Stop the war!
Остановите войну!
for scientists:
default search action
BibTeX records: Alejandro Rodríguez González
@article{DBLP:journals/corr/abs-2402-10967, author = {Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Isa{\'{\i}}as Garc{\'{\i}}a{-}Rodr{\'{\i}}guez and Carmen Benavides and H{\'{e}}ctor Alaiz{-}Moret{\'{o}}n and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Social network analysis for personalized characterization and risk assessment of alcohol use disorders in adolescents using semantic technologies}, journal = {CoRR}, volume = {abs/2402.10967}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.10967}, doi = {10.48550/ARXIV.2402.10967}, eprinttype = {arXiv}, eprint = {2402.10967}, timestamp = {Mon, 26 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-10967.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2402-12390, author = {Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Carmen Benavides and Leticia S{\'{a}}nchez{-}Valde{\'{o}}n and Isa{\'{\i}}as Garc{\'{\i}}a}, title = {A Semantic Social Network Analysis Tool for Sensitivity Analysis and What-If Scenario Testing in Alcohol Consumption Studies}, journal = {CoRR}, volume = {abs/2402.12390}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.12390}, doi = {10.48550/ARXIV.2402.12390}, eprinttype = {arXiv}, eprint = {2402.12390}, timestamp = {Thu, 21 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-12390.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/artmed/MunozSCSG23, author = {Adri{\'{a}}n Ayuso Mu{\~{n}}oz and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Esther Ugarte Carro and Emilio Serrano and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Uncovering hidden therapeutic indications through drug repurposing with graph neural networks and heterogeneous data}, journal = {Artif. Intell. Medicine}, volume = {145}, pages = {102687}, year = {2023}, url = {https://doi.org/10.1016/j.artmed.2023.102687}, doi = {10.1016/J.ARTMED.2023.102687}, timestamp = {Sun, 17 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/artmed/MunozSCSG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/semweb/AisoposJNPRSIVM23, author = {Fotis Aisopos and Samaneh Jozashoori and Emetis Niazmand and Disha Purohit and Ariam Rivas and Ahmad Sakor and Enrique Iglesias and Dimitrios Vogiatzis and Ernestina Menasalvas and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Guillermo Vigueras and Daniel G{\'{o}}mez{-}Bravo and Maria Torrente and Roberto Hern{\'{a}}ndez L{\'{o}}pez and Mariano Provencio Pulla and Athanasios Dalianis and Anna Triantafillou and Georgios Paliouras and Maria{-}Esther Vidal}, title = {Knowledge graphs for enhancing transparency in health data ecosystems}, journal = {Semantic Web}, volume = {14}, number = {5}, pages = {943--976}, year = {2023}, url = {https://doi.org/10.3233/SW-223294}, doi = {10.3233/SW-223294}, timestamp = {Sat, 03 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/semweb/AisoposJNPRSIVM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/PerezSCOMG23, author = {Andrea {\'{A}}lvarez P{\'{e}}rez and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Esther Ugarte Carro and Bel{\'{e}}n Otero{-}Carrasco and Adri{\'{a}}n Ayuso Mu{\~{n}}oz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Jo{\~{a}}o Rafael Almeida and Myra Spiliopoulou and Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Giuseppe Placidi and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rosa Sicilia and Bridget Kane}, title = {Exploring disease-drug pairs in Clinical Trials information for personalized drug repurposing}, booktitle = {36th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023}, pages = {179--184}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CBMS58004.2023.00213}, doi = {10.1109/CBMS58004.2023.00213}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/PerezSCOMG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/OteroCarrascoRPMSHG23, author = {Bel{\'{e}}n Otero{-}Carrasco and Santiago Romero{-}Brufau and Andrea {\'{A}}lvarez P{\'{e}}rez and Adri{\'{a}}n Ayuso Mu{\~{n}}oz and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Juan Pedro Cara{\c{c}}a{-}Valente Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Jo{\~{a}}o Rafael Almeida and Myra Spiliopoulou and Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Giuseppe Placidi and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rosa Sicilia and Bridget Kane}, title = {Orphan Drugs and Rare Diseases: Unveiling Biological Patterns through Drug Repurposing}, booktitle = {36th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023}, pages = {185--191}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CBMS58004.2023.00214}, doi = {10.1109/CBMS58004.2023.00214}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/OteroCarrascoRPMSHG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/MunozSAOSG23, author = {Adri{\'{a}}n Ayuso Mu{\~{n}}oz and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Andrea {\'{A}}lverez{-}P{\'{e}}rez and Bel{\'{e}}n Otero{-}Carrasco and Emilio Serrano and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Jo{\~{a}}o Rafael Almeida and Myra Spiliopoulou and Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Giuseppe Placidi and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rosa Sicilia and Bridget Kane}, title = {Enhancing Drug Repurposing on Graphs by Integrating Drug Molecular Structure as Feature}, booktitle = {36th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023}, pages = {192--197}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CBMS58004.2023.00215}, doi = {10.1109/CBMS58004.2023.00215}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/MunozSAOSG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GomezBravoGVRPOTMPG23, author = {Daniel G{\'{o}}mez{-}Bravo and Aaron Garc{\'{\i}}a and Guillermo Vigueras and Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and Alejandra P{\'{e}}rez{-}Garc{\'{\i}}a and Vanessa Ospina and Mar{\'{\i}}a Torrente and Ernestina Menasalvas and Mariano Provencio and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Jo{\~{a}}o Rafael Almeida and Myra Spiliopoulou and Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Giuseppe Placidi and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rosa Sicilia and Bridget Kane}, title = {Clustering-based Pattern Discovery in Lung Cancer Treatments}, booktitle = {36th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023}, pages = {694--699}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CBMS58004.2023.00302}, doi = {10.1109/CBMS58004.2023.00302}, timestamp = {Mon, 24 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/GomezBravoGVRPOTMPG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pacbb/Tejera-NevadoSG23, author = {Paloma Tejera{-}Nevado and Emilio Serrano and Ana Gonz{\'{a}}lez{-}Herrero and Rodrigo Bermejo{-}Moreno and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Miguel Rocha and Florentino Fdez{-}Riverola and Mohd Saberi Mohamad and Ana Bel{\'{e}}n Gil Gonz{\'{a}}lez}, title = {Analysis of the Confidence in the Prediction of the Protein Folding by Artificial Intelligence}, booktitle = {Practical Applications of Computational Biology and Bioinformatics, 17th International Conference {(PACBB} 2023), 12th-14th July, 2023, Guimar{\~{a}}es, Portugal}, series = {Lecture Notes in Networks and Systems}, volume = {743}, pages = {84--93}, publisher = {Springer}, year = {2023}, url = {https://doi.org/10.1007/978-3-031-38079-2\_9}, doi = {10.1007/978-3-031-38079-2\_9}, timestamp = {Mon, 17 Jul 2023 15:40:46 +0200}, biburl = {https://dblp.org/rec/conf/pacbb/Tejera-NevadoSG23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cbms/2023, editor = {Jo{\~{a}}o Rafael Almeida and Myra Spiliopoulou and Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Giuseppe Placidi and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rosa Sicilia and Bridget Kane}, title = {36th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CBMS58004.2023}, doi = {10.1109/CBMS58004.2023}, isbn = {979-8-3503-1224-9}, timestamp = {Mon, 24 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/2023.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2307-15089, author = {Daniel G{\'{o}}mez{-}Bravo and Aaron Garc{\'{\i}}a and Guillermo Vigueras and Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {A new algorithm for Subgroup Set Discovery based on Information Gain}, journal = {CoRR}, volume = {abs/2307.15089}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2307.15089}, doi = {10.48550/ARXIV.2307.15089}, eprinttype = {arXiv}, eprint = {2307.15089}, timestamp = {Wed, 02 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2307-15089.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/istr/Diaz-HonrubiaBS22, author = {Antonio Jes{\'{u}}s D{\'{\i}}az{-}Honrubia and Alberto Bl{\'{a}}zquez{-}Herranz and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Gustavo {Gonzalez Granadillo} and Rodrigo Diaz and Emmanouil Panaousis and Christos Xenakis}, title = {A Trusted Platform Module-based, Pre-emptive and Dynamic Asset Discovery Tool}, journal = {J. Inf. Secur. Appl.}, volume = {71}, pages = {103350}, year = {2022}, url = {https://doi.org/10.1016/j.jisa.2022.103350}, doi = {10.1016/J.JISA.2022.103350}, timestamp = {Tue, 28 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/istr/Diaz-HonrubiaBS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/peerj-cs/PabonMTGPM22, author = {Oswaldo Solarte Pab{\'{o}}n and Orlando Montenegro and Maria Torrente and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Mariano Provencio and Ernestina Menasalvas}, title = {Negation and uncertainty detection in clinical texts written in Spanish: a deep learning-based approach}, journal = {PeerJ Comput. Sci.}, volume = {8}, pages = {e913}, year = {2022}, url = {https://doi.org/10.7717/peerj-cs.913}, doi = {10.7717/PEERJ-CS.913}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/peerj-cs/PabonMTGPM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/Gomez-BravoGVRO22, author = {Daniel G{\'{o}}mez{-}Bravo and Aaron Garc{\'{\i}}a and Guillermo Vigueras and Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and Bel{\'{e}}n Otero and Roberto Hern{\'{a}}ndez L{\'{o}}pez and Mar{\'{\i}}a Torrente and Ernestina Menasalvas and Mariano Provencio and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Linlin Shen and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zhihui Lai and Rosa Sicilia and Jo{\~{a}}o Rafael Almeida and Bridget Kane}, title = {Subgroup Discovery Analysis of Treatment Patterns in Lung Cancer Patients}, booktitle = {35th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2022, Shenzen, China, July 21-23, 2022}, pages = {1--7}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CBMS55023.2022.00082}, doi = {10.1109/CBMS55023.2022.00082}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/Gomez-BravoGVRO22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/MunozCSORPG22, author = {Adri{\'{a}}n Ayuso Mu{\~{n}}oz and Esther Ugarte Carro and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Bel{\'{e}}n Otero{-}Carrasco and Ernestina Menasalvas Ruiz and Yuliana P{\'{e}}rez{-}Gallardo and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Linlin Shen and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zhihui Lai and Rosa Sicilia and Jo{\~{a}}o Rafael Almeida and Bridget Kane}, title = {{REDIRECTION:} Generating drug repurposing hypotheses using link prediction with {DISNET} data}, booktitle = {35th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2022, Shenzen, China, July 21-23, 2022}, pages = {7--12}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CBMS55023.2022.00009}, doi = {10.1109/CBMS55023.2022.00009}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/MunozCSORPG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/Otero-CarrascoP22, author = {Bel{\'{e}}n Otero{-}Carrasco and Aurora P{\'{e}}rez{-}P{\'{e}}rez and Ernestina Menasalvas Ruiz and Juan Pedro Cara{\c{c}}a{-}Valente Hern{\'{a}}ndez and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Linlin Shen and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zhihui Lai and Rosa Sicilia and Jo{\~{a}}o Rafael Almeida and Bridget Kane}, title = {Drug repositioning with gender perspective focused on Adverse Drug Reactions}, booktitle = {35th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2022, Shenzen, China, July 21-23, 2022}, pages = {435--440}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CBMS55023.2022.00084}, doi = {10.1109/CBMS55023.2022.00084}, timestamp = {Fri, 02 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/Otero-CarrascoP22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ekaw/PerezISPBG22, author = {Andrea {\'{A}}lvarez P{\'{e}}rez and Ana Iglesias{-}Molina and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Mar{\'{\i}}a Poveda{-}Villal{\'{o}}n and Carlos Badenes{-}Olmedo and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {{\'{O}}scar Corcho and Laura Hollink and Oliver Kutz and Nicolas Troquard and Fajar J. Ekaputra}, title = {{EBOCA:} Evidences for BiOmedical Concepts Association Ontology}, booktitle = {Knowledge Engineering and Knowledge Management - 23rd International Conference, {EKAW} 2022, Bolzano, Italy, September 26-29, 2022, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {13514}, pages = {152--166}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-17105-5\_11}, doi = {10.1007/978-3-031-17105-5\_11}, timestamp = {Mon, 24 Oct 2022 20:50:57 +0200}, biburl = {https://dblp.org/rec/conf/ekaw/PerezISPBG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwinac/Otero-CarrascoS22, author = {Bel{\'{e}}n Otero{-}Carrasco and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Esther Ugarte Carro and Juan Pedro Cara{\c{c}}a{-}Valente Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Jos{\'{e}} Manuel Ferr{\'{a}}ndez de Vicente and Jos{\'{e}} Ram{\'{o}}n {\'{A}}lvarez S{\'{a}}nchez and F{\'{e}}lix de la Paz L{\'{o}}pez and Hojjat Adeli}, title = {A Computational Drug Repositioning Method for Rare Diseases}, booktitle = {Bio-inspired Systems and Applications: from Robotics to Ambient Intelligence - 9th International Work-Conference on the Interplay Between Natural and Artificial Computation, {IWINAC} 2022, Puerto de la Cruz, Tenerife, Spain, May 31 - June 3, 2022, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {13259}, pages = {551--561}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-06527-9\_55}, doi = {10.1007/978-3-031-06527-9\_55}, timestamp = {Mon, 13 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwinac/Otero-CarrascoS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cbms/2022, editor = {Linlin Shen and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zhihui Lai and Rosa Sicilia and Jo{\~{a}}o Rafael Almeida and Bridget Kane}, title = {35th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2022, Shenzen, China, July 21-23, 2022}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CMBS55023.2022}, doi = {10.1109/CMBS55023.2022}, isbn = {978-1-6654-6770-4}, timestamp = {Fri, 02 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/2022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2208-01093, author = {Andrea {\'{A}}lvarez P{\'{e}}rez and Ana Iglesias{-}Molina and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Mar{\'{\i}}a Poveda{-}Villal{\'{o}}n and Carlos Badenes{-}Olmedo and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {{EBOCA:} Evidences for BiOmedical Concepts Association Ontology}, journal = {CoRR}, volume = {abs/2208.01093}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2208.01093}, doi = {10.48550/ARXIV.2208.01093}, eprinttype = {arXiv}, eprint = {2208.01093}, timestamp = {Tue, 09 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2208-01093.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ci/VenturaSG21, author = {Sebasti{\'{a}}n Ventura and Paolo Soda and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {{EDITORIAL}}, journal = {Comput. Intell.}, volume = {37}, number = {4}, pages = {1458--1459}, year = {2021}, url = {https://doi.org/10.1111/coin.12493}, doi = {10.1111/COIN.12493}, timestamp = {Tue, 01 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ci/VenturaSG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/ValleGSZRG21, author = {Eduardo P. Garc{\'{\i}}a del Valle and Gerardo Lagunes Garc{\'{\i}}a and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Massimiliano Zanin and Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {DisMaNET: {A} network-based tool to cross map disease vocabularies}, journal = {Comput. Methods Programs Biomed.}, volume = {207}, pages = {106233}, year = {2021}, url = {https://doi.org/10.1016/j.cmpb.2021.106233}, doi = {10.1016/J.CMPB.2021.106233}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmpb/ValleGSZRG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ipm/GonzalezSSF21, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Sebasti{\'{a}}n Ventura Soto and Paolo Soda and Jesualdo Tom{\'{a}}s Fern{\'{a}}ndez{-}Breis}, title = {Introduction to the special issue on Methods and applications in the analysis of social data in healthcare}, journal = {Inf. Process. Manag.}, volume = {58}, number = {1}, pages = {102427}, year = {2021}, url = {https://doi.org/10.1016/j.ipm.2020.102427}, doi = {10.1016/J.IPM.2020.102427}, timestamp = {Fri, 08 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ipm/GonzalezSSF21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/ValleSGZRG21, author = {Eduardo P. Garc{\'{\i}}a del Valle and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Gerardo Lagunes Garc{\'{\i}}a and Massimiliano Zanin and Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Jo{\~{a}}o Rafael Almeida and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Linlin Shen and Bridget Kane and Agma J. M. Traina and Paolo Soda and Jos{\'{e}} Lu{\'{\i}}s Oliveira}, title = {A Meta-Path-Based Prediction Method for Disease Comorbidities}, booktitle = {34th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2021, Aveiro, Portugal, June 7-9, 2021}, pages = {219--224}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/CBMS52027.2021.00022}, doi = {10.1109/CBMS52027.2021.00022}, timestamp = {Fri, 21 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/ValleSGZRG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/PabonMBSGM21, author = {Oswaldo Solarte Pab{\'{o}}n and Orlando Montenegro and Alberto Bl{\'{a}}zquez{-}Herranz and Hadi Saputro and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas}, editor = {Guglielmo Faggioli and Nicola Ferro and Alexis Joly and Maria Maistro and Florina Piroi}, title = {Information Extraction from Spanish Radiology Reports using multilingual {BERT}}, booktitle = {Proceedings of the Working Notes of {CLEF} 2021 - Conference and Labs of the Evaluation Forum, Bucharest, Romania, September 21st - to - 24th, 2021}, series = {{CEUR} Workshop Proceedings}, volume = {2936}, pages = {834--845}, publisher = {CEUR-WS.org}, year = {2021}, url = {https://ceur-ws.org/Vol-2936/paper-69.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:42 +0100}, biburl = {https://dblp.org/rec/conf/clef/PabonMBSGM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsaa/PabonBTGPM21, author = {Oswaldo Solarte Pab{\'{o}}n and Alberto Bl{\'{a}}zquez{-}Herranz and Maria Torrente and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Mariano Provencio and Ernestina Menasalvas}, title = {Extracting Cancer Treatments from Clinical Text written in Spanish: {A} Deep Learning Approach}, booktitle = {8th {IEEE} International Conference on Data Science and Advanced Analytics, {DSAA} 2021, Porto, Portugal, October 6-9, 2021}, pages = {1--6}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/DSAA53316.2021.9564137}, doi = {10.1109/DSAA53316.2021.9564137}, timestamp = {Fri, 22 Oct 2021 15:23:43 +0200}, biburl = {https://dblp.org/rec/conf/dsaa/PabonBTGPM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dsaa/RedondoRVOHTMPG21, author = {Arturo Redondo and Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and Guillermo Vigueras and Bel{\'{e}}n Otero and Roberto Hern{\'{a}}ndez L{\'{o}}pez and Maria Torrente and Ernestina Menasalvas and Mariano Provencio and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Towards Treatment Patterns Validation in Lung Cancer Patients}, booktitle = {8th {IEEE} International Conference on Data Science and Advanced Analytics, {DSAA} 2021, Porto, Portugal, October 6-9, 2021}, pages = {1--8}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/DSAA53316.2021.9564176}, doi = {10.1109/DSAA53316.2021.9564176}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dsaa/RedondoRVOHTMPG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cbms/2021, editor = {Jo{\~{a}}o Rafael Almeida and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Linlin Shen and Bridget Kane and Agma J. M. Traina and Paolo Soda and Jos{\'{e}} Lu{\'{\i}}s Oliveira}, title = {34th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2021, Aveiro, Portugal, June 7-9, 2021}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/CBMS52027.2021}, doi = {10.1109/CBMS52027.2021}, isbn = {978-1-6654-4121-6}, timestamp = {Tue, 11 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/2021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/artmed/NajafabadipourZ20, author = {Marjan Najafabadipour and Massimiliano Zanin and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Maria Torrente and Beatriz Nu{\~{n}}ez Garc{\'{\i}}a and Juan Luis Cruz{-}Berm{\'{u}}dez and Mariano Provencio and Ernestina Menasalvas}, title = {Reconstructing the patient's natural history from electronic health records}, journal = {Artif. Intell. Medicine}, volume = {105}, pages = {101860}, year = {2020}, url = {https://doi.org/10.1016/j.artmed.2020.101860}, doi = {10.1016/J.ARTMED.2020.101860}, timestamp = {Thu, 26 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/artmed/NajafabadipourZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/Benitez-Andrades20, author = {Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and Isa{\'{\i}}as Garc{\'{\i}}a{-}Rodr{\'{\i}}guez and Carmen Benavides and H{\'{e}}ctor Alaiz{-}Moret{\'{o}}n and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Social network analysis for personalized characterization and risk assessment of alcohol use disorders in adolescents using semantic technologies}, journal = {Future Gener. Comput. Syst.}, volume = {106}, pages = {154--170}, year = {2020}, url = {https://doi.org/10.1016/j.future.2020.01.002}, doi = {10.1016/J.FUTURE.2020.01.002}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fgcs/Benitez-Andrades20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ipm/GarciaGSVZR20, author = {Gerardo Lagunes Garc{\'{\i}}a and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Eduardo P. Garc{\'{\i}}a del Valle and Massimiliano Zanin and Ernestina Menasalvas Ruiz}, title = {How Wikipedia disease information evolve over time? An analysis of disease-based articles changes}, journal = {Inf. Process. Manag.