Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: Eduard H. Hovy
@article{DBLP:journals/corr/abs-2402-18005,
author = {Miao Li and
Jey Han Lau and
Eduard H. Hovy},
title = {Exploring Multi-Document Information Consolidation for Scientific
Sentiment Summarization},
journal = {CoRR},
volume = {abs/2402.18005},
year = {2024},
url = {https://doi.org/10.48550/arXiv.2402.18005},
doi = {10.48550/ARXIV.2402.18005},
eprinttype = {arXiv},
eprint = {2402.18005},
timestamp = {Tue, 26 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2402-18005.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/WenXHH23,
author = {Haoyang Wen and
Zhenxin Xiao and
Eduard H. Hovy and
Alexander G. Hauptmann},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {Towards Open-Domain Twitter User Profile Inference},
booktitle = {Findings of the Association for Computational Linguistics: {ACL} 2023,
Toronto, Canada, July 9-14, 2023},
pages = {3172--3188},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-acl.198},
doi = {10.18653/V1/2023.FINDINGS-ACL.198},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/WenXHH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/OtaniAKH23,
author = {Naoki Otani and
Jun Araki and
HyeongSik Kim and
Eduard H. Hovy},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {A Textual Dataset for Situated Proactive Response Selection},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {3856--3874},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.214},
doi = {10.18653/V1/2023.ACL-LONG.214},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/OtaniAKH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/TedeschiBDHHHKK23,
author = {Simone Tedeschi and
Johan Bos and
Thierry Declerck and
Jan Hajic and
Daniel Hershcovich and
Eduard H. Hovy and
Alexander Koller and
Simon Krek and
Steven Schockaert and
Rico Sennrich and
Ekaterina Shutova and
Roberto Navigli},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {What's the Meaning of Superhuman Performance in Today's NLU?},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {12471--12491},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.697},
doi = {10.18653/V1/2023.ACL-LONG.697},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/TedeschiBDHHHKK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/FengKSGH23,
author = {Steven Y. Feng and
Vivek Khetan and
Bogdan Sacaleanu and
Anatole Gershman and
Eduard H. Hovy},
editor = {Andreas Vlachos and
Isabelle Augenstein},
title = {{CHARD:} Clinical Health-Aware Reasoning Across Dimensions for Text
Generation Models},
booktitle = {Proceedings of the 17th Conference of the European Chapter of the
Association for Computational Linguistics, {EACL} 2023, Dubrovnik,
Croatia, May 2-6, 2023},
pages = {313--327},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.eacl-main.24},
doi = {10.18653/V1/2023.EACL-MAIN.24},
timestamp = {Thu, 05 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eacl/FengKSGH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/KehFGAH23