Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: Javed A. Aslam
@inproceedings{DBLP:conf/recsys/AzizAJWBA22,
author = {Maryam Aziz and
Jesse Anderton and
Kevin Jamieson and
Alice Wang and
Hugues Bouchard and
Javed A. Aslam},
editor = {Jennifer Golbeck and
F. Maxwell Harper and
Vanessa Murdock and
Michael D. Ekstrand and
Bracha Shapira and
Justin Basilico and
Keld T. Lundgaard and
Even Oldridge},
title = {Identifying New Podcasts with High General Appeal Using a Pure Exploration
Infinitely-Armed Bandit Strategy},
booktitle = {RecSys '22: Sixteenth {ACM} Conference on Recommender Systems, Seattle,
WA, USA, September 18 - 23, 2022},
pages = {134--144},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3523227.3546766},
doi = {10.1145/3523227.3546766},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/recsys/AzizAJWBA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/QinLPA21,
author = {Kechen Qin and
Cheng Li and
Virgil Pavlu and
Javed A. Aslam},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {Improving Query Graph Generation for Complex Question Answering over
Knowledge Base},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {4201--4207},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.346},
doi = {10.18653/V1/2021.EMNLP-MAIN.346},
timestamp = {Fri, 16 Feb 2024 08:27:36 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/QinLPA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-10970,
author = {Kechen Qin and
Yu Wang and
Cheng Li and
Kalpa Gunaratna and
Hongxia Jin and
Virgil Pavlu and
Javed A. Aslam},
title = {A Complex {KBQA} System using Multiple Reasoning Paths},
journal = {CoRR},
volume = {abs/2005.10970},
year = {2020},
url = {https://arxiv.org/abs/2005.10970},
eprinttype = {arXiv},
eprint = {2005.10970},
timestamp = {Mon, 12 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-10970.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/AndertonA19,
author = {Jesse Anderton and
Javed A. Aslam},
editor = {Kamalika Chaudhuri and
Ruslan Salakhutdinov},
title = {Scaling Up Ordinal Embedding: {A} Landmark Approach},
booktitle = {Proceedings of the 36th International Conference on Machine Learning,
{ICML} 2019, 9-15 June 2019, Long Beach, California, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {97},
pages = {282--290},
publisher = {{PMLR}},
year = {2019},
url = {http://proceedings.mlr.press/v97/anderton19a.html},
timestamp = {Tue, 11 Jun 2019 15:37:38 +0200},
biburl = {https://dblp.org/rec/conf/icml/AndertonA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/QinLPA19,
author = {Kechen Qin and
Cheng Li and
Virgil Pavlu and
Javed A. Aslam},
editor = {Jill Burstein and
Christy Doran and
Thamar Solorio},
title = {Adapting {RNN} Sequence Prediction Model to Multi-label Set Prediction},
booktitle = {Proceedings of the 2019 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long
and Short Papers)},
pages = {3181--3190},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/n19-1321},
doi = {10.18653/V1/N19-1321},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/QinLPA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pkdd/LiPAWQ19,
author = {Cheng Li and
Virgil Pavlu and
Javed A. Aslam and
Bingyu Wang and
Kechen Qin},
editor = {Ulf Brefeld and
{\'{E}}lisa Fromont and
Andreas Hotho and
Arno J. Knobbe and
Marloes H. Maathuis and
C{\'{e}}line Robardet},
title = {Learning to Calibrate and Rerank Multi-label Predictions},
booktitle = {Machine Learning and Knowledge Discovery in Databases - European Conference,
{ECML} {PKDD} 2019, W{\"{u}}rzburg, Germany, September 16-20,
2019, Proceedings, Part {III}},
series = {Lecture Notes in Computer Science},
volume = {11908},
pages = {220--236},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-46133-1\_14},
doi = {10.1007/978-3-030-46133-1\_14},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pkdd/LiPAWQ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-05829,
author = {Kechen Qin and
Cheng Li and
Virgil Pavlu and
Javed A. Aslam},
title = {Adapting {RNN} Sequence Prediction Model to Multi-label Set Prediction},
journal = {CoRR},
volume = {abs/1904.05829},
year = {2019},
url = {http://arxiv.org/abs/1904.05829},
eprinttype = {arXiv},
eprint = {1904.05829},
timestamp = {Thu, 25 Apr 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-05829.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/alt/AzizAKA18,
author = {Maryam Aziz and
Jesse Anderton and
Emilie Kaufmann and
Javed A. Aslam},
editor = {Firdaus Janoos and
Mehryar Mohri and
Karthik Sridharan},
title = {Pure Exploration in Infinitely-Armed Bandit Models with Fixed-Confidence},
booktitle = {Algorithmic Learning Theory, {ALT} 2018, 7-9 April 2018, Lanzarote,
Canary Islands, Spain},
series = {Proceedings of Machine Learning Research},
volume = {83},
pages = {3--24},
publisher = {{PMLR}},
year = {2018},
url = {http://proceedings.mlr.press/v83/aziz18a.html},
timestamp = {Wed, 03 Apr 2019 18:17:24 +0200},
biburl = {https://dblp.org/rec/conf/alt/AzizAKA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/WangLPA18,
author = {Bingyu Wang and
Cheng Li and
Virgil Pavlu and
Jay Aslam},
editor = {M. Arif Wani and
Mehmed M. Kantardzic and
Moamar Sayed Mouchaweh and
Jo{\~{a}}o Gama and
Edwin Lughofer},
title = {A Pipeline for Optimizing F1-Measure in Multi-label Text Classification},
booktitle = {17th {IEEE} International Conference on Machine Learning and Applications,
{ICMLA} 2018, Orlando, FL, USA, December 17-20, 2018},
pages = {913--918},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/ICMLA.2018.00148},
doi = {10.1109/ICMLA.2018.00148},
timestamp = {Mon, 30 Nov 2020 08:47:24 +0100},
biburl = {https://dblp.org/rec/conf/icmla/WangLPA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1802-05929,
author = {Jesse Anderton and
Pavel Metrikov and
Virgil Pavlu and
Javed A. Aslam},
title = {Measuring Human-perceived Similarity in Heterogeneous Collections},
journal = {CoRR},
volume = {abs/1802.05929},
year = {2018},
url = {http://arxiv.org/abs/1802.05929},
eprinttype = {arXiv},
eprint = {1802.05929},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1802-05929.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1803-04665,
author = {Maryam Aziz and
Jesse Anderton and
Emilie Kaufmann and
Javed A. Aslam},
title = {Pure Exploration in Infinitely-Armed Bandit Models with Fixed-Confidence},
journal = {CoRR},
volume = {abs/1803.04665},
year = {2018},
url = {http://arxiv.org/abs/1803.04665},
eprinttype = {arXiv},
eprint = {1803.04665},
timestamp = {Tue, 17 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1803-04665.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-07589,
author = {Jesse Anderton and
Virgil Pavlu and
Javed A. Aslam},
title = {Revealing the Basis: Ordinal Embedding Through Geometry},
journal = {CoRR},
volume = {abs/1805.07589},
year = {2018},
url = {http://arxiv.org/abs/1805.07589},
eprinttype = {arXiv},
eprint = {1805.07589},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-07589.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-07592,
author = {Maryam Aziz and
Jesse Anderton and
Javed A. Aslam},
title = {Adaptively Pruning Features for Boosted Decision Trees},
journal = {CoRR},
volume = {abs/1805.07592},
year = {2018},
url = {http://arxiv.org/abs/1805.07592},
eprinttype = {arXiv},
eprint = {1805.07592},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-07592.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WangLPA17,
author = {Bingyu Wang and
Cheng Li and
Virgil Pavlu and
Javed A. Aslam},
title = {Regularizing Model Complexity and Label Structure for Multi-Label
Text Classification},
journal = {CoRR},
volume = {abs/1705.00740},
year = {2017},
url = {http://arxiv.org/abs/1705.00740},
eprinttype = {arXiv},
eprint = {1705.00740},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/WangLPA17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/LiWPA16,
author = {Cheng Li and
Bingyu Wang and
Virgil Pavlu and
Javed A. Aslam},
editor = {Nicola Ferro and
Fabio Crestani and
Marie{-}Francine Moens and
Josiane Mothe and
Fabrizio Silvestri and
Giorgio Maria Di Nunzio and
Claudia Hauff and
Gianmaria Silvello},
title = {An Empirical Study of Skip-Gram Features and Regularization for Learning
on Sentiment Analysis},
booktitle = {Advances in Information Retrieval - 38th European Conference on {IR}
Research, {ECIR} 2016, Padua, Italy, March 20-23, 2016. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {9626},
pages = {72--87},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-30671-1\_6},
doi = {10.1007/978-3-319-30671-1\_6},
timestamp = {Sun, 25 Oct 2020 22:33:09 +0100},
biburl = {https://dblp.org/rec/conf/ecir/LiWPA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/LiWPA16,
author = {Cheng Li and
Bingyu Wang and
Virgil Pavlu and
Javed A. Aslam},
editor = {Maria{-}Florina Balcan and
Kilian Q. Weinberger},
title = {Conditional Bernoulli Mixtures for Multi-label Classification},
booktitle = {Proceedings of the 33nd International Conference on Machine Learning,
{ICML} 2016, New York City, NY, USA, June 19-24, 2016},
series = {{JMLR} Workshop and Conference Proceedings},
volume = {48},
pages = {2482--2491},
publisher = {JMLR.org},
year = {2016},
url = {http://proceedings.mlr.press/v48/lij16.html},