}, volume = {57}, number = {3}, pages = {102225}, year = {2020}, url = {https://doi.org/10.1016/j.ipm.2020.102225}, doi = {10.1016/J.IPM.2020.102225}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ipm/GarciaGSVZR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/winet/Sanchez-Cervantes20, author = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Luis Omar Colombo{-}Mendoza and Giner Alor{-}Hern{\'{a}}ndez and Jorge Luis Garc{\'{\i}}a{-}Alcaraz and Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {LINDASearch: a faceted search system for linked open datasets}, journal = {Wirel. Networks}, volume = {26}, number = {8}, pages = {5645--5663}, year = {2020}, url = {https://doi.org/10.1007/s11276-019-02029-z}, doi = {10.1007/S11276-019-02029-Z}, timestamp = {Wed, 22 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/winet/Sanchez-Cervantes20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/SantamariaVGZGR20, author = {Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Eduardo P. Garc{\'{\i}}a del Valle and Gerardo Lagunes Garc{\'{\i}}a and Massimiliano Zanin and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas Ruiz and Yuliana P{\'{e}}rez{-}Gallardo and Gandhi Hern{\'{a}}ndez{-}Chan}, editor = {Alba Garc{\'{\i}}a Seco de Herrera and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zelalem Temesgen and Bridget Kane and Paolo Soda}, title = {Analysis of New Nosological Models from Disease Similarities using Clustering}, booktitle = {33rd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020}, pages = {183--188}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CBMS49503.2020.00042}, doi = {10.1109/CBMS49503.2020.00042}, timestamp = {Mon, 16 Jan 2023 08:52:16 +0100}, biburl = {https://dblp.org/rec/conf/cbms/SantamariaVGZGR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/ScurtiRVTVPPG20, author = {Manuel Scurti and Ernestina Menasalvas Ruiz and Maria{-}Esther Vidal and Maria Torrente and Dimitrios Vogiatzis and George Paliouras and Mariano Provencio and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Alba Garc{\'{\i}}a Seco de Herrera and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zelalem Temesgen and Bridget Kane and Paolo Soda}, title = {A Data-Driven Approach for Analyzing Healthcare Services Extracted from Clinical Records}, booktitle = {33rd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020}, pages = {193--196}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CBMS49503.2020.00044}, doi = {10.1109/CBMS49503.2020.00044}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/ScurtiRVTVPPG20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GonzalezTPRJCCA20, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Juan Manuel Tu{\~{n}}as and Diego Fernandez Peces{-}Barba and Ernestina Menasalvas Ruiz and Almudena Jaramillo and Manuel Cotarelo and Antonio Conejo and Amalia Arce and Angel Gil}, editor = {Alba Garc{\'{\i}}a Seco de Herrera and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zelalem Temesgen and Bridget Kane and Paolo Soda}, title = {Creating a Metamodel Based on Machine Learning to Identify the Sentiment of Vaccine and Disease-Related Messages in Twitter: the {MAVIS} Study}, booktitle = {33rd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020}, pages = {245--250}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CBMS49503.2020.00053}, doi = {10.1109/CBMS49503.2020.00053}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/GonzalezTPRJCCA20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/PabonTGPMT20, author = {Oswaldo Solarte Pab{\'{o}}n and Maria Torrente and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Mariano Provencio and Ernestina Menasalvas and Juan Manuel Tu{\~{n}}as}, editor = {Alba Garc{\'{\i}}a Seco de Herrera and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zelalem Temesgen and Bridget Kane and Paolo Soda}, title = {Lung Cancer Diagnosis Extraction from Clinical Notes Written in Spanish}, booktitle = {33rd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020}, pages = {492--497}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/CBMS49503.2020.00099}, doi = {10.1109/CBMS49503.2020.00099}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/PabonTGPMT20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwbbio/PabonMG20, author = {Oswaldo Solarte Pab{\'{o}}n and Ernestina Menasalvas and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Ignacio Rojas and Olga Valenzuela and Fernando Rojas and Luis Javier Herrera and Francisco M. Ortu{\~{n}}o Guzman}, title = {Spa-neg: An Approach for Negation Detection in Clinical Text Written in Spanish}, booktitle = {Bioinformatics and Biomedical Engineering - 8th International Work-Conference, {IWBBIO} 2020, Granada, Spain, May 6-8, 2020, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12108}, pages = {323--337}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-45385-5\_29}, doi = {10.1007/978-3-030-45385-5\_29}, timestamp = {Mon, 05 Feb 2024 20:33:18 +0100}, biburl = {https://dblp.org/rec/conf/iwbbio/PabonMG20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/meco/ZaninRGWWHS20, author = {Massimiliano Zanin and Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Christian Wolff and Juana Wendt and Elisa A. Herrmann and Pavel Smrz}, title = {Developing a Data Analytics Toolbox to Support CPS-based Services}, booktitle = {9th Mediterranean Conference on Embedded Computing, {MECO} 2020, Budva, Montenegro, June 8-11, 2020}, pages = {1--7}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.1109/MECO49872.2020.9134351}, doi = {10.1109/MECO49872.2020.9134351}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/meco/ZaninRGWWHS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mipro/ZaninMGS20, author = {Massimiliano Zanin and Ernestina Menasalvas and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Pavel Smrz}, editor = {Marko Koricic and Karolj Skala and Zeljka Car and Marina Cicin{-}Sain and Vlado Sruk and Dejan Skvorc and Slobodan Ribaric and Bojan Jerbic and Stjepan Gros and Boris Vrdoljak and Mladen Mauher and Edvard Tijan and Tihomir Katulic and Predrag Pale and Tihana Galinac Grbac and Nikola Filip Fijan and Adrian Boukalov and Dragan Cisic and Vera Gradisnik}, title = {An Analytics Toolbox for Cyber-Physical Systems Data Analysis: Requirements and Challenges}, booktitle = {43rd International Convention on Information, Communication and Electronic Technology, {MIPRO} 2020, Opatija, Croatia, September 28 - October 2, 2020}, pages = {271--276}, publisher = {{IEEE}}, year = {2020}, url = {https://doi.org/10.23919/MIPRO48935.2020.9245355}, doi = {10.23919/MIPRO48935.2020.9245355}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mipro/ZaninMGS20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/cbms/2020, editor = {Alba Garc{\'{\i}}a Seco de Herrera and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and KC Santosh and Zelalem Temesgen and Bridget Kane and Paolo Soda}, title = {33rd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020}, publisher = {{IEEE}}, year = {2020}, url = {https://ieeexplore.ieee.org/xpl/conhome/9169740/proceeding}, isbn = {978-1-7281-9429-5}, timestamp = {Mon, 16 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijdsa/GonzalezVMORS19, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Athena Vakali and Miguel Angel Mayer and Takashi Okumura and Ernestina Menasalvas Ruiz and Myra Spiliopoulou}, title = {Introduction to the special issue on social data analytics in medicine and healthcare}, journal = {Int. J. Data Sci. Anal.}, volume = {8}, number = {4}, pages = {325--326}, year = {2019}, url = {https://doi.org/10.1007/s41060-019-00199-9}, doi = {10.1007/S41060-019-00199-9}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijdsa/GonzalezVMORS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jbi/ValleGSZRG19, author = {Eduardo P. Garc{\'{\i}}a del Valle and Gerardo Lagunes Garc{\'{\i}}a and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Massimiliano Zanin and Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Disease networks and their contribution to disease understanding: {A} review of their evolution, techniques and data sources}, journal = {J. Biomed. Informatics}, volume = {94}, year = {2019}, url = {https://doi.org/10.1016/j.jbi.2019.103206}, doi = {10.1016/J.JBI.2019.103206}, timestamp = {Tue, 16 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jbi/ValleGSZRG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/NajafabadipourZ19, author = {Marjan Najafabadipour and Massimiliano Zanin and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Consuelo Gonzalo{-}Mart{\'{\i}}n and Beatriz Nu{\~{n}}ez Garc{\'{\i}}a and Virginia Calvo and Juan Luis Cruz{-}Berm{\'{u}}dez and Mariano Provencio and Ernestina Menasalvas}, title = {Recognition of Time Expressions in Spanish Electronic Health Records}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {69--74}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00025}, doi = {10.1109/CBMS.2019.00025}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/NajafabadipourZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/KritharaARNBVMG19, author = {Anastasia Krithara and Fotis Aisopos and Vassiliki Rentoumi and Anastasios Nentidis and Konstantinos Bougiatiotis and Maria{-}Esther Vidal and Ernestina Menasalvas and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Eleftherios Samaras and Peter Garrard and Maria Torrente and Mariano Provencio Pulla and Nikos Dimakopoulos and Rui Mauricio and Jordi Rambla De Argila and Gian Gaetano Tartaglia and George Paliouras}, title = {iASiS: Towards Heterogeneous Big Data Analysis for Personalized Medicine}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {106--111}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00032}, doi = {10.1109/CBMS.2019.00032}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/KritharaARNBVMG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/Diaz-HonrubiaGZ19, author = {Antonio Jes{\'{u}}s D{\'{\i}}az{-}Honrubia and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Juan Mora Zamorano and Jes{\'{u}}s Rey Jim{\'{e}}nez and Gustavo {Gonzalez Granadillo} and Rodrigo Diaz and Mariza Konidi and Panos Papachristou and Sokratis Nifakos and Georgia Kougka and Anastasios Gounaris}, title = {An Overview of the {CUREX} Platform}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {162--167}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00042}, doi = {10.1109/CBMS.2019.00042}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/Diaz-HonrubiaGZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/ValleGRSZG19, author = {Eduardo P. Garc{\'{\i}}a del Valle and Gerardo Lagunes Garc{\'{\i}}a and Ernestina Menasalvas Ruiz and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Massimiliano Zanin and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Completing Missing MeSH Code Mappings in {UMLS} Through Alternative Expert-Curated Sources}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {174--179}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00044}, doi = {10.1109/CBMS.2019.00044}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/ValleGRSZG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/ToroSGGGR19, author = {C{\'{e}}sar Antonio Ortiz Toro and Nuria Guti{\'{e}}rrez S{\'{a}}nchez and Consuelo Gonzalo{-}Mart{\'{\i}}n and Roberto Garrido Garc{\'{\i}}a and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas Ruiz}, title = {Radiomics Textural Features Extracted from Subcortical Structures of Grey Matter Probability for Alzheimers Disease Detection}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {391--397}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00084}, doi = {10.1109/CBMS.2019.00084}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/ToroSGGGR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GarciaG19, author = {Gerardo Lagunes Garc{\'{\i}}a and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Characterization of Diseases Based on Phenotypic Information Through Knowledge Extraction using Public Sources}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {596--599}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00124}, doi = {10.1109/CBMS.2019.00124}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/GarciaG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GarciaSVZRG19, author = {Gerardo Lagunes Garc{\'{\i}}a and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Eduardo P. Garc{\'{\i}}a del Valle and Massimiliano Zanin and Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Wikipedia Disease Articles: An Analysis of their Content and Evolution}, booktitle = {32nd {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2019, Cordoba, Spain, June 5-7, 2019}, pages = {664--671}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/CBMS.2019.00136}, doi = {10.1109/CBMS.2019.00136}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cbms/GarciaSVZRG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sgai/NajafabadipourT19, author = {Marjan Najafabadipour and Juan Manuel Tu{\~{n}}as and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas}, editor = {Max Bramer and Miltos Petridis}, title = {Analysis of Electronic Health Records to Identify the Patient's Treatment Lines: Challenges and Opportunities}, booktitle = {Artificial Intelligence {XXXVI} - 39th {SGAI} International Conference on Artificial Intelligence, {AI} 2019, Cambridge, UK, December 17-19, 2019, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {11927}, pages = {437--442}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-34885-4\_33}, doi = {10.1007/978-3-030-34885-4\_33}, timestamp = {Sat, 30 May 2020 20:07:11 +0200}, biburl = {https://dblp.org/rec/conf/sgai/NajafabadipourT19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19, author = {Ziawasch Abedjan and Nozha Boujemaa and Stuart Campbell and Patricia Casla and Supriyo Chatterjea and Sergio Consoli and Crist{\'{o}}bal Costa Soria and Paul Czech and Marija Despenic and Chiara Garattini and Dirk Hamelinck and Adrienne Heinrich and Wessel Kraaij and Jacek Kustra and Aizea Lojo and Marga Martin Sanchez and Miguel Angel Mayer and Matteo Melideo and Ernestina Menasalvas and Frank M{\o}ller Aarestrup and Elvira Narro Artigot and Milan Petkovic and Diego Reforgiato Recupero and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Gisele Roesems Kerremans and Roland Roller and M{\'{a}}rio Rom{\~{a}}o and Stefan R{\"{u}}ping and Felix Sasaki and Wouter Spek and Nenad Stojanovic and Jack Thoms and Andrejs Vasiljevs and Wilfried Verachtert and Roel Wuyts}, editor = {Sergio Consoli and Diego Reforgiato Recupero and Milan Petkovic}, title = {Data Science in Healthcare: Benefits, Challenges and Opportunities}, booktitle = {Data Science for Healthcare - Methodologies and Applications}, pages = {3--38}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-05249-2\_1}, doi = {10.1007/978-3-030-05249-2\_1}, timestamp = {Fri, 22 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/entropy/ZaninGRP18, author = {Massimiliano Zanin and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas Ruiz and David Papo}, title = {Assessing Time Series Reversibility through Permutation Patterns}, journal = {Entropy}, volume = {20}, number = {9}, pages = {665}, year = {2018}, url = {https://doi.org/10.3390/e20090665}, doi = {10.3390/E20090665}, timestamp = {Fri, 25 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/entropy/ZaninGRP18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jis/Colombo-Mendoza18, author = {Luis Omar Colombo{-}Mendoza and Rafael Valencia{-}Garc{\'{\i}}a and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ricardo Colomo Palacios and Giner Alor{-}Hern{\'{a}}ndez}, title = {Towards a knowledge-based probabilistic and context-aware social recommender system}, journal = {J. Inf. Sci.}, volume = {44}, number = {4}, pages = {464--490}, year = {2018}, url = {https://doi.org/10.1177/0165551517698787}, doi = {10.1177/0165551517698787}, timestamp = {Mon, 15 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jis/Colombo-Mendoza18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jms/RuizTBGGZPMZRPB18, author = {Ernestina Menasalvas Ruiz and Juan Manuel Tu{\~{n}}as and Guzm{\'{a}}n Bermejo and Consuelo Gonzalo{-}Mart{\'{\i}}n and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Massimiliano Zanin and Cristina Gonzalez de Pedro and Marta Mendez and Olga Zaretskaia and Jes{\'{u}}s Rey and Consuelo Parejo and Juan Luis Cruz{-}Berm{\'{u}}dez and Mariano Provencio}, title = {Profiling Lung Cancer Patients Using Electronic Health Records}, journal = {J. Medical Syst.}, volume = {42}, number = {7}, pages = {126:1--126:10}, year = {2018}, url = {https://doi.org/10.1007/s10916-018-0975-9}, doi = {10.1007/S10916-018-0975-9}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jms/RuizTBGGZPMZRPB18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/ValleGSZRG18, author = {Eduardo P. Garc{\'{\i}}a del Valle and Gerardo Lagunes Garc{\'{\i}}a and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Massimiliano Zanin and Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Jaakko Hollm{\'{e}}n and Carolyn McGregor and Paolo Soda and Bridget Kane}, title = {Evaluating Wikipedia as a Source of Information for Disease Understanding}, booktitle = {31st {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2018, Karlstad, Sweden, June 18-21, 2018}, pages = {399--404}, publisher = {{IEEE} Computer Society}, year = {2018}, url = {https://doi.org/10.1109/CBMS.2018.00076}, doi = {10.1109/CBMS.2018.00076}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/ValleGSZRG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dils/NajafabadipourT18, author = {Marjan Najafabadipour and Juan Manuel Tu{\~{n}}as and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas}, editor = {S{\"{o}}ren Auer and Maria{-}Esther Vidal}, title = {Lung Cancer Concept Annotation from Spanish Clinical Narratives}, booktitle = {Data Integration in the Life Sciences - 13th International Conference, {DILS} 2018, Hannover, Germany, November 20-21, 2018, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {11371}, pages = {153--163}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-06016-9\_15}, doi = {10.1007/978-3-030-06016-9\_15}, timestamp = {Fri, 27 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dils/NajafabadipourT18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sitis/GonzalezGM18, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Consuelo Gonzalo and Ernestina Menasalvas}, editor = {Gabriella Sanniti di Baja and Luigi Gallo and Kokou Y{\'{e}}tongnon and Albert Dipanda and Modesto Castrill{\'{o}}n Santana and Richard Chbeir}, title = {Mining Electronic Health Records: Challenges and Impact}, booktitle = {14th International Conference on Signal-Image Technology {\&} Internet-Based Systems, {SITIS} 2018, Las Palmas de Gran Canaria, Spain, November 26-29, 2018}, pages = {747--754}, publisher = {{IEEE}}, year = {2018}, url = {https://doi.org/10.1109/SITIS.2018.00119}, doi = {10.1109/SITIS.2018.00119}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sitis/GonzalezGM18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1808-01459, author = {Eduardo P. Garc{\'{\i}}a del Valle and Gerardo Lagunes Garc{\'{\i}}a and Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and Massimiliano Zanin and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas Ruiz}, title = {Evaluating Wikipedia as a source of information for disease understanding}, journal = {CoRR}, volume = {abs/1808.01459}, year = {2018}, url = {http://arxiv.org/abs/1808.01459}, eprinttype = {arXiv}, eprint = {1808.01459}, timestamp = {Sat, 13 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1808-01459.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-06639, author = {Marjan Najafabadipour and Juan Manuel Tu{\~{n}}as and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas}, title = {Lung Cancer Concept Annotation from Spanish Clinical Narratives}, journal = {CoRR}, volume = {abs/1809.06639}, year = {2018}, url = {http://arxiv.org/abs/1809.06639}, eprinttype = {arXiv}, eprint = {1809.06639}, timestamp = {Mon, 08 Oct 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-06639.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-07784, author = {Ernestina Menasalvas Ruiz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Consuelo Gonzalo{-}Mart{\'{\i}}n and Massimiliano Zanin and Juan Manuel Tu{\~{n}}as and Mariano Provencio and Maria Torrente and Fabio Franco and Virginia Calvo and Beatriz Nu{\~{n}}ez}, title = {{IASIS} and BigMedilytics: Towards personalized medicine in Europe}, journal = {CoRR}, volume = {abs/1809.07784}, year = {2018}, url = {http://arxiv.org/abs/1809.07784}, eprinttype = {arXiv}, eprint = {1809.07784}, timestamp = {Fri, 05 Oct 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-07784.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/RuizGTGPPMZCRP17, author = {Ernestina Menasalvas Ruiz and Consuelo Gonzalo and Juan Manuel Tu{\~{n}}as and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Mariano Provencio and Cristina Gonzalez de Pedro and Marta Mendez and Olga Zaretskaia and Juan Luis Cruz and Jes{\'{u}}s Rey and Consuelo Parejo}, editor = {Panagiotis D. Bamidis and Stathis Th. Konstantinidis and Pedro Pereira Rodrigues}, title = {OncoCall: Analyzing the Outcomes of the Oncology Telephone Patient Assistance}, booktitle = {30th {IEEE} International Symposium on Computer-Based Medical Systems, {CBMS} 2017, Thessaloniki, Greece, June 22-24, 2017}, pages = {624--629}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/CBMS.2017.103}, doi = {10.1109/CBMS.2017.103}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/RuizGTGPPMZCRP17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/citi/Aparicio-Paniagua17, author = {Virginia Aparicio{-}Paniagua and Jorge P{\'{e}}rez{-}Mu{\~{n}}oz and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Angel Garc{\'{\i}}a{-}Pedrero and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Consuelo Gonzalo{-}Mart{\'{\i}}n and Ernestina Menasalvas Ruiz and Giner Alor{-}Hern{\'{a}}ndez}, editor = {Rafael Valencia{-}Garc{\'{\i}}a and Katty Lagos{-}Ortiz and Gema Alcaraz{-}M{\'{a}}rmol and Javier del Cioppo and N{\'{e}}stor Vera{-}Lucio and Martha Bucaram{-}Leverone}, title = {Automatic Recording and Analysis of Somniloquy Through the Use of Mobile Devices to Support the Diagnosis of Psychological Pathologies}, booktitle = {Technologies and Innovation - Third International Conference, {CITI} 2017, Guayaquil, Ecuador, October 24-27, 2017, Proceedings}, series = {Communications in Computer and Information Science}, volume = {749}, pages = {169--180}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-67283-0\_13}, doi = {10.1007/978-3-319-67283-0\_13}, timestamp = {Mon, 26 Jun 2023 20:45:39 +0200}, biburl = {https://dblp.org/rec/conf/citi/Aparicio-Paniagua17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pacbb/ToroGGGM17, author = {C{\'{e}}sar Antonio Ortiz Toro and Consuelo Gonzalo{-}Mart{\'{\i}}n and Angel Garc{\'{\i}}a{-}Pedrero and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas}, editor = {Florentino Fdez{-}Riverola and Mohd Saberi Mohamad and Miguel P. Rocha and Juan F. De Paz and Tiago Pinto}, title = {Mitosis Detection in Breast Cancer Using Superpixels and Ensemble Classifiers}, booktitle = {11th International Conference on Practical Applications of Computational Biology {\&} Bioinformatics, {PACBB} 2017, Porto, Portugal, 21-23 June, 2017}, series = {Advances in Intelligent Systems and Computing}, volume = {616}, pages = {137--145}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-60816-7\_17}, doi = {10.1007/978-3-319-60816-7\_17}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pacbb/ToroGGGM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cbm/Hernandez-ChanC16, author = {Gandhi Hern{\'{a}}ndez{-}Chan and Edgar Eduardo Ceh{-}Varela and Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Marisol Villanueva{-}Escalante and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Yuliana P{\'{e}}rez{-}Gallardo}, title = {Collective intelligence in medical diagnosis systems: {A} case study}, journal = {Comput. Biol. Medicine}, volume = {74}, pages = {45--53}, year = {2016}, url = {https://doi.org/10.1016/j.compbiomed.2016.04.016}, doi = {10.1016/J.COMPBIOMED.2016.04.016}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cbm/Hernandez-ChanC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/GonzalezRM16, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ernestina Menasalvas Ruiz and Miguel Angel Mayer}, title = {Automatic extraction and identification of users' responses in Facebook medical quizzes}, journal = {Comput. Methods Programs Biomed.