timestamp = {Wed, 29 May 2019 08:41:46 +0200},
biburl = {https://dblp.org/rec/conf/icml/LiWPA16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigir/2016,
editor = {Raffaele Perego and
Fabrizio Sebastiani and
Javed A. Aslam and
Ian Ruthven and
Justin Zobel},
title = {Proceedings of the 39th International {ACM} {SIGIR} conference on
Research and Development in Information Retrieval, {SIGIR} 2016, Pisa,
Italy, July 17-21, 2016},
publisher = {{ACM}},
year = {2016},
url = {https://doi.org/10.1145/2911451},
doi = {10.1145/2911451},
isbn = {978-1-4503-4069-4},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/2016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/snam/FadaeeFSAP15,
author = {Saber Shokat Fadaee and
Mehrdad Farajtabar and
Ravi Sundaram and
Javed A. Aslam and
Nikos I. Passas},
title = {On the network you keep: analyzing persons of interest using Cliqster},
journal = {Soc. Netw. Anal. Min.},
volume = {5},
number = {1},
pages = {63:1--63:14},
year = {2015},
url = {https://doi.org/10.1007/s13278-015-0302-0},
doi = {10.1007/S13278-015-0302-0},
timestamp = {Tue, 08 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/snam/FadaeeFSAP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/MetrikovPA15,
author = {Pavel Metrikov and
Virgil Pavlu and
Javed A. Aslam},
editor = {James Bailey and
Alistair Moffat and
Charu C. Aggarwal and
Maarten de Rijke and
Ravi Kumar and
Vanessa Murdock and
Timos K. Sellis and
Jeffrey Xu Yu},
title = {Aggregation of Crowdsourced Ordinal Assessments and Integration with
Learning to Rank: {A} Latent Trait Model},
booktitle = {Proceedings of the 24th {ACM} International Conference on Information
and Knowledge Management, {CIKM} 2015, Melbourne, VIC, Australia,
October 19 - 23, 2015},
pages = {1391--1400},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2806416.2806492},
doi = {10.1145/2806416.2806492},
timestamp = {Mon, 26 Apr 2021 09:27:03 +0200},
biburl = {https://dblp.org/rec/conf/cikm/MetrikovPA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iros/YuAKR15,
author = {Jingjin Yu and
Javed A. Aslam and
Sertac Karaman and
Daniela Rus},
title = {Anytime planning of optimal schedules for a mobile sensing robot},
booktitle = {2015 {IEEE/RSJ} International Conference on Intelligent Robots and
Systems, {IROS} 2015, Hamburg, Germany, September 28 - October 2,
2015},
pages = {5279--5286},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/IROS.2015.7354122},
doi = {10.1109/IROS.2015.7354122},
timestamp = {Wed, 16 Oct 2019 14:14:51 +0200},
biburl = {https://dblp.org/rec/conf/iros/YuAKR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlsp/AzmandianKDA15,
author = {Fatemeh Azmandian and
David R. Kaeli and
Jennifer G. Dy and
Javed A. Aslam},
editor = {Deniz Erdogmus and
Murat Ak{\c{c}}akaya and
Suleyman Serdar Kozat and
Jan Larsen},
title = {Securing virtual execution environments through machine learning-based
intrusion detection},
booktitle = {25th {IEEE} International Workshop on Machine Learning for Signal
Processing, {MLSP} 2015, Boston, MA, USA, September 17-20, 2015},
pages = {1--6},
publisher = {{IEEE}},
year = {2015},
url = {https://doi.org/10.1109/MLSP.2015.7324345},
doi = {10.1109/MLSP.2015.7324345},
timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
biburl = {https://dblp.org/rec/conf/mlsp/AzmandianKDA15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/AslamDEMPS15,
author = {Javed A. Aslam and
Fernando Diaz and
Matthew Ekstrand{-}Abueg and
Richard McCreadie and
Virgil Pavlu and
Tetsuya Sakai},
editor = {Ellen M. Voorhees and
Angela Ellis},
title = {{TREC} 2015 Temporal Summarization Track Overview},
booktitle = {Proceedings of The Twenty-Fourth Text REtrieval Conference, {TREC}
2015, Gaithersburg, Maryland, USA, November 17-20, 2015},
series = {{NIST} Special Publication},
volume = {500-319},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2015},
url = {http://trec.nist.gov/pubs/trec24/papers/Overview-TS.pdf},
timestamp = {Wed, 03 Feb 2021 08:31:23 +0100},
biburl = {https://dblp.org/rec/conf/trec/AslamDEMPS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/FadaeeFSAP15,
author = {Saber Shokat Fadaee and
Mehrdad Farajtabar and
Ravi Sundaram and
Javed A. Aslam and
Nikos I. Passas},
title = {On The Network You Keep: Analyzing Persons of Interest using Cliqster},
journal = {CoRR},
volume = {abs/1510.01374},
year = {2015},
url = {http://arxiv.org/abs/1510.01374},
eprinttype = {arXiv},
eprint = {1510.01374},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/FadaeeFSAP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcst/AzmandianYDAK14,
author = {Fatemeh Azmandian and
Ayse Yilmazer and
Jennifer G. Dy and
Javed A. Aslam and
David R. Kaeli},
title = {Harnessing the Power of GPUs to Speed Up Feature Selection for Outlier
Detection},
journal = {J. Comput. Sci. Technol.},
volume = {29},
number = {3},
pages = {408--422},
year = {2014},
url = {https://doi.org/10.1007/s11390-014-1439-4},
doi = {10.1007/S11390-014-1439-4},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jcst/AzmandianYDAK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asunam/FadaeeFSAP14,
author = {Saber Shokat Fadaee and
Mehrdad Farajtabar and
Ravi Sundaram and
Javed A. Aslam and
Nikos I. Passas},
editor = {Xindong Wu and
Martin Ester and
Guandong Xu},
title = {The network you keep: Analyzing persons of interest using cliqster},
booktitle = {2014 {IEEE/ACM} International Conference on Advances in Social Networks
Analysis and Mining, {ASONAM} 2014, Beijing, China, August 17-20,
2014},
pages = {122--129},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/ASONAM.2014.6921571},
doi = {10.1109/ASONAM.2014.6921571},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/asunam/FadaeeFSAP14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/GolbusA14,
author = {Peter B. Golbus and
Javed A. Aslam},
editor = {Shlomo Geva and
Andrew Trotman and
Peter Bruza and
Charles L. A. Clarke and
Kalervo J{\"{a}}rvelin},
title = {On the information difference between standard retrieval models},
booktitle = {The 37th International {ACM} {SIGIR} Conference on Research and Development
in Information Retrieval, {SIGIR} '14, Gold Coast , QLD, Australia
- July 06 - 11, 2014},
pages = {1135--1138},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2600428.2609528},
doi = {10.1145/2600428.2609528},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/GolbusA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/AslamEPDMS14,
author = {Javed A. Aslam and
Matthew Ekstrand{-}Abueg and
Virgil Pavlu and
Fernando Diaz and
Richard McCreadie and
Tetsuya Sakai},
editor = {Ellen M. Voorhees and
Angela Ellis},
title = {{TREC} 2014 Temporal Summarization Track Overview},
booktitle = {Proceedings of The Twenty-Third Text REtrieval Conference, {TREC}
2014, Gaithersburg, Maryland, USA, November 19-21, 2014},
series = {{NIST} Special Publication},
volume = {500-308},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2014},
url = {http://trec.nist.gov/pubs/trec23/papers/overview-tempsumm.pdf},
timestamp = {Wed, 03 Feb 2021 08:31:24 +0100},
biburl = {https://dblp.org/rec/conf/trec/AslamEPDMS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/YuAKR14,
author = {Jingjin Yu and
Javed A. Aslam and
Sertac Karaman and
Daniela Rus},
title = {Optimal Tourist Problem and Anytime Planning of Trip Itineraries},
journal = {CoRR},
volume = {abs/1409.8536},
year = {2014},
url = {http://arxiv.org/abs/1409.8536},
eprinttype = {arXiv},
eprint = {1409.8536},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/YuAKR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/GolbusAC13,
author = {Peter B. Golbus and
Javed A. Aslam and
Charles L. A. Clarke},
title = {Increasing evaluation sensitivity to diversity},
journal = {Inf. Retr.},
volume = {16},
number = {4},
pages = {530--555},
year = {2013},
url = {https://doi.org/10.1007/s10791-012-9218-8},
doi = {10.1007/S10791-012-9218-8},
timestamp = {Sat, 27 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ir/GolbusAC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/AndertonBPA13,
author = {Jesse Anderton and
Maryam Bashir and
Virgil Pavlu and
Javed A. Aslam},
editor = {Qi He and
Arun Iyengar and
Wolfgang Nejdl and
Jian Pei and
Rajeev Rastogi},
title = {An analysis of crowd workers mistakes for specific and complex relevance
assessment task},
booktitle = {22nd {ACM} International Conference on Information and Knowledge Management,
CIKM'13, San Francisco, CA, USA, October 27 - November 1, 2013},
pages = {1873--1876},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2505515.2507884},
doi = {10.1145/2505515.2507884},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/AndertonBPA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/MetrikovPA13,
author = {Pavel Metrikov and
Virgiliu Pavlu and
Javed A. Aslam},
editor = {Pavel Serdyukov and
Pavel Braslavski and
Sergei O. Kuznetsov and
Jaap Kamps and
Stefan M. R{\"{u}}ger and
Eugene Agichtein and
Ilya Segalovich and
Emine Yilmaz},
title = {Optimizing nDCG Gains by Minimizing Effect of Label Inconsistency},
booktitle = {Advances in Information Retrieval - 35th European Conference on {IR}
Research, {ECIR} 2013, Moscow, Russia, March 24-27, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7814},
pages = {760--763},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-36973-5\_78},
doi = {10.1007/978-3-642-36973-5\_78},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/ecir/MetrikovPA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictir/MetrikovWAPA13,
author = {Pavel Metrikov and
Jie Wu and
Jesse Anderton and
Virgil Pavlu and
Javed A. Aslam},
editor = {Oren Kurland and
Donald Metzler and
Christina Lioma and
Birger Larsen and
Peter Ingwersen},
title = {A Modification of LambdaMART to Handle Noisy Crowdsourced Assessments},
booktitle = {International Conference on the Theory of Information Retrieval, {ICTIR}
'13, Copenhagen, Denmark, September 29 - October 02, 2013},
pages = {31},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2499178.2499198},
doi = {10.1145/2499178.2499198},
timestamp = {Sat, 14 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ictir/MetrikovWAPA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/GolbusA13,
author = {Peter B. Golbus and
Javed A. Aslam},
editor = {Gareth J. F. Jones and
Paraic Sheridan and
Diane Kelly and
Maarten de Rijke and
Tetsuya Sakai},
title = {A mutual information-based framework for the analysis of information
retrieval systems},
booktitle = {The 36th International {ACM} {SIGIR} conference on research and development
in Information Retrieval, {SIGIR} '13, Dublin, Ireland - July 28 -
August 01, 2013},
pages = {683--692},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2484028.2484073},
doi = {10.1145/2484028.2484073},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/GolbusA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/BashirAWGPA13,
author = {Maryam Bashir and
Jesse Anderton and
Jie Wu and
Peter B. Golbus and
Virgil Pavlu and
Javed A. Aslam},
editor = {Gareth J. F. Jones and
Paraic Sheridan and
Diane Kelly and
Maarten de Rijke and
Tetsuya Sakai},
title = {A document rating system for preference judgements},
booktitle = {The 36th International {ACM} {SIGIR} conference on research and development
in Information Retrieval, {SIGIR} '13, Dublin, Ireland - July 28 -
August 01, 2013},
pages = {909--912},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2484028.2484170},
doi = {10.1145/2484028.2484170},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/BashirAWGPA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/Ekstrand-AbuegPA13,
author = {Matthew Ekstrand{-}Abueg and
Virgil Pavlu and
Javed A. Aslam},
editor = {Gareth J. F. Jones and
Paraic Sheridan and
Diane Kelly and
Maarten de Rijke and
Tetsuya Sakai},
title = {Live nuggets extractor: a semi-automated system for text extraction
and test collection creation},
booktitle = {The 36th International {ACM} {SIGIR} conference on research and development
in Information Retrieval, {SIGIR} '13, Dublin, Ireland - July 28 -
August 01, 2013},
pages = {1087--1088},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2484028.2484211},
doi = {10.1145/2484028.2484211},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/Ekstrand-AbuegPA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/AslamEPDS13,
author = {Javed A. Aslam and
Matthew Ekstrand{-}Abueg and
Virgil Pavlu and
Fernando Diaz and
Tetsuya Sakai},
editor = {Ellen M. Voorhees},
title = {{TREC} 2013 Temporal Summarization},
booktitle = {Proceedings of The Twenty-Second Text REtrieval Conference, {TREC}
2013, Gaithersburg, Maryland, USA, November 19-22, 2013},
series = {{NIST} Special Publication},
volume = {500-302},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2013},
url = {http://trec.nist.gov/pubs/trec22/papers/TS.OVERVIEW.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/AslamEPDS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/BashirAPA13,
author = {Maryam Bashir and
Jesse Anderton and
Virgil Pavlu and
Javed A. Aslam},
editor = {Ellen M. Voorhees},
title = {Northeastern University Runs at the {TREC13} Crowdsourcing Track},
booktitle = {Proceedings of The Twenty-Second Text REtrieval Conference, {TREC}
2013, Gaithersburg, Maryland, USA, November 19-22, 2013},
series = {{NIST} Special Publication},
volume = {500-302},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2013},
url = {http://trec.nist.gov/pubs/trec22/papers/northeastern-crowd.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/BashirAPA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/RajputEPA12,
author = {Shahzad Rajput and
Matthew Ekstrand{-}Abueg and
Virgiliu Pavlu and
Javed A. Aslam},
editor = {Xue{-}wen Chen and
Guy Lebanon and
Haixun Wang and
Mohammed J. Zaki},
title = {Constructing test collections by inferring document relevance via
extracted relevant information},
booktitle = {21st {ACM} International Conference on Information and Knowledge Management,
CIKM'12, Maui, HI, USA, October 29 - November 02, 2012},
pages = {145--154},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2396761.2396783},
doi = {10.1145/2396761.2396783},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/RajputEPA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/DaiPKA12,
author = {Keshi Dai and
Virgiliu Pavlu and
Evangelos Kanoulas and
Javed A. Aslam},
editor = {Ricardo Baeza{-}Yates and
Arjen P. de Vries and
Hugo Zaragoza and
Berkant Barla Cambazoglu and
Vanessa Murdock and
Ronny Lempel and
Fabrizio Silvestri},
title = {Extended Expectation Maximization for Inferring Score Distributions},
booktitle = {Advances in Information Retrieval - 34th European Conference on {IR}
Research, {ECIR} 2012, Barcelona, Spain, April 1-5, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7224},
pages = {293--304},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-28997-2\_25},
doi = {10.1007/978-3-642-28997-2\_25},
timestamp = {Mon, 28 Aug 2023 21:17:41 +0200},
biburl = {https://dblp.org/rec/conf/ecir/DaiPKA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/AlshawabkehADK12,
author = {Malak Alshawabkeh and
Javed A. Aslam and
Jennifer G. Dy and
David R. Kaeli},
editor = {Mohammed Javeed Zaki and
Arno Siebes and
Jeffrey Xu Yu and
Bart Goethals and
Geoffrey I. Webb and
Xindong Wu},
title = {Feature Weighting and Selection Using Hypothesis Margin of Boosting},
booktitle = {12th {IEEE} International Conference on Data Mining, {ICDM} 2012,
Brussels, Belgium, December 10-13, 2012},
pages = {41--50},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICDM.2012.143},
doi = {10.1109/ICDM.2012.143},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/AlshawabkehADK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/AzmandianYDAK12,
author = {Fatemeh Azmandian and
Ayse Yilmazer and
Jennifer G. Dy and
Javed A. Aslam and
David R. Kaeli},
editor = {Mohammed Javeed Zaki and
Arno Siebes and
Jeffrey Xu Yu and
Bart Goethals and
Geoffrey I. Webb and
Xindong Wu},
title = {GPU-Accelerated Feature Selection for Outlier Detection Using the
Local Kernel Density Ratio},
booktitle = {12th {IEEE} International Conference on Data Mining, {ICDM} 2012,
Brussels, Belgium, December 10-13, 2012},
pages = {51--60},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ICDM.2012.51},
doi = {10.1109/ICDM.2012.51},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/AzmandianYDAK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/AslamLR12,
author = {Javed A. Aslam and
Sejoon Lim and
Daniela Rus},
title = {Congestion-aware Traffic Routing System using sensor data},
booktitle = {15th International {IEEE} Conference on Intelligent Transportation
Systems, {ITSC} 2012, Anchorage, AK, USA, September 16-19, 2012},
pages = {1006--1013},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ITSC.2012.6338663},
doi = {10.1109/ITSC.2012.6338663},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/itsc/AslamLR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/itsc/VolkovAR12,
author = {Mikhail Volkov and
Javed A. Aslam and
Daniela Rus},
title = {Markov-based redistribution policy model for future urban mobility
networks},
booktitle = {15th International {IEEE} Conference on Intelligent Transportation
Systems, {ITSC} 2012, Anchorage, AK, USA, September 16-19, 2012},
pages = {1906--1911},
publisher = {{IEEE}},
year = {2012},
url = {https://doi.org/10.1109/ITSC.2012.6338848},
doi = {10.1109/ITSC.2012.6338848},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/itsc/VolkovAR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/AslamLPR12,
author = {Javed A. Aslam and
Sejoon Lim and
Xinghao Pan and
Daniela Rus},
editor = {M. Rasit Eskicioglu and
Andrew Campbell and
Koen Langendoen},
title = {City-scale traffic estimation from a roving sensor network},
booktitle = {The 10th {ACM} Conference on Embedded Network Sensor Systems, SenSys
'12, Toronto, ON, Canada, November 6-9, 2012},
pages = {141--154},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2426656.2426671},
doi = {10.1145/2426656.2426671},
timestamp = {Fri, 10 Dec 2021 17:15:01 +0100},
biburl = {https://dblp.org/rec/conf/sensys/AslamLPR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/MetrikovPA12,
author = {Pavel Metrikov and
Virgiliu Pavlu and
Javed A. Aslam},
editor = {William R. Hersh and
Jamie Callan and
Yoelle Maarek and
Mark Sanderson},
title = {Impact of assessor disagreement on ranking performance},
booktitle = {The 35th International {ACM} {SIGIR} conference on research and development