}, volume = {127}, pages = {197--203}, year = {2016}, url = {https://doi.org/10.1016/j.cmpb.2015.12.025}, doi = {10.1016/J.CMPB.2015.12.025}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cmpb/GonzalezRM16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/js/Sanchez-Cervantes16, author = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Mateusz Radzimski and Cristian Aar{\'{o}}n Rodr{\'{\i}}guez{-}Enr{\'{\i}}quez and Giner Alor{-}Hern{\'{a}}ndez and Lisbeth Rodr{\'{\i}}guez{-}Mazahua and Cuauht{\'{e}}moc S{\'{a}}nchez{-}Ram{\'{\i}}rez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {{SREQP:} {A} Solar Radiation Extraction and Query Platform for the Production and Consumption of Linked Data from Weather Stations Sensors}, journal = {J. Sensors}, volume = {2016}, pages = {2825653:1--2825653:18}, year = {2016}, url = {https://doi.org/10.1155/2016/2825653}, doi = {10.1155/2016/2825653}, timestamp = {Wed, 19 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/js/Sanchez-Cervantes16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/rskt/MenasalvasGCAG16, author = {Ernestina Menasalvas and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Roberto Costumero and Hector Ambit and Consuelo Gonzalo}, editor = {V{\'{\i}}ctor Flores and Fernando A. C. Gomide and Andrzej Janusz and Claudio Meneses and Duoqian Miao and Georg Peters and Dominik Slezak and Guoyin Wang and Richard Weber and Yiyu Yao}, title = {Clinical Narrative Analytics Challenges}, booktitle = {Rough Sets - International Joint Conference, {IJCRS} 2016, Santiago de Chile, Chile, October 7-11, 2016, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {9920}, pages = {23--32}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-47160-0\_2}, doi = {10.1007/978-3-319-47160-0\_2}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/rskt/MenasalvasGCAG16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/Colombo-MendozaVGAZ15, author = {Luis Omar Colombo{-}Mendoza and Rafael Valencia{-}Garc{\'{\i}}a and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Giner Alor{-}Hern{\'{a}}ndez and Jos{\'{e}} Javier Samper Zapater}, title = {RecomMetz: {A} context-aware knowledge-based mobile recommender system for movie showtimes}, journal = {Expert Syst. Appl.}, volume = {42}, number = {3}, pages = {1202--1222}, year = {2015}, url = {https://doi.org/10.1016/j.eswa.2014.09.016}, doi = {10.1016/J.ESWA.2014.09.016}, timestamp = {Fri, 30 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/Colombo-MendozaVGAZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/scp/Salas-ZarateAVR15, author = {Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and Giner Alor{-}Hern{\'{a}}ndez and Rafael Valencia{-}Garc{\'{\i}}a and Lisbeth Rodr{\'{\i}}guez{-}Mazahua and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jos{\'{e}} Luis L{\'{o}}pez Cuadrado}, title = {Analyzing best practices on Web development frameworks: The lift approach}, journal = {Sci. Comput. Program.}, volume = {102}, pages = {1--19}, year = {2015}, url = {https://doi.org/10.1016/j.scico.2014.12.004}, doi = {10.1016/J.SCICO.2014.12.004}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/scp/Salas-ZarateAVR15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spe/Paredes-ValverdeAGVJ15, author = {Mario Andr{\'{e}}s Paredes{-}Valverde and Giner Alor{-}Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rafael Valencia{-}Garc{\'{\i}}a and Enrique Jim{\'{e}}nez{-}Domingo}, title = {A systematic review of tools, languages, and methodologies for mashup development}, journal = {Softw. Pract. Exp.}, volume = {45}, number = {3}, pages = {365--397}, year = {2015}, url = {https://doi.org/10.1002/spe.2233}, doi = {10.1002/SPE.2233}, timestamp = {Thu, 09 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spe/Paredes-ValverdeAGVJ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pacbb/GonzalezRCWR15, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Marcos Mart{\'{\i}}nez Romero and Roberto Costumero and Mark D. Wilkinson and Ernestina Menasalvas Ruiz}, editor = {Ross A. Overbeek and Miguel P. Rocha and Florentino Fdez{-}Riverola and Juan Francisco de Paz}, title = {Diagnostic Knowledge Extraction from MedlinePlus: An Application for Infectious Diseases}, booktitle = {9th International Conference on Practical Applications of Computational Biology and Bioinformatics, {PACBB} 2015, 3-5 June, 2015, Salamanca, Spain}, series = {Advances in Intelligent Systems and Computing}, volume = {375}, pages = {79--87}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-19776-0\_9}, doi = {10.1007/978-3-319-19776-0\_9}, timestamp = {Wed, 12 Oct 2022 08:58:54 +0200}, biburl = {https://dblp.org/rec/conf/pacbb/GonzalezRCWR15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pacbb/GonzalezRCWR15a, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Marcos Mart{\'{\i}}nez Romero and Roberto Costumero and Mark D. Wilkinson and Ernestina Menasalvas Ruiz}, editor = {Ross A. Overbeek and Miguel P. Rocha and Florentino Fdez{-}Riverola and Juan Francisco de Paz}, title = {Erratum to: Diagnostic Knowledge Extraction from MedlinePlus: An Application for Infectious Diseases}, booktitle = {9th International Conference on Practical Applications of Computational Biology and Bioinformatics, {PACBB} 2015, 3-5 June, 2015, Salamanca, Spain}, series = {Advances in Intelligent Systems and Computing}, volume = {375}, pages = {E1}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-19776-0\_16}, doi = {10.1007/978-3-319-19776-0\_16}, timestamp = {Fri, 20 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/pacbb/GonzalezRCWR15a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/acj/GonzalezERAJ14, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and David Estrada{-}Contreras and Guillermo Cortes Robles and Giner Alor{-}Hern{\'{a}}ndez and Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez}, title = {A Function-Oriented Ontology Tool for Solving Inventive Problems}, journal = {J. Res. Pract. Inf. Technol.}, volume = {46}, number = {4}, year = {2014}, url = {http://ws.acs.org.au/jrpit/JRPITVolumes/JRPIT46/JRPIT46.4.287\%20David\%20Estrada-Contreas\%20A\%20Function-Orientated\%20Ontology\%20Tool\%20for\%20Solving\%20Inventive\%20Problems.pdf}, timestamp = {Thu, 26 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/acj/GonzalezERAJ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ase/Colombo-MendozaAGV14, author = {Luis Omar Colombo{-}Mendoza and Giner Alor{-}Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rafael Valencia{-}Garc{\'{\i}}a}, title = {MobiCloUP!: a PaaS for cloud services-based mobile applications}, journal = {Autom. Softw. Eng.}, volume = {21}, number = {3}, pages = {391--437}, year = {2014}, url = {https://doi.org/10.1007/s10515-014-0143-5}, doi = {10.1007/S10515-014-0143-5}, timestamp = {Sun, 02 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ase/Colombo-MendozaAGV14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biomedsem/ArangurenGW14, author = {Mikel Ega{\~{n}}a Aranguren and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Mark D. Wilkinson}, title = {Executing {SADI} services in Galaxy}, journal = {J. Biomed. Semant.}, volume = {5}, pages = {42}, year = {2014}, url = {https://doi.org/10.1186/2041-1480-5-42}, doi = {10.1186/2041-1480-5-42}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biomedsem/ArangurenGW14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biomedsem/GonzalezCCGADW14, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Alison Callahan and Jos{\'{e}} Cruz{-}Toledo and Adrian Garcia and Mikel Ega{\~{n}}a Aranguren and Michel Dumontier and Mark D. Wilkinson}, title = {Automatically exposing OpenLifeData via {SADI} semantic Web Services}, journal = {J. Biomed. Semant.}, volume = {5}, pages = {46}, year = {2014}, url = {https://doi.org/10.1186/2041-1480-5-46}, doi = {10.1186/2041-1480-5-46}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biomedsem/GonzalezCCGADW14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/caee/Vasquez-Ramirez14, author = {Raquel V{\'{a}}squez{-}Ram{\'{\i}}rez and Giner Alor{-}Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Athena: {A} hybrid management system for multi-device educational content}, journal = {Comput. Appl. Eng. Educ.}, volume = {22}, number = {4}, pages = {750--763}, year = {2014}, url = {https://doi.org/10.1002/cae.21567}, doi = {10.1002/CAE.21567}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/caee/Vasquez-Ramirez14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/chb/RodriguezGGP14, author = {Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and Jos{\'{e}} Emilio Labra Gayo and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Patricia Ord{\'{o}}{\~{n}}ez de Pablos}, title = {Empowering the access to public procurement opportunities by means of linking controlled vocabularies. {A} case study of Product Scheme Classifications in the European e-Procurement sector}, journal = {Comput. Hum. Behav.}, volume = {30}, pages = {674--688}, year = {2014}, url = {https://doi.org/10.1016/j.chb.2013.07.046}, doi = {10.1016/J.CHB.2013.07.046}, timestamp = {Wed, 22 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/chb/RodriguezGGP14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cii/Alor-HernandezSCRGC14, author = {Giner Alor{-}Hern{\'{a}}ndez and Cuauht{\'{e}}moc S{\'{a}}nchez{-}Ram{\'{\i}}rez and Guillermo Cortes Robles and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jorge Luis Garc{\'{\i}}a{-}Alcaraz and Miguel Gast{\'{o}}n Cedillo{-}Campos}, title = {{BROSEMWEB:} {A} brokerage service for e-Procurement using Semantic Web Technologies}, journal = {Comput. Ind.}, volume = {65}, number = {5}, pages = {828--840}, year = {2014}, url = {https://doi.org/10.1016/j.compind.2013.12.007}, doi = {10.1016/J.COMPIND.2013.12.007}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cii/Alor-HernandezSCRGC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fgcs/PalaciosSG14, author = {Ricardo Colomo Palacios and Vladimir Stantchev and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Special issue on exploiting semantic technologies with particularization on linked data over grid and cloud architectures}, journal = {Future Gener. Comput. Syst.}, volume = {32}, pages = {260--262}, year = {2014}, url = {https://doi.org/10.1016/j.future.2013.10.021}, doi = {10.1016/J.FUTURE.2013.10.021}, timestamp = {Wed, 19 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/fgcs/PalaciosSG14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/scp/Valencia-GarciaGP14, author = {Rafael Valencia{-}Garc{\'{\i}}a and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ricardo Colomo Palacios}, title = {Special issue on Systems Development by Means of Semantic Technologies}, journal = {Sci. Comput. Program.}, volume = {95}, pages = {1--2}, year = {2014}, url = {https://doi.org/10.1016/j.scico.2014.04.010}, doi = {10.1016/J.SCICO.2014.04.010}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/scp/Valencia-GarciaGP14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GonzalezRAW14, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Marcos Mart{\'{\i}}nez Romero and Mikel Ega{\~{n}}a Aranguren and Mark D. Wilkinson}, title = {Nanopublishing Clinical Diagnoses: Tracking Diagnostic Knowledge Base Content and Utilization}, booktitle = {2014 {IEEE} 27th International Symposium on Computer-Based Medical Systems, New York, NY, USA, May 27-29, 2014}, pages = {335--340}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/CBMS.2014.82}, doi = {10.1109/CBMS.2014.82}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/GonzalezRAW14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biomedsem/ArangurenFAMGW13, author = {Mikel Ega{\~{n}}a Aranguren and Jesualdo Tom{\'{a}}s Fern{\'{a}}ndez{-}Breis and Erick Antezana and Chris Mungall and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Mark D. Wilkinson}, title = {OPPL-Galaxy, a Galaxy tool for enhancing ontology exploitation as part of bioinformatics workflows}, journal = {J. Biomed. Semant.}, volume = {4}, pages = {2}, year = {2013}, url = {https://doi.org/10.1186/2041-1480-4-2}, doi = {10.1186/2041-1480-4-2}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biomedsem/ArangurenFAMGW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cbm/GonzalezA13, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Giner Alor{-}Hern{\'{a}}ndez}, title = {An approach for solving multi-level diagnosis in high sensitivity medical diagnosis systems through the application of semantic technologies}, journal = {Comput. Biol. Medicine}, volume = {43}, number = {1}, pages = {51--62}, year = {2013}, url = {https://doi.org/10.1016/j.compbiomed.2012.10.007}, doi = {10.1016/J.COMPBIOMED.2012.10.007}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cbm/GonzalezA13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cbm/GonzalezNVMA13, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Javier Torres Ni{\~{n}}o and Rafael Valencia{-}Garc{\'{\i}}a and Miguel Angel Mayer and Giner Alor{-}Hern{\'{a}}ndez}, title = {Using experts feedback in clinical case resolution and arbitration as accuracy diagnosis methodology}, journal = {Comput. Biol. Medicine}, volume = {43}, number = {8}, pages = {975--986}, year = {2013}, url = {https://doi.org/10.1016/j.compbiomed.2013.05.003}, doi = {10.1016/J.COMPBIOMED.2013.05.003}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cbm/GonzalezNVMA13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmmm/Garcia-CrespoABG13, author = {{\'{A}}ngel Garc{\'{\i}}a{-}Crespo and Giner Alor{-}Hern{\'{a}}ndez and Linamara Rizzo Battistella and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Methods and Models for Diagnosis and Prognosis in Medical Systems}, journal = {Comput. Math. Methods Medicine}, volume = {2013}, pages = {184257:1--184257:2}, year = {2013}, url = {https://doi.org/10.1155/2013/184257}, doi = {10.1155/2013/184257}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmmm/Garcia-CrespoABG13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/Monfil-ContrerasARGG13, author = {Erick Ulisses Monfil{-}Contreras and Giner Alor{-}Hern{\'{a}}ndez and Guillermo Cortes Robles and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Israel Gonz{\'{a}}lez{-}Carrasco}, title = {{RESYGEN:} {A} Recommendation System Generator using domain-based heuristics}, journal = {Expert Syst. Appl.}, volume = {40}, number = {1}, pages = {242--256}, year = {2013}, url = {https://doi.org/10.1016/j.eswa.2012.07.016}, doi = {10.1016/J.ESWA.2012.07.016}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/Monfil-ContrerasARGG13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/Perez-GallardoARG13, author = {Yuliana P{\'{e}}rez{-}Gallardo and Giner Alor{-}Hern{\'{a}}ndez and Guillermo Cortes Robles and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Collective intelligence as mechanism of medical diagnosis: The iPixel approach}, journal = {Expert Syst. Appl.}, volume = {40}, number = {7}, pages = {2726--2737}, year = {2013}, url = {https://doi.org/10.1016/j.eswa.2012.11.020}, doi = {10.1016/J.ESWA.2012.11.020}, timestamp = {Tue, 06 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/Perez-GallardoARG13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/GonzalezNA13, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Javier Torres Ni{\~{n}}o and Giner Alor{-}Hern{\'{a}}ndez}, title = {I\({}_{\mbox{KS}}\) index: {A} knowledge-model driven index to estimate the capability of medical diagnosis systems to produce results}, journal = {Expert Syst. Appl.}, volume = {40}, number = {17}, pages = {6798--6804}, year = {2013}, url = {https://doi.org/10.1016/j.eswa.2013.06.052}, doi = {10.1016/J.ESWA.2013.06.052}, timestamp = {Tue, 06 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/GonzalezNA13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijdsst/GonzalezAMRP13, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Giner Alor{-}Hern{\'{a}}ndez and Miguel Angel Mayer and Guillermo Cortes Robles and Yuliana P{\'{e}}rez{-}Gallardo}, title = {Application of Probabilistic Techniques for the Development of a Prognosis Model of Stroke Using Epidemiological Studies}, journal = {Int. J. Decis. Support Syst. Technol.}, volume = {5}, number = {4}, pages = {34--58}, year = {2013}, url = {https://doi.org/10.4018/ijdsst.2013100103}, doi = {10.4018/IJDSST.2013100103}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijdsst/GonzalezAMRP13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jbi/GonzalezMF13, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Miguel Angel Mayer and Jesualdo Tom{\'{a}}s Fern{\'{a}}ndez{-}Breis}, title = {Biomedical information through the implementation of social media environments}, journal = {J. Biomed. Informatics}, volume = {46}, number = {6}, pages = {955--956}, year = {2013}, url = {https://doi.org/10.1016/j.jbi.2013.10.006}, doi = {10.1016/J.JBI.2013.10.006}, timestamp = {Tue, 16 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jbi/GonzalezMF13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jucs/NinoGPJA13, author = {Javier Torres Ni{\~{n}}o and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ricardo Colomo Palacios and Enrique Jim{\'{e}}nez{-}Domingo and Giner Alor{-}Hern{\'{a}}ndez}, title = {Improving Accuracy of Decision Trees Using Clustering Techniques}, journal = {J. Univers. Comput. Sci.}, volume = {19}, number = {4}, pages = {484--501}, year = {2013}, url = {https://doi.org/10.3217/jucs-019-04-0483}, doi = {10.3217/JUCS-019-04-0483}, timestamp = {Fri, 18 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jucs/NinoGPJA13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jwe/Colombo-MendozaAGP13, author = {Luis Omar Colombo{-}Mendoza and Giner Alor{-}Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ricardo Colomo Palacios}, title = {AlexandRIA: {A} Visual Tool for Generating Multi-device Rich Internet Applications}, journal = {J. Web Eng.}, volume = {12}, number = {3{\&}4}, pages = {317--359}, year = {2013}, url = {http://www.rintonpress.com/xjwe12/jwe-12-34/317-359.pdf}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jwe/Colombo-MendozaAGP13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwbbio/IglesiasAGW13, author = {Alejandro Rodriguez Iglesias and Mikel Ega{\~{n}}a Aranguren and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Mark D. Wilkinson}, editor = {Ignacio Rojas and Francisco M. Ortu{\~{n}}o Guzman}, title = {Plant Pathogen Interactions Ontology {(PPIO)}}, booktitle = {International Work-Conference on Bioinformatics and Biomedical Engineering, {IWBBIO} 2013, Granada, Spain, March 18-20, 2013. Proceedings}, pages = {695--702}, publisher = {Copicentro Editorial}, year = {2013}, url = {http://iwbbio.ugr.es/papers/iwbbio\_110.pdf}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iwbbio/IglesiasAGW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmmm/GonzalezNMAW12, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Javier Torres Ni{\~{n}}o and Miguel Angel Mayer and Giner Alor{-}Hern{\'{a}}ndez and Mark D. Wilkinson}, title = {Analysis of a Multilevel Diagnosis Decision Support System and Its Implications: {A} Case Study}, journal = {Comput. Math. Methods Medicine}, volume = {2012}, pages = {367345:1--367345:9}, year = {2012}, url = {https://doi.org/10.1155/2012/367345}, doi = {10.1155/2012/367345}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmmm/GonzalezNMAW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/comsis/GonzalezNJBA12, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Javier Torres Ni{\~{n}}o and Enrique Jim{\'{e}}nez{-}Domingo and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Giner Alor{-}Hern{\'{a}}ndez}, title = {{AKNOBAS:} {A} knowledge-based segmentation recommender system based on intelligent data mining techniques}, journal = {Comput. Sci. Inf. Syst.}, volume = {9}, number = {2}, pages = {713--740}, year = {2012}, url = {https://doi.org/10.2298/CSIS110722008R}, doi = {10.2298/CSIS110722008R}, timestamp = {Tue, 21 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/comsis/GonzalezNJBA12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/Casado-LumbrerasGAP12, author = {Cristina Casado{-}Lumbreras and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and Ricardo Colomo Palacios}, title = {PsyDis: Towards a diagnosis support system for psychological disorders}, journal = {Expert Syst. Appl.}, volume = {39}, number = {13}, pages = {11391--11403}, year = {2012}, url = {https://doi.org/10.1016/j.eswa.2012.04.033}, doi = {10.1016/J.ESWA.2012.04.033}, timestamp = {Wed, 22 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/Casado-LumbrerasGAP12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/GonzalezTHJA12, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Javier Torres Ni{\~{n}}o and Gandhi Hern{\'{a}}ndez{-}Chan and Enrique Jim{\'{e}}nez{-}Domingo and Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez}, title = {Using agents to parallelize a medical reasoning system based on ontologies and description logics as an application case}, journal = {Expert Syst. Appl.}, volume = {39}, number = {18}, pages = {13085--13092}, year = {2012}, url = {https://doi.org/10.1016/j.eswa.2012.05.093}, doi = {10.1016/J.ESWA.2012.05.093}, timestamp = {Wed, 22 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/GonzalezTHJA12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijhcitp/PalaciosSAG12, author = {Ricardo Colomo Palacios and Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and Giner Alor{-}Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {Linked Data: Perspectives for {IT} Professionals}, journal = {Int. J. Hum. Cap. Inf. Technol. Prof.