in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16,
2012},
pages = {1091--1092},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2348283.2348484},
doi = {10.1145/2348283.2348484},
timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
biburl = {https://dblp.org/rec/conf/sigir/MetrikovPA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/BashirAWEGPA12,
author = {Maryam Bashir and
Jesse Anderton and
Jie Wu and
Matthew Ekstrand{-}Abueg and
Peter B. Golbus and
Virgil Pavlu and
Javed A. Aslam},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {Northeastern University Runs at the {TREC12} Crowdsourcing Track},
booktitle = {Proceedings of The Twenty-First Text REtrieval Conference, {TREC}
2012, Gaithersburg, Maryland, USA, November 6-9, 2012},
series = {{NIST} Special Publication},
volume = {500-298},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2012},
url = {http://trec.nist.gov/pubs/trec21/papers/NEU.crowd.final.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/BashirAWEGPA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsdm/PavluRGA12,
author = {Virgiliu Pavlu and
Shahzad Rajput and
Peter B. Golbus and
Javed A. Aslam},
editor = {Eytan Adar and
Jaime Teevan and
Eugene Agichtein and
Yoelle Maarek},
title = {{IR} system evaluation using nugget-based test collections},
booktitle = {Proceedings of the Fifth International Conference on Web Search and
Web Data Mining, {WSDM} 2012, Seattle, WA, USA, February 8-12, 2012},
pages = {393--402},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2124295.2124343},
doi = {10.1145/2124295.2124343},
timestamp = {Tue, 21 May 2019 11:38:33 +0200},
biburl = {https://dblp.org/rec/conf/wsdm/PavluRGA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:journals/jmlr/AzmandianDAK12,
author = {Fatemeh Azmandian and
Jennifer G. Dy and
Javed A. Aslam and
David R. Kaeli},
editor = {Steven C. H. Hoi and
Wray L. Buntine},
title = {Local Kernel Density Ratio-Based Feature Selection for Outlier Detection},
booktitle = {Proceedings of the 4th Asian Conference on Machine Learning, {ACML}
2012, Singapore, Singapore, November 4-6, 2012},
series = {{JMLR} Proceedings},
volume = {25},
pages = {49--64},
publisher = {JMLR.org},
year = {2012},
url = {http://proceedings.mlr.press/v25/azmandian12.html},
timestamp = {Wed, 29 May 2019 08:41:47 +0200},
biburl = {https://dblp.org/rec/journals/jmlr/AzmandianDAK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/DaiKPA11,
author = {Keshi Dai and
Evangelos Kanoulas and
Virgiliu Pavlu and
Javed A. Aslam},
title = {Variational bayes for modeling score distributions},
journal = {Inf. Retr.},
volume = {14},
number = {1},
pages = {47--67},
year = {2011},
url = {https://doi.org/10.1007/s10791-010-9156-2},
doi = {10.1007/S10791-010-9156-2},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ir/DaiKPA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigops/AzmandianMADAK11,
author = {Fatemeh Azmandian and
Micha Moffie and
Malak Alshawabkeh and
Jennifer G. Dy and
Javed A. Aslam and
David R. Kaeli},
title = {Virtual machine monitor-based lightweight intrusion detection},
journal = {{ACM} {SIGOPS} Oper. Syst. Rev.},
volume = {45},
number = {2},
pages = {38--53},
year = {2011},
url = {https://doi.org/10.1145/2007183.2007189},
doi = {10.1145/2007183.2007189},
timestamp = {Tue, 14 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigops/AzmandianMADAK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/RajputPGA11,
author = {Shahzad Rajput and
Virgiliu Pavlu and
Peter B. Golbus and
Javed A. Aslam},
editor = {Craig Macdonald and
Iadh Ounis and
Ian Ruthven},
title = {A nugget-based test collection construction paradigm},
booktitle = {Proceedings of the 20th {ACM} Conference on Information and Knowledge
Management, {CIKM} 2011, Glasgow, United Kingdom, October 24-28, 2011},
pages = {1945--1948},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2063576.2063861},
doi = {10.1145/2063576.2063861},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/RajputPGA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/AlshawabkehADK11,
author = {Malak Alshawabkeh and
Javed A. Aslam and
Jennifer G. Dy and
David R. Kaeli},
editor = {Xue{-}wen Chen and
Tharam S. Dillon and
Hisao Ishibuchi and
Jian Pei and
Haixun Wang and
M. Arif Wani},
title = {Feature Selection Metric Using {AUC} Margin for Small Samples and
Imbalanced Data Classification Problems},
booktitle = {10th International Conference on Machine Learning and Applications
and Workshops, {ICMLA} 2011, Honolulu, Hawaii, USA, December 18-21,
2011. Volume 1: Main Conference},
pages = {145--150},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICMLA.2011.70},
doi = {10.1109/ICMLA.2011.70},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmla/AlshawabkehADK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictai/AlshawabkehAKD11,
author = {Malak Alshawabkeh and
Javed A. Aslam and
David R. Kaeli and
Jennifer G. Dy},
title = {A Novel Feature Selection for Intrusion Detection in Virtual Machine
Environments},
booktitle = {{IEEE} 23rd International Conference on Tools with Artificial Intelligence,
{ICTAI} 2011, Boca Raton, FL, USA, November 7-9, 2011},
pages = {879--881},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICTAI.2011.138},
doi = {10.1109/ICTAI.2011.138},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ictai/AlshawabkehAKD11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mascots/AzmandianMDAK11,
author = {Fatemeh Azmandian and
Micha Moffie and
Jennifer G. Dy and
Javed A. Aslam and
David R. Kaeli},
title = {Workload Characterization at the Virtualization Layer},
booktitle = {{MASCOTS} 2011, 19th Annual {IEEE/ACM} International Symposium on
Modeling, Analysis and Simulation of Computer and Telecommunication
Systems, Singapore, 25-27 July, 2011},
pages = {63--72},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/MASCOTS.2011.63},
doi = {10.1109/MASCOTS.2011.63},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mascots/AzmandianMDAK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/KanoulasSMPA11,
author = {Evangelos Kanoulas and
Stefan Savev and
Pavel Metrikov and
Virgiliu Pavlu and
Javed A. Aslam},
editor = {Wei{-}Ying Ma and
Jian{-}Yun Nie and
Ricardo Baeza{-}Yates and
Tat{-}Seng Chua and
W. Bruce Croft},
title = {A large-scale study of the effect of training set characteristics
over learning-to-rank algorithms},
booktitle = {Proceeding of the 34th International {ACM} {SIGIR} Conference on Research
and Development in Information Retrieval, {SIGIR} 2011, Beijing, China,
July 25-29, 2011},
pages = {1243--1244},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2009916.2010140},
doi = {10.1145/2009916.2010140},
timestamp = {Sun, 22 Sep 2019 18:15:38 +0200},
biburl = {https://dblp.org/rec/conf/sigir/KanoulasSMPA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/AlshawabkehMAADK10,
author = {Malak Alshawabkeh and
Micha Moffie and
Fatemeh Azmandian and
Javed A. Aslam and
Jennifer G. Dy and
David R. Kaeli},
editor = {Sorin Draghici and
Taghi M. Khoshgoftaar and
Vasile Palade and
Witold Pedrycz and
M. Arif Wani and
Xingquan Zhu},
title = {Effective Virtual Machine Monitor Intrusion Detection Using Feature
Selection on Highly Imbalanced Data},
booktitle = {The Ninth International Conference on Machine Learning and Applications,
{ICMLA} 2010, Washington, DC, USA, 12-14 December 2010},
pages = {823--827},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ICMLA.2010.127},
doi = {10.1109/ICMLA.2010.127},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmla/AlshawabkehMAADK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/KanoulasDPA10,
author = {Evangelos Kanoulas and
Keshi Dai and
Virgiliu Pavlu and
Javed A. Aslam},
editor = {Fabio Crestani and
St{\'{e}}phane Marchand{-}Maillet and
Hsin{-}Hsi Chen and
Efthimis N. Efthimiadis and
Jacques Savoy},
title = {Score distribution models: assumptions, intuition, and robustness
to score manipulation},
booktitle = {Proceeding of the 33rd International {ACM} {SIGIR} Conference on Research
and Development in Information Retrieval, {SIGIR} 2010, Geneva, Switzerland,
July 19-23, 2010},
pages = {242--249},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1835449.1835491},
doi = {10.1145/1835449.1835491},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/KanoulasDPA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/is/FeuerSA09,
author = {Alan Feuer and
Stefan Savev and
Javed A. Aslam},
title = {Implementing and evaluating phrasal query suggestions for proximity
search},
journal = {Inf. Syst.},
volume = {34},
number = {8},
pages = {711--723},
year = {2009},
url = {https://doi.org/10.1016/j.is.2009.03.012},
doi = {10.1016/J.IS.2009.03.012},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/is/FeuerSA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/KanoulasA09,
author = {Evangelos Kanoulas and
Javed A. Aslam},
editor = {David Wai{-}Lok Cheung and
Il{-}Yeol Song and
Wesley W. Chu and
Xiaohua Hu and
Jimmy Lin},
title = {Empirical justification of the gain and discount function for nDCG},
booktitle = {Proceedings of the 18th {ACM} Conference on Information and Knowledge
Management, {CIKM} 2009, Hong Kong, China, November 2-6, 2009},
pages = {611--620},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1645953.1646032},
doi = {10.1145/1645953.1646032},
timestamp = {Fri, 27 Aug 2021 11:13:00 +0200},
biburl = {https://dblp.org/rec/conf/cikm/KanoulasA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/CarterettePKAA09,
author = {Ben Carterette and
Virgiliu Pavlu and
Evangelos Kanoulas and
Javed A. Aslam and
James Allan},
editor = {Mohand Boughanem and
Catherine Berrut and
Josiane Mothe and
Chantal Soul{\'{e}}{-}Dupuy},
title = {If {I} Had a Million Queries},
booktitle = {Advances in Information Retrieval, 31th European Conference on {IR}
Research, {ECIR} 2009, Toulouse, France, April 6-9, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5478},
pages = {288--300},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-00958-7\_27},
doi = {10.1007/978-3-642-00958-7\_27},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/ecir/CarterettePKAA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictir/KanoulasPDA09,
author = {Evangelos Kanoulas and
Virgiliu Pavlu and
Keshi Dai and
Javed A. Aslam},
editor = {Leif Azzopardi and
Gabriella Kazai and
Stephen E. Robertson and
Stefan M. R{\"{u}}ger and
Milad Shokouhi and
Dawei Song and
Emine Yilmaz},
title = {Modeling the Score Distributions of Relevant and Non-relevant Documents},
booktitle = {Advances in Information Retrieval Theory, Second International Conference
on the Theory of Information Retrieval, {ICTIR} 2009, Cambridge, UK,
September 10-12, 2009, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5766},
pages = {152--163},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-04417-5\_14},
doi = {10.1007/978-3-642-04417-5\_14},
timestamp = {Tue, 14 May 2019 10:00:40 +0200},
biburl = {https://dblp.org/rec/conf/ictir/KanoulasPDA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamKPSY09,
author = {Javed A. Aslam and
Evangelos Kanoulas and
Virgiliu Pavlu and
Stefan Savev and
Emine Yilmaz},
editor = {James Allan and
Javed A. Aslam and
Mark Sanderson and
ChengXiang Zhai and
Justin Zobel},
title = {Document selection methodologies for efficient and effective learning-to-rank},
booktitle = {Proceedings of the 32nd Annual International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval, {SIGIR} 2009,
Boston, MA, USA, July 19-23, 2009},
pages = {468--475},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1571941.1572022},
doi = {10.1145/1571941.1572022},
timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamKPSY09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/KanoulasDPSA09,
author = {Evangelos Kanoulas and
Keshi Dai and
Virgiliu Pavlu and
Stefan Savev and
Javed A. Aslam},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {Northeastern University in {TREC} 2009 Million Query Track},
booktitle = {Proceedings of The Eighteenth Text REtrieval Conference, {TREC} 2009,
Gaithersburg, Maryland, USA, November 17-20, 2009},
series = {{NIST} Special Publication},
volume = {500-278},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2009},
url = {http://trec.nist.gov/pubs/trec18/papers/northeasternu.MQ.pdf},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/KanoulasDPSA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RajputKPA09,
author = {Shahzad Rajput and
Evangelos Kanoulas and
Virgiliu Pavlu and
Javed A. Aslam},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {Northeastern University in the {TREC} 2009 Web Track},
booktitle = {Proceedings of The Eighteenth Text REtrieval Conference, {TREC} 2009,
Gaithersburg, Maryland, USA, November 17-20, 2009},
series = {{NIST} Special Publication},
volume = {500-278},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2009},
url = {http://trec.nist.gov/pubs/trec18/papers/northeasternu.WEB.pdf},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/RajputKPA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigir/2009,
editor = {James Allan and
Javed A. Aslam and
Mark Sanderson and
ChengXiang Zhai and
Justin Zobel},
title = {Proceedings of the 32nd Annual International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval, {SIGIR} 2009,
Boston, MA, USA, July 19-23, 2009},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1571941},
doi = {10.1145/1571941},
isbn = {978-1-60558-483-6},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/2009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kais/YilmazA08,
author = {Emine Yilmaz and
Javed A. Aslam},
title = {Estimating average precision when judgments are incomplete},
journal = {Knowl. Inf. Syst.},
volume = {16},
number = {2},
pages = {173--211},
year = {2008},
url = {https://doi.org/10.1007/s10115-007-0101-7},
doi = {10.1007/S10115-007-0101-7},
timestamp = {Sun, 28 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/kais/YilmazA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YilmazAR08,
author = {Emine Yilmaz and
Javed A. Aslam and
Stephen Robertson},
editor = {Sung{-}Hyon Myaeng and
Douglas W. Oard and
Fabrizio Sebastiani and
Tat{-}Seng Chua and
Mun{-}Kew Leong},
title = {A new rank correlation coefficient for information retrieval},
booktitle = {Proceedings of the 31st Annual International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval, {SIGIR} 2008,
Singapore, July 20-24, 2008},
pages = {587--594},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1390334.1390435},
doi = {10.1145/1390334.1390435},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigir/YilmazAR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YilmazKA08,
author = {Emine Yilmaz and
Evangelos Kanoulas and
Javed A. Aslam},
editor = {Sung{-}Hyon Myaeng and
Douglas W. Oard and
Fabrizio Sebastiani and
Tat{-}Seng Chua and
Mun{-}Kew Leong},
title = {A simple and efficient sampling method for estimating {AP} and {NDCG}},
booktitle = {Proceedings of the 31st Annual International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval, {SIGIR} 2008,
Singapore, July 20-24, 2008},
pages = {603--610},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1390334.1390437},
doi = {10.1145/1390334.1390437},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/YilmazKA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CarterettePKAA08,
author = {Ben Carterette and
Virgiliu Pavlu and
Evangelos Kanoulas and
Javed A. Aslam and
James Allan},
editor = {Sung{-}Hyon Myaeng and
Douglas W. Oard and
Fabrizio Sebastiani and
Tat{-}Seng Chua and
Mun{-}Kew Leong},
title = {Evaluation over thousands of queries},
booktitle = {Proceedings of the 31st Annual International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval, {SIGIR} 2008,
Singapore, July 20-24, 2008},
pages = {651--658},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1390334.1390445},
doi = {10.1145/1390334.1390445},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/CarterettePKAA08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/AllanAPKC08,
author = {James Allan and
Javed A. Aslam and
Virgil Pavlu and
Evangelos Kanoulas and
Ben Carterette},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {Million Query Track 2008 Overview},
booktitle = {Proceedings of The Seventeenth Text REtrieval Conference, {TREC} 2008,
Gaithersburg, Maryland, USA, November 18-21, 2008},
series = {{NIST} Special Publication},
volume = {500-277},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2008},
url = {https://trec.nist.gov/pubs/trec17/papers/MQ.OVERVIEW.pdf},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/AllanAPKC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uss/AslamPR08,
author = {Javed A. Aslam and
Raluca A. Popa and
Ronald L. Rivest},
editor = {David L. Dill and
Tadayoshi Kohno},
title = {On Auditing Elections When Precincts Have Different Sizes},
booktitle = {2008 {USENIX/ACCURATE} Electronic Voting Workshop, {EVT} 2008, July
28-29, 2008, San Jose, CA, USA, Proceedings},
publisher = {{USENIX} Association},
year = {2008},
url = {http://www.usenix.org/events/evt08/tech/full\_papers/aslam/aslam.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/uss/AslamPR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/AslamY07,
author = {Javed A. Aslam and
Emine Yilmaz},
editor = {M{\'{a}}rio J. Silva and
Alberto H. F. Laender and
Ricardo A. Baeza{-}Yates and
Deborah L. McGuinness and
Bj{\o}rn Olstad and
{\O}ystein Haug Olsen and
Andr{\'{e}} O. Falc{\~{a}}o},
title = {Inferring document relevance from incomplete information},
booktitle = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge
Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007},
pages = {633--642},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1321440.1321529},
doi = {10.1145/1321440.1321529},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/AslamY07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/FeuerSA07,
author = {Alan Feuer and
Stefan Savev and
Javed A. Aslam},
editor = {M{\'{a}}rio J. Silva and
Alberto H. F. Laender and
Ricardo A. Baeza{-}Yates and
Deborah L. McGuinness and
Bj{\o}rn Olstad and
{\O}ystein Haug Olsen and
Andr{\'{e}} O. Falc{\~{a}}o},
title = {Evaluation of phrasal query suggestions},
booktitle = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge
Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007},
pages = {841--848},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1321440.1321556},
doi = {10.1145/1321440.1321556},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/FeuerSA07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/AslamP07,
author = {Javed A. Aslam and
Virgiliu Pavlu},
editor = {Giambattista Amati and
Claudio Carpineto and
Giovanni Romano},
title = {Query Hardness Estimation Using Jensen-Shannon Divergence Among Multiple
Scoring Functions},
booktitle = {Advances in Information Retrieval, 29th European Conference on {IR}
Research, {ECIR} 2007, Rome, Italy, April 2-5, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4425},
pages = {198--209},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-71496-5\_20},
doi = {10.1007/978-3-540-71496-5\_20},
timestamp = {Sat, 30 Sep 2023 09:39:25 +0200},
biburl = {https://dblp.org/rec/conf/ecir/AslamP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/AllanCDAPK07,
author = {James Allan and
Ben Carterette and
Blagovest Dachev and
Javed A. Aslam and
Virgiliu Pavlu and
Evangelos Kanoulas},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {Million Query Track 2007 Overview},
booktitle = {Proceedings of The Sixteenth Text REtrieval Conference, {TREC} 2007,
Gaithersburg, Maryland, USA, November 5-9, 2007},
series = {{NIST} Special Publication},
volume = {500-274},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2007},
url = {http://trec.nist.gov/pubs/trec16/papers/1MQ.OVERVIEW16.pdf},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/AllanCDAPK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/AslamPZ07,
author = {Javed A. Aslam and
Virgiliu Pavlu and
Olena Zubaryeva},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {The Hedge Algorithm for Metasearch at {TREC} 2007},
booktitle = {Proceedings of The Sixteenth Text REtrieval Conference, {TREC} 2007,
Gaithersburg, Maryland, USA, November 5-9, 2007},
series = {{NIST} Special Publication},
volume = {500-274},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2007},
url = {http://trec.nist.gov/pubs/trec16/papers/northeasternu.mq.final.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/trec/AslamPZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/uss/AslamPR07,
author = {Javed A. Aslam and
Raluca A. Popa and
Ronald L. Rivest},
editor = {Ray Martinez and
David A. Wagner},
title = {On Estimating the Size and Confidence of a Statistical Audit},
booktitle = {2007 {USENIX/ACCURATE} Electronic Voting Technology Workshop, EVT'07,
Boston, MA, USA, August 6, 2007},
publisher = {{USENIX} Association},
year = {2007},
url = {https://www.usenix.org/conference/evt-07/estimating-size-and-confidence-statistical-audit},
timestamp = {Mon, 01 Feb 2021 08:42:55 +0100},
biburl = {https://dblp.org/rec/conf/uss/AslamPR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/YilmazA06,
author = {Emine Yilmaz and
Javed A. Aslam},
editor = {Philip S. Yu and
Vassilis J. Tsotras and
Edward A. Fox and
Bing Liu},
title = {Estimating average precision with incomplete and imperfect judgments},
booktitle = {Proceedings of the 2006 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Arlington, Virginia, USA, November 6-11,
2006},
pages = {102--111},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1183614.1183633},
doi = {10.1145/1183614.1183633},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/YilmazA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmla/AslamBP06,
author = {Javed A. Aslam and
Sergey Bratus and
Virgiliu Pavlu},
editor = {M. Arif Wani and
Tao Li and
Lukasz A. Kurgan and
Jieping Ye and
Ying Liu},
title = {Semi-supervised Data Organization for Interactive Anomaly Analysis},
booktitle = {The Fifth International Conference on Machine Learning and Applications,
{ICMLA} 2006, Orlando, Florida, USA, 14-16 December 2006},
pages = {55--62},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICMLA.2006.47},
doi = {10.1109/ICMLA.2006.47},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmla/AslamBP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamPY06,
author = {Javed A. Aslam and
Virgiliu Pavlu and
Emine Yilmaz},
editor = {Efthimis N. Efthimiadis and
Susan T. Dumais and
David Hawking and
Kalervo J{\"{a}}rvelin},
title = {A statistical method for system evaluation using incomplete judgments},
booktitle = {{SIGIR} 2006: Proceedings of the 29th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Seattle,
Washington, USA, August 6-11, 2006},
pages = {541--548},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1148170.1148263},
doi = {10.1145/1148170.1148263},
timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamPY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamY06,
author = {Javed A. Aslam and
Emine Yilmaz},
editor = {Efthimis N. Efthimiadis and
Susan T. Dumais and
David Hawking and
Kalervo J{\"{a}}rvelin},
title = {Inferring document relevance via average precision},
booktitle = {{SIGIR} 2006: Proceedings of the 29th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Seattle,
Washington, USA, August 6-11, 2006},
pages = {601--602},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1148170.1148275},
doi = {10.1145/1148170.1148275},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/AslamPR06,
author = {Javed A. Aslam and
Virgiliu Pavlu and
Carlos Rei},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {The Hedge Algorithm for Metasearch at {TREC} 2006},
booktitle = {Proceedings of the Fifteenth Text REtrieval Conference, {TREC} 2006,
Gaithersburg, Maryland, USA, November 14-17, 2006},
series = {{NIST} Special Publication},
volume = {500-272},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2006},
url = {http://trec.nist.gov/pubs/trec15/papers/northeasternu.tera.final.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/AslamPR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/AslamPR06,
author = {Javed A. Aslam and
Ekaterina Pelekhov and
Daniela Rus},
editor = {Jacob Kogan and
Charles K. Nicholas and
Marc Teboulle},
title = {The Star Clustering Algorithm for Information Organization},
booktitle = {Grouping Multidimensional Data - Recent Advances in Clustering},
pages = {1--23},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/3-540-28349-8\_1},
doi = {10.1007/3-540-28349-8\_1},
timestamp = {Tue, 16 May 2017 14:01:41 +0200},
biburl = {https://dblp.org/rec/books/daglib/p/AslamPR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijeb/AslamPR05,
author = {Javed A. Aslam and
Ekaterina Pelekhov and
Daniela Rus},
title = {Persistent queries over dynamic text streams},
journal = {Int. J. Electron. Bus.},
volume = {3},
number = {3/4},
pages = {288--299},
year = {2005},
url = {https://doi.org/10.1504/IJEB.2005.007273},
doi = {10.1504/IJEB.2005.007273},
timestamp = {Thu, 16 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijeb/AslamPR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/AslamY05,
author = {Javed A. Aslam and
Emine Yilmaz},
editor = {Otthein Herzog and
Hans{-}J{\"{o}}rg Schek and
Norbert Fuhr and
Abdur Chowdhury and
Wilfried Teiken},
title = {A geometric interpretation and analysis of R-precision},
booktitle = {Proceedings of the 2005 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Bremen, Germany, October 31 - November 5,
2005},
pages = {664--671},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1099554.1099721},
doi = {10.1145/1099554.1099721},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/AslamY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamYP05,
author = {Javed A. Aslam and
Emine Yilmaz and
Virgiliu Pavlu},
editor = {Ricardo A. Baeza{-}Yates and
Nivio Ziviani and
Gary Marchionini and
Alistair Moffat and
John Tait},
title = {The maximum entropy method for analyzing retrieval measures},
booktitle = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Salvador,
Brazil, August 15-19, 2005},
pages = {27--34},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1076034.1076042},
doi = {10.1145/1076034.1076042},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamYP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamPY05,
author = {Javed A. Aslam and
Virgiliu Pavlu and
Emine Yilmaz},
editor = {Ricardo A. Baeza{-}Yates and
Nivio Ziviani and
Gary Marchionini and
Alistair Moffat and
John Tait},
title = {Measure-based metasearch},
booktitle = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Salvador,
Brazil, August 15-19, 2005},
pages = {571--572},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1076034.1076133},
doi = {10.1145/1076034.1076133},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamPY05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamYP05a,
author = {Javed A. Aslam and
Emine Yilmaz and
Virgiliu Pavlu},
editor = {Ricardo A. Baeza{-}Yates and
Nivio Ziviani and
Gary Marchionini and
Alistair Moffat and
John Tait},
title = {A geometric interpretation of r-precision and its correlation with
average precision},
booktitle = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Salvador,
Brazil, August 15-19, 2005},
pages = {573--574},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1076034.1076134},
doi = {10.1145/1076034.1076134},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamYP05a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieeesp/AslamBKPTR04,
author = {Javed A. Aslam and
Sergey Bratus and
David Kotz and
Ronald A. Peterson and
Brett Tofel and
Daniela Rus},
title = {The Kerf Toolkit for Intrusion Analysis},
journal = {{IEEE} Secur. Priv.},
volume = {2},
number = {6},
pages = {42--52},
year = {2004},
url = {https://doi.org/10.1109/MSP.2004.113},
doi = {10.1109/MSP.2004.113},
timestamp = {Sun, 15 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ieeesp/AslamBKPTR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jgaa/AslamPR04,
author = {Javed A. Aslam and
Ekaterina Pelekhov and
Daniela Rus},
title = {The Star Clustering Algorithm for Static and Dynamic Information Organization},
journal = {J. Graph Algorithms Appl.},
volume = {8},
pages = {95--129},
year = {2004},
url = {https://doi.org/10.7155/jgaa.00084},
doi = {10.7155/JGAA.00084},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jgaa/AslamPR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wicomm/AslamLR03,
author = {Javed A. Aslam and
Qun Li and
Daniela Rus},
title = {Three power-aware routing algorithms for sensor networks},
journal = {Wirel. Commun. Mob. Comput.},
volume = {3},
number = {2},
pages = {187--208},
year = {2003},
url = {https://doi.org/10.1002/wcm.111},
doi = {10.1002/WCM.111},
timestamp = {Thu, 21 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wicomm/AslamLR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/AslamPS03,
author = {Javed A. Aslam and
Virgiliu Pavlu and
Robert Savell},
title = {A unified model for metasearch, pooling, and system evaluation},
booktitle = {Proceedings of the 2003 {ACM} {CIKM} International Conference on Information
and Knowledge Management, New Orleans, Louisiana, USA, November 2-8,
2003},
pages = {484--491},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/956863.956953},
doi = {10.1145/956863.956953},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/AslamPS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/LiAR03,
author = {Qun Li and
Javed A. Aslam and
Daniela Rus},
title = {Distributed Energy-conserving Routing Protocols},
booktitle = {36th Hawaii International Conference on System Sciences {(HICSS-36}
2003), {CD-ROM} / Abstracts Proceedings, January 6-9, 2003, Big Island,
HI, {USA}},
pages = {301},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/HICSS.2003.1174850},
doi = {10.1109/HICSS.2003.1174850},
timestamp = {Thu, 21 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hicss/LiAR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iaw/AslamBKPRT03,
author = {Javed A. Aslam and
Sergey Bratus and
David Kotz and
Ronald A. Peterson and
Daniela Rus and
Brett Tofel},
title = {The Kerf toolkit for intrusion analysis},
booktitle = {{IEEE} Systems, Man and Cybernetics Society Information Assurance
Workshop, June 18-20, 2003, West Point, New York, {USA}},
pages = {301--302},
publisher = {{IEEE}},
year = {2003},
timestamp = {Tue, 11 Sep 2007 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iaw/AslamBKPRT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/AslamBCCCR03,
author = {Javed A. Aslam and
Zack J. Butler and
Florin Constantin and
Valentino Crespi and
George Cybenko and
Daniela Rus},
editor = {Ian F. Akyildiz and
Deborah Estrin and
David E. Culler and
Mani B. Srivastava},
title = {Tracking a moving object with a binary sensor network},
booktitle = {Proceedings of the 1st International Conference on Embedded Networked
Sensor Systems, SenSys 2003, Los Angeles, California, USA, November
5-7, 2003},
pages = {150--161},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/958491.958509},
doi = {10.1145/958491.958509},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sensys/AslamBCCCR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamS03,
author = {Javed A. Aslam and
Robert Savell},
editor = {Charles L. A. Clarke and
Gordon V. Cormack and
Jamie Callan and
David Hawking and
Alan F. Smeaton},
title = {On the effectiveness of evaluating retrieval systems in the absence
of relevance judgments},
booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
28 - August 1, 2003, Toronto, Canada},
pages = {361--362},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/860435.860501},
doi = {10.1145/860435.860501},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamPS03,
author = {Javed A. Aslam and
Virgiliu Pavlu and
Robert Savell},
editor = {Charles L. A. Clarke and
Gordon V. Cormack and
Jamie Callan and
David Hawking and
Alan F. Smeaton},
title = {A unified model for metasearch and the efficient evaluation of retrieval
systems via the hedge algorithm},
booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
28 - August 1, 2003, Toronto, Canada},
pages = {393--394},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/860435.860517},
doi = {10.1145/860435.860517},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamPS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamF03,
author = {Javed A. Aslam and
Meredith Frost},
editor = {Charles L. A. Clarke and
Gordon V. Cormack and
Jamie Callan and
David Hawking and
Alan F. Smeaton},
title = {An information-theoretic measure for document similarity},
booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
28 - August 1, 2003, Toronto, Canada},
pages = {449--450},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/860435.860545},
doi = {10.1145/860435.860545},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamF03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/MontagueA02,
author = {Mark H. Montague and
Javed A. Aslam},
title = {Condorcet fusion for improved retrieval},
booktitle = {Proceedings of the 2002 {ACM} {CIKM} International Conference on Information
and Knowledge Management, McLean, VA, USA, November 4-9, 2002},
pages = {538--548},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/584792.584881},
doi = {10.1145/584792.584881},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/MontagueA02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-DS-0205008,
author = {Javed A. Aslam and
April Rasala and
Clifford Stein and
Neal E. Young},
title = {Improved Bicriteria Existence Theorems for Scheduling},
journal = {CoRR},
volume = {cs.DS/0205008},
year = {2002},
url = {https://arxiv.org/abs/cs/0205008},
timestamp = {Mon, 17 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/cs-DS-0205008.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/MontagueA01,
author = {Mark H. Montague and
Javed A. Aslam},
title = {Relevance Score Normalization for Metasearch},
booktitle = {Proceedings of the 2001 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Atlanta, Georgia, USA, November 5-10, 2001},
pages = {427--433},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/502585.502657},
doi = {10.1145/502585.502657},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/MontagueA01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mobicom/LiAR01,
author = {Qun Li and
Javed A. Aslam and
Daniela Rus},
editor = {Christopher Rose},
title = {Online power-aware routing in wireless Ad-hoc networks},
booktitle = {{MOBICOM} 2001, Proceedings of the seventh annual international conference
on Mobile computing and networking, Rome, Italy, July 16-21, 2001},
pages = {97--107},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/381677.381687},
doi = {10.1145/381677.381687},
timestamp = {Thu, 21 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mobicom/LiAR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamM01,
author = {Javed A. Aslam and
Mark H. Montague},
editor = {W. Bruce Croft and
David J. Harper and
Donald H. Kraft and
Justin Zobel},
title = {Models for Metasearch},
booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, September
9-13, 2001, New Orleans, Louisiana, {USA}},
pages = {275--284},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/383952.384007},
doi = {10.1145/383952.384007},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamM01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamM01a,
author = {Javed A. Aslam and
Mark H. Montague},
editor = {W. Bruce Croft and
David J. Harper and
Donald H. Kraft and
Justin Zobel},
title = {Metasearch Consistency},
booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, September
9-13, 2001, New Orleans, Louisiana, {USA}},
pages = {386--387},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/383952.384030},
doi = {10.1145/383952.384030},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamM01a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/AslamPR00,
author = {Javed A. Aslam and
Katya Pelekhov and
Daniela Rus},
title = {Using Star Clusters for Filtering},
booktitle = {Proceedings of the 2000 {ACM} {CIKM} International Conference on Information
and Knowledge Management, McLean, VA, USA, November 6-11, 2000},
pages = {306--313},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/354756.354833},
doi = {10.1145/354756.354833},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/AslamPR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/Aslam00,
author = {Javed A. Aslam},
editor = {Nicol{\`{o}} Cesa{-}Bianchi and
Sally A. Goldman},
title = {Improving Algorithms for Boosting},
booktitle = {Proceedings of the Thirteenth Annual Conference on Computational Learning
Theory {(COLT} 2000), June 28 - July 1, 2000, Palo Alto, California,
{USA}},
pages = {200--207},
publisher = {Morgan Kaufmann},
year = {2000},
timestamp = {Wed, 20 Jun 2018 17:06:15 +0200},
biburl = {https://dblp.org/rec/conf/colt/Aslam00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/riao/AslamRR00,
author = {Jay Aslam and
Frederick Reiss and
Daniela Rus},
editor = {Joseph{-}Jean Mariani and
Donna Harman},
title = {Scalable Information Organization Information Retrieval},
booktitle = {Computer-Assisted Information Retrieval (Recherche d'Information et
ses Applications) - {RIAO} 2000, 6th International Conference, College
de France, France, April 12-14, 2000. Proceedings},
pages = {1033--1042},
publisher = {{CID}},
year = {2000},
url = {https://dl.acm.org/doi/10.5555/2856151.2856161},
doi = {10.5555/2856151.2856161},
timestamp = {Fri, 20 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/riao/AslamRR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/AslamM00,
author = {Javed A. Aslam and
Mark H. Montague},
editor = {Emmanuel J. Yannakoudakis and
Nicholas J. Belkin and
Peter Ingwersen and
Mun{-}Kew Leong},
title = {Bayes optimal metasearch: a probabilistic model for combining the
results},
booktitle = {{SIGIR} 2000: Proceedings of the 23rd Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
24-28, 2000, Athens, Greece},
pages = {379--381},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/345508.345665},
doi = {10.1145/345508.345665},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/AslamM00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wae/AslamLS00,
author = {Javed A. Aslam and
Alain Leblanc and
Clifford Stein},
editor = {Stefan N{\"{a}}her and
Dorothea Wagner},
title = {Clustering Data without Prior Knowledge},
booktitle = {Algorithm Engineering, 4th International Workshop, {WAE} 2000, Saarbr{\"{u}}cken,
Germany, September 5-8, 2000, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1982},
pages = {74--86},
publisher = {Springer},
year = {2000},
url = {https://doi.org/10.1007/3-540-44691-5\_7},
doi = {10.1007/3-540-44691-5\_7},
timestamp = {Fri, 07 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wae/AslamLS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/soda/AslamPR99,
author = {Javed A. Aslam and
Katya Pelekhov and
Daniela Rus},
editor = {Robert Endre Tarjan and
Tandy J. Warnow},
title = {A Practical Clustering Algorithm for Static and Dynamic Information
Organization},
booktitle = {Proceedings of the Tenth Annual {ACM-SIAM} Symposium on Discrete Algorithms,
17-19 January 1999, Baltimore, Maryland, {USA}},
pages = {51--60},
publisher = {{ACM/SIAM}},
year = {1999},
url = {http://dl.acm.org/citation.cfm?id=314500.314530},
timestamp = {Thu, 05 Jul 2018 07:29:57 +0200},
biburl = {https://dblp.org/rec/conf/soda/AslamPR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/soda/AslamRSY99,
author = {Javed A. Aslam and
April Rasala and
Clifford Stein and
Neal E. Young},
editor = {Robert Endre Tarjan and
Tandy J. Warnow},
title = {Improved Bicriteria Existence Theorems for Scheduling},
booktitle = {Proceedings of the Tenth Annual {ACM-SIAM} Symposium on Discrete Algorithms,
17-19 January 1999, Baltimore, Maryland, {USA}},
pages = {846--847},
publisher = {{ACM/SIAM}},
year = {1999},
url = {http://dl.acm.org/citation.cfm?id=314500.314963},
timestamp = {Mon, 17 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/soda/AslamRSY99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iandc/AslamD98,
author = {Javed A. Aslam and
Scott E. Decatur},
title = {General Bounds on Statistical Query Learning and {PAC} Learning with
Noise via Hypothesis Boosting},
journal = {Inf. Comput.},
volume = {141},
number = {2},
pages = {85--118},
year = {1998},
url = {https://doi.org/10.1006/inco.1998.2664},
doi = {10.1006/INCO.1998.2664},
timestamp = {Fri, 12 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/iandc/AslamD98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcss/AslamD98,
author = {Javed A. Aslam and
Scott E. Decatur},
title = {Specification and Simulation of Statistical Query Algorithms for Efficiency
and Noise Tolerance},
journal = {J. Comput. Syst. Sci.},
volume = {56},
number = {2},
pages = {191--208},
year = {1998},
url = {https://doi.org/10.1006/jcss.1997.1558},
doi = {10.1006/JCSS.1997.1558},
timestamp = {Tue, 16 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jcss/AslamD98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/AslamPR98,
author = {Javed A. Aslam and
Katya Pelekhov and
Daniela Rus},
editor = {Georges Gardarin and
James C. French and
Niki Pissinou and
Kia Makki and
Luc Bouganim},
title = {Static and Dynamic Information Organization with Star Clusters},
booktitle = {Proceedings of the 1998 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Bethesda, Maryland, USA, November 3-7, 1998},
pages = {208--217},
publisher = {{ACM}},
year = {1998},
url = {https://doi.org/10.1145/288627.288659},
doi = {10.1145/288627.288659},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/AslamPR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ep/AslamPR98,
author = {Javed A. Aslam and
Katya Pelekhov and
Daniela Rus},
editor = {Ethan V. Munson and
Charles K. Nicholas and
Derick Wood},
title = {Generating, Visualizing, and Evaluating High-Quality Clusters for
Information Organization},
booktitle = {Principles of Digital Document Processing, 4th International Workshop,
PODDP'98, Saint Malo, France, March 29-30, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1481},
pages = {53--69},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/3-540-49654-8\_5},
doi = {10.1007/3-540-49654-8\_5},
timestamp = {Tue, 14 May 2019 10:00:48 +0200},
biburl = {https://dblp.org/rec/conf/ep/AslamPR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipl/AslamD96,
author = {Javed A. Aslam and
Scott E. Decatur},
title = {On the Sample Complexity of Noise-Tolerant Learning},
journal = {Inf. Process. Lett.},
volume = {57},
number = {4},
pages = {189--195},
year = {1996},
url = {https://doi.org/10.1016/0020-0190(96)00006-3},
doi = {10.1016/0020-0190(96)00006-3},
timestamp = {Fri, 26 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ipl/AslamD96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/ndltd/Aslam95,
author = {Javed A. Aslam},
title = {Noise tolerant algorithms for learning and searching},
school = {Massachusetts Institute of Technology, Cambridge, MA, {USA}},
year = {1995},
url = {https://hdl.handle.net/1721.1/36533},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/ndltd/Aslam95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/AslamD95,
author = {Javed A. Aslam and
Scott E. Decatur},
editor = {Wolfgang Maass},
title = {Specification and Simulation of Statistical Query Algorithms for Efficiency
and Noise Tolerance},
booktitle = {Proceedings of the Eigth Annual Conference on Computational Learning
Theory, {COLT} 1995, Santa Cruz, California, USA, July 5-8, 1995},
pages = {437--446},
publisher = {{ACM}},
year = {1995},
url = {https://doi.org/10.1145/225298.225351},
doi = {10.1145/225298.225351},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/colt/AslamD95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/AslamD93,
author = {Javed A. Aslam and
Aditi Dhagat},
title = {On-Line Algorithms for 2-Coloring Hypergraphs Via Chip Games},
journal = {Theor. Comput. Sci.},
volume = {112},
number = {2},
pages = {355--369},
year = {1993},
url = {https://doi.org/10.1016/0304-3975(93)90025-O},
doi = {10.1016/0304-3975(93)90025-O},
timestamp = {Wed, 17 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tcs/AslamD93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/focs/AslamD93,
author = {Javed A. Aslam and
Scott E. Decatur},
title = {General Bounds on Statistical Query Learning and {PAC} Learning with
Noise via Hypothesis Bounding},
booktitle = {34th Annual Symposium on Foundations of Computer Science, Palo Alto,
California, USA, 3-5 November 1993},
pages = {282--291},
publisher = {{IEEE} Computer Society},
year = {1993},
url = {https://doi.org/10.1109/SFCS.1993.366859},
doi = {10.1109/SFCS.1993.366859},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/focs/AslamD93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/stoc/AslamD91,
author = {Javed A. Aslam and
Aditi Dhagat},
editor = {Cris Koutsougeras and
Jeffrey Scott Vitter},
title = {Searching in the Presence of Linearly Bounded Errors (Extended Abstract)},
booktitle = {Proceedings of the 23rd Annual {ACM} Symposium on Theory of Computing,
May 5-8, 1991, New Orleans, Louisiana, {USA}},
pages = {486--493},
publisher = {{ACM}},
year = {1991},
url = {https://doi.org/10.1145/103418.103469},
doi = {10.1145/103418.103469},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/stoc/AslamD91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/colt/AslamR90,
author = {Javed A. Aslam and
Ronald L. Rivest},
editor = {Mark A. Fulk and
John Case},
title = {Inferring Graphs from Walks},
booktitle = {Proceedings of the Third Annual Workshop on Computational Learning
Theory, {COLT} 1990, University of Rochester, Rochester, NY, USA,
August 6-8, 1990},
pages = {359--370},
publisher = {Morgan Kaufmann},
year = {1990},
url = {http://dl.acm.org/citation.cfm?id=92670},
timestamp = {Fri, 23 Dec 2011 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/colt/AslamR90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-04-25 05:41 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