}, volume = {3}, number = {3}, pages = {1--12}, year = {2012}, url = {https://doi.org/10.4018/jhcitp.2012070101}, doi = {10.4018/JHCITP.2012070101}, timestamp = {Sat, 25 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijhcitp/PalaciosSAG12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijmso/GonzalezRCP12, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and Cristina Casado{-}Lumbreras and Ricardo Colomo Palacios}, title = {Towards an ontology for psychological disorders}, journal = {Int. J. Metadata Semant. Ontologies}, volume = {7}, number = {4}, pages = {260--268}, year = {2012}, url = {https://doi.org/10.1504/IJMSO.2012.051489}, doi = {10.1504/IJMSO.2012.051489}, timestamp = {Sun, 22 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijmso/GonzalezRCP12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijseke/GonzalezVC12, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Rafael Valencia{-}Garc{\'{\i}}a and Ricardo Colomo Palacios}, title = {Guest Editors' Introduction}, journal = {Int. J. Softw. Eng. Knowl. Eng.}, volume = {22}, number = {3}, pages = {323--324}, year = {2012}, url = {https://doi.org/10.1142/S0218194012020020}, doi = {10.1142/S0218194012020020}, timestamp = {Wed, 22 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijseke/GonzalezVC12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isf/GonzalezPGBG12, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Ricardo Colomo Palacios and Fernando Guldr{\'{\i}}s{-}Iglesias and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo}, title = {{FAST:} Fundamental Analysis Support for Financial Statements. Using semantics for trading recommendations}, journal = {Inf. Syst. Frontiers}, volume = {14}, number = {5}, pages = {999--1017}, year = {2012}, url = {https://doi.org/10.1007/s10796-011-9321-1}, doi = {10.1007/S10796-011-9321-1}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/isf/GonzalezPGBG12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jms/GonzalezGPMBG12, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jos{\'{e}} Emilio Labra Gayo and Ricardo Colomo Palacios and Miguel Angel Mayer and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo}, title = {SeDeLo: Using Semantics and Description Logics to Support Aided Clinical Diagnosis}, journal = {J. Medical Syst.}, volume = {36}, number = {4}, pages = {2471--2481}, year = {2012}, url = {https://doi.org/10.1007/s10916-011-9714-1}, doi = {10.1007/S10916-011-9714-1}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jms/GonzalezGPMBG12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/conielecomp/Colombo-MendozaAG12, author = {Luis Omar Colombo{-}Mendoza and Giner Alor{-}Hern{\'{a}}ndez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Pedro Ba{\~{n}}uelos S{\'{a}}nchez and Roberto Rosas{-}Romero and Mauricio Javier Osorio Galindo}, title = {A novel approach for generating multi-device Rich Internet Applications}, booktitle = {22nd International Conference on Electrical Communications and Computers, {CONIELECOMP} 2012, Cholula, Puebla, Mexico, February 27-29, 2012}, pages = {361--367}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/CONIELECOMP.2012.6189939}, doi = {10.1109/CONIELECOMP.2012.6189939}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/conielecomp/Colombo-MendozaAG12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/intenv/SandovalTPR12, author = {Oscar Sandoval and Paolo Tripicchio and Otniel Portillo{-}Rodr{\'{\i}}guez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Juan A. Bot{\'{\i}}a and Hedda Rahel Schmidtke and Tatsuo Nakashima and Mohammed R. Al{-}Mulla and Juan Carlos Augusto and Asier Aztiria and Matthew Ball and Victor Callaghan and Diane J. Cook and James Dooley and John O'Donoghue and Simon Egerton and Pablo A. Haya and Miguel J. Hornos and Eduardo Morales and Juan Carlos Orozco and Otniel Portillo{-}Rodr{\'{\i}}guez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Oscar Sandoval and Paolo Tripicchio and Minjuan Wang and V{\'{\i}}ctor Zamudio}, title = {Introduction to the Proceedings of IMIASH'12}, booktitle = {Workshop Proceedings of the 8th International Conference on Intelligent Environments, Guanajuato, Mexico, June 26-29, 2012}, series = {Ambient Intelligence and Smart Environments}, volume = {13}, pages = {311}, publisher = {{IOS} Press}, year = {2012}, timestamp = {Sat, 23 Jun 2018 18:45:57 +0200}, biburl = {https://dblp.org/rec/conf/intenv/SandovalTPR12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/intenv/Posada-GomezRLAMR12, author = {Rub{\'{e}}n Posada{-}G{\'{o}}mez and Cristhian Omar Rodriguez{-}Bernardo and Phares Salathiel Luna{-}Bravo and Giner Alor{-}Hern{\'{a}}ndez and Albino Mart{\'{\i}}nez{-}Sibaja and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Juan A. Bot{\'{\i}}a and Hedda Rahel Schmidtke and Tatsuo Nakashima and Mohammed R. Al{-}Mulla and Juan Carlos Augusto and Asier Aztiria and Matthew Ball and Victor Callaghan and Diane J. Cook and James Dooley and John O'Donoghue and Simon Egerton and Pablo A. Haya and Miguel J. Hornos and Eduardo Morales and Juan Carlos Orozco and Otniel Portillo{-}Rodr{\'{\i}}guez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Oscar Sandoval and Paolo Tripicchio and Minjuan Wang and V{\'{\i}}ctor Zamudio}, title = {Development of a natural interaction interface for people with disabilities in a home automation control room}, booktitle = {Workshop Proceedings of the 8th International Conference on Intelligent Environments, Guanajuato, Mexico, June 26-29, 2012}, series = {Ambient Intelligence and Smart Environments}, volume = {13}, pages = {353--361}, publisher = {{IOS} Press}, year = {2012}, url = {https://doi.org/10.3233/978-1-61499-080-2-353}, doi = {10.3233/978-1-61499-080-2-353}, timestamp = {Tue, 23 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/intenv/Posada-GomezRLAMR12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/intenv/Herrera-AguilarSSJRAP12, author = {Ignacio Herrera{-}Aguilar and Oscar Osvaldo Sandoval{-}Gonzalez and Blanca E. Gonz{\'{a}}lez S{\'{a}}nchez and Juan Manuel Jacinto{-}Villegas and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Giner Alor{-}Hern{\'{a}}ndez and Otniel Portillo{-}Rodr{\'{\i}}guez}, editor = {Juan A. Bot{\'{\i}}a and Hedda Rahel Schmidtke and Tatsuo Nakashima and Mohammed R. Al{-}Mulla and Juan Carlos Augusto and Asier Aztiria and Matthew Ball and Victor Callaghan and Diane J. Cook and James Dooley and John O'Donoghue and Simon Egerton and Pablo A. Haya and Miguel J. Hornos and Eduardo Morales and Juan Carlos Orozco and Otniel Portillo{-}Rodr{\'{\i}}guez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Oscar Sandoval and Paolo Tripicchio and Minjuan Wang and V{\'{\i}}ctor Zamudio}, title = {Visuo-Vibrotactile Stimuli Applied for Skills Transfer and Rehabilitation}, booktitle = {Workshop Proceedings of the 8th International Conference on Intelligent Environments, Guanajuato, Mexico, June 26-29, 2012}, series = {Ambient Intelligence and Smart Environments}, volume = {13}, pages = {362--369}, publisher = {{IOS} Press}, year = {2012}, url = {https://doi.org/10.3233/978-1-61499-080-2-362}, doi = {10.3233/978-1-61499-080-2-362}, timestamp = {Tue, 23 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/intenv/Herrera-AguilarSSJRAP12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/otm/PalaciosGCF12, author = {Ricardo Colomo Palacios and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Antonio Cabanas{-}Abascal and Joaqu{\'{\i}}n M. Fern{\'{a}}ndez{-}Gonz{\'{a}}lez}, editor = {Pilar Herrero and Herv{\'{e}} Panetto and Robert Meersman and Tharam S. Dillon}, title = {Post-via: After Visit Tourist Services Enabled by Semantics}, booktitle = {On the Move to Meaningful Internet Systems: {OTM} 2012 Workshops, Confederated International Workshops: {OTM} Academy, Industry Case Studies Program, EI2N, INBAST, META4eS, OnToContent, ORM, SeDeS, SINCOM, and {SOMOCO} 2012, Rome, Italy, September 10-14, 2012. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {7567}, pages = {183--193}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-33618-8\_27}, doi = {10.1007/978-3-642-33618-8\_27}, timestamp = {Thu, 14 Oct 2021 10:28:28 +0200}, biburl = {https://dblp.org/rec/conf/otm/PalaciosGCF12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/intenv/2012w, editor = {Juan A. Bot{\'{\i}}a and Hedda Rahel Schmidtke and Tatsuo Nakashima and Mohammed R. Al{-}Mulla and Juan Carlos Augusto and Asier Aztiria and Matthew Ball and Victor Callaghan and Diane J. Cook and James Dooley and John O'Donoghue and Simon Egerton and Pablo A. Haya and Miguel J. Hornos and Eduardo Morales and Juan Carlos Orozco and Otniel Portillo{-}Rodr{\'{\i}}guez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Oscar Sandoval and Paolo Tripicchio and Minjuan Wang and V{\'{\i}}ctor Zamudio}, title = {Workshop Proceedings of the 8th International Conference on Intelligent Environments, Guanajuato, Mexico, June 26-29, 2012}, series = {Ambient Intelligence and Smart Environments}, volume = {13}, publisher = {{IOS} Press}, year = {2012}, url = {http://www.booksonline.iospress.nl/Content/View.aspx?piid=30661}, isbn = {978-1-61499-079-6}, timestamp = {Sat, 23 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/intenv/2012w.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/semweb/2012satbi, editor = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jyotishman Pathak and Mark D. Wilkinson and Nigam Shah and Robert Stevens and Richard D. Boyce and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo}, title = {Proceedings of the Joint Workshop on Semantic Technologies Applied to Biomedical Informatics and Individualized Medicine, Boston, USA, November 12, 2012}, series = {{CEUR} Workshop Proceedings}, volume = {930}, publisher = {CEUR-WS.org}, year = {2012}, url = {https://ceur-ws.org/Vol-930}, urn = {urn:nbn:de:0074-930-6}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/semweb/2012satbi.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/GonzalezGPIB11, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and Ricardo Colomo Palacios and Fernando Guldr{\'{\i}}s{-}Iglesias and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s}, title = {{CAST:} Using neural networks to improve trading systems based on technical analysis by means of the {RSI} financial indicator}, journal = {Expert Syst. Appl.}, volume = {38}, number = {9}, pages = {11489--11500}, year = {2011}, url = {https://doi.org/10.1016/j.eswa.2011.03.023}, doi = {10.1016/J.ESWA.2011.03.023}, timestamp = {Wed, 01 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/GonzalezGPIB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijdsst/GonzalezGPGBA11, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and Ricardo Colomo Palacios and Jos{\'{e}} Emilio Labra Gayo and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Giner Alor{-}Hern{\'{a}}ndez}, title = {Automated Diagnosis Through Ontologies and Logical Descriptions: The {ADONIS} Approach}, journal = {Int. J. Decis. Support Syst. Technol.}, volume = {3}, number = {1}, pages = {21--39}, year = {2011}, url = {https://doi.org/10.4018/jdsst.2011010102}, doi = {10.4018/JDSST.2011010102}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijdsst/GonzalezGPGBA11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijkbo/GonzalezGPBJ11, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and Ricardo Colomo Palacios and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Enrique Jim{\'{e}}nez{-}Domingo}, title = {Using Ontologies in Drug Prescription: The SemMed Approach}, journal = {Int. J. Knowl. Based Organ.}, volume = {1}, number = {4}, pages = {1--15}, year = {2011}, url = {https://doi.org/10.4018/ijkbo.2011100101}, doi = {10.4018/IJKBO.2011100101}, timestamp = {Thu, 24 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijkbo/GonzalezGPBJ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bcb/GonzalezDGABP11, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Enrique Jim{\'{e}}nez{-}Domingo and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and Giner Alor{-}Hern{\'{a}}ndez and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Rub{\'{e}}n Posada{-}G{\'{o}}mez}, editor = {Robert Grossman and Andrey Rzhetsky and Sun Kim and Wei Wang}, title = {Designing an ontology to support the creation of diagnostic decision support system}, booktitle = {{ACM} International Conference on Bioinformatics, Computational Biology and Biomedicine, BCB' 11, Chicago, IL, {USA} - July 31 - August 03, 2011}, pages = {612--616}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2147805.2147911}, doi = {10.1145/2147805.2147911}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/bcb/GonzalezDGABP11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/igi/11/GonzalezGPGG11, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and Ricardo Colomo Palacios and Jos{\'{e}} Emilio Labra Gayo and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s}, editor = {Miltiadis D. Lytras and Patricia Ord{\'{o}}{\~{n}}ez de Pablos and Ernesto Damiani}, title = {Locating Doctors using Social and Semantic Web Technologies: The MedFinder Approach}, booktitle = {Semantic Web Personalization and Context Awareness - Management of Personal Identities and Social Networking}, pages = {94--106}, publisher = {{IGI} Global}, year = {2011}, url = {https://doi.org/10.4018/978-1-61520-921-7.ch009}, doi = {10.4018/978-1-61520-921-7.CH009}, timestamp = {Mon, 16 Sep 2019 14:43:11 +0200}, biburl = {https://dblp.org/rec/books/igi/11/GonzalezGPGG11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/Garcia-CrespoGMBP10, author = {{\'{A}}ngel Garc{\'{\i}}a{-}Crespo and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Myriam Mencke and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Ricardo Colomo Palacios}, title = {{ODDIN:} Ontology-driven differential diagnosis based on logical inference and probabilistic refinements}, journal = {Expert Syst. Appl.}, volume = {37}, number = {3}, pages = {2621--2628}, year = {2010}, url = {https://doi.org/10.1016/j.eswa.2009.08.016}, doi = {10.1016/J.ESWA.2009.08.016}, timestamp = {Wed, 01 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/Garcia-CrespoGMBP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcci/Alor-HernandezAJPRMBG10, author = {Giner Alor{-}Hern{\'{a}}ndez and Alberto Alfonso Aguilar{-}Lasserre and Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Guillermo Cortes Robles and Mario Alberto Garcia Martinez and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, title = {{HYDRA:} {A} Middleware-Oriented Integrated Architecture for e-Procurement in Supply Chains}, journal = {Trans. Comput. Collect. Intell.}, volume = {1}, pages = {1--20}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15034-0\_1}, doi = {10.1007/978-3-642-15034-0\_1}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcci/Alor-HernandezAJPRMBG10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GonzalezMABRL10, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Miguel Angel Mayer and Giner Alor{-}Hern{\'{a}}ndez and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Guillermo Cortes Robles and Angel Lagares Lemos}, editor = {Tharam S. Dillon and Daniel L. Rubin and William M. Gallagher and Amandeep S. Sidhu and Alexey Tsymbal}, title = {Using ontologies and probabilistic networks to develop a preventive stroke diagnosis system {(PSDS)}}, booktitle = {{IEEE} 23rd International Symposium on Computer-Based Medical Systems {(CBMS} 2010), Perth, Australia, October 12-15, 2010}, pages = {370--377}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/CBMS.2010.6042672}, doi = {10.1109/CBMS.2010.6042672}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/GonzalezMABRL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pkaw/GonzalezGPBJAPR10, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Fernando Guldr{\'{\i}}s{-}Iglesias and Ricardo Colomo Palacios and Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and Enrique Jim{\'{e}}nez{-}Domingo and Giner Alor{-}Hern{\'{a}}ndez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Guillermo Cortes Robles}, editor = {Byeong Ho Kang and Debbie Richards}, title = {Improving Trading Systems Using the {RSI} Financial Indicator and Neural Networks}, booktitle = {Knowledge Management and Acquisition for Smart Systems and Services, 11th International Workshop, {PKAW} 2010, Daegu, Korea, August 20 - September 3, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6232}, pages = {27--37}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15037-1\_3}, doi = {10.1007/978-3-642-15037-1\_3}, timestamp = {Tue, 30 Aug 2022 08:51:41 +0200}, biburl = {https://dblp.org/rec/conf/pkaw/GonzalezGPBJAPR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/GonzalezGAGP09, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jos{\'{e}} Emilio Labra Gayo and Giner Alor{-}Hern{\'{a}}ndez and Juan Miguel G{\'{o}}mez and Rub{\'{e}}n Posada{-}G{\'{o}}mez}, title = {{ADONIS:} Automated diagnosis system based on sound and precise logical descriptions}, booktitle = {Proceedings of the Twenty-Second {IEEE} International Symposium on Computer-Based Medical Systems, August 3-4, 2009, Albuquerque, New Mexico, {USA}}, pages = {1--8}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/CBMS.2009.5255449}, doi = {10.1109/CBMS.2009.5255449}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/GonzalezGAGP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/etelemed/RodriguezMAPGA09, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Myriam Mencke and Giner Alor{-}Hern{\'{a}}ndez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Juan Miguel G{\'{o}}mez and Alberto Alfonso Aguilar{-}Lasserre}, title = {{MEDBOLI:} Medical Diagnosis Based on Ontologies and Logical Inference}, booktitle = {International Conference on eHealth, Telemedicine, and Social Medicine, eTELEMED 2009, February 1-7, 2009, Cancun, Mexico}, pages = {233--238}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/eTELEMED.2009.43}, doi = {10.1109/ETELEMED.2009.43}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/etelemed/RodriguezMAPGA09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccci/GonzalezJRGAPG09, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Enrique Jim{\'{e}}nez{-}Domingo and Mateusz Radzimski and Juan Miguel G{\'{o}}mez and Giner Alor{-}Hern{\'{a}}ndez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Jos{\'{e}} Emilio Labra Gayo}, editor = {Ngoc Thanh Nguyen and Radoslaw P. Katarzyniak and Adam Janiak}, title = {Applying Caching Capabilities to Inference Applications Based on Semantic Web}, booktitle = {New Challenges in Computational Collective Intelligence [selected papers from the 1st International Conference on Collective Intelligence - Semantic Web, Social Networks {\&} Multiagent Systems, {ICCCI} 2009]}, series = {Studies in Computational Intelligence}, volume = {244}, pages = {27--37}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03958-4\_3}, doi = {10.1007/978-3-642-03958-4\_3}, timestamp = {Thu, 16 Mar 2023 20:00:29 +0100}, biburl = {https://dblp.org/rec/conf/iccci/GonzalezJRGAPG09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccci/Alor-HernandezAJPRMGMG09, author = {Giner Alor{-}Hern{\'{a}}ndez and Alberto Alfonso Aguilar{-}Lasserre and Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Guillermo Cortes Robles and Mario Alberto Garcia Martinez and Juan Miguel G{\'{o}}mez and Myriam Mencke and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Ngoc Thanh Nguyen and Ryszard Kowalczyk and Shyi{-}Ming Chen}, title = {A Hybrid Architecture for E-Procurement}, booktitle = {Computational Collective Intelligence. Semantic Web, Social Networks and Multiagent Systems, First International Conference, {ICCCI} 2009, Wroclaw, Poland, October 5-7, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5796}, pages = {685--696}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-04441-0\_60}, doi = {10.1007/978-3-642-04441-0\_60}, timestamp = {Thu, 16 Mar 2023 20:00:29 +0100}, biburl = {https://dblp.org/rec/conf/iccci/Alor-HernandezAJPRMGMG09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iciw/GonzalezEMFJGAPR09, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Martin Eccius and Myriam Mencke and Jes{\'{u}}s Fern{\'{a}}ndez and Enrique Jim{\'{e}}nez{-}Domingo and Juan Miguel G{\'{o}}mez and Giner Alor{-}Hern{\'{a}}ndez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Guillermo Cortes Robles}, editor = {Mark Perry and Hideyasu Sasaki and Matthias Ehmann and Guadalupe Ortiz and Oana Dini}, title = {A Multi-agent System for Traffic Control for Emergencies by Quadrants}, booktitle = {Fourth International Conference on Internet and Web Applications and Services, {ICIW} 2009, 24-28 May 2009, Venice/Mestre, Italy}, pages = {247--253}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/ICIW.2009.42}, doi = {10.1109/ICIW.2009.42}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iciw/GonzalezEMFJGAPR09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ideal/RoblesAAJPGG09, author = {Guillermo Cortes Robles and Giner Alor{-}Hern{\'{a}}ndez and Alberto Alfonso Aguilar{-}Lasserre and Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Juan Miguel G{\'{o}}mez and Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez}, editor = {Emilio Corchado and Hujun Yin}, title = {Resources Oriented Search: {A} Strategy to Transfer Knowledge in the {TRIZ-CBR} Synergy}, booktitle = {Intelligent Data Engineering and Automated Learning - {IDEAL} 2009, 10th International Conference, Burgos, Spain, September 23-26, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5788}, pages = {518--526}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-04394-9\_63}, doi = {10.1007/978-3-642-04394-9\_63}, timestamp = {Sat, 10 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ideal/RoblesAAJPGG09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/intensive/GonzalezJFEGAPL09, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Enrique Jim{\'{e}}nez{-}Domingo and Jes{\'{u}}s Fern{\'{a}}ndez and Martin Eccius and Juan Miguel G{\'{o}}mez and Giner Alor{-}Hern{\'{a}}ndez and Rub{\'{e}}n Posada{-}G{\'{o}}mez and Carlos Laufer}, editor = {Fernando Boronat and Cosmin Dini}, title = {SemMed: Applying Semantic Web to Medical Recommendation Systems}, booktitle = {First International Conference on Intensive Applications and Services, {INTENSIVE} 2009, Valencia, Spain, 20-25 April 2009}, pages = {47--52}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/INTENSIVE.2009.12}, doi = {10.1109/INTENSIVE.2009.12}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/intensive/GonzalezJFEGAPL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/webist/GonzalezFJMRGAP09, author = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and Jes{\'{u}}s Fern{\'{a}}ndez and Enrique Jim{\'{e}}nez{-}Domingo and Myriam Mencke and Mateusz Radzimski and Juan Miguel G{\'{o}}mez and Giner Alor{-}Hern{\'{a}}ndez and Rub{\'{e}}n Posada{-}G{\'{o}}mez}, editor = {Joaquim Filipe and Jos{\'{e}} Cordeiro}, title = {{MEDFINDER} - Using Semantic Web, Web 2.0 and Geolocation Methods to Develop a Decision Support System to Locate Doctors}, booktitle = {{WEBIST} 2009 - Proceedings of the Fifth International Conference on Web Information Systems and Technologies, Lisbon, Portugal, March 23-26, 2009}, pages = {288--293}, publisher = {{INSTICC} Press}, year = {2009}, timestamp = {Thu, 17 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/webist/GonzalezFJMRGAP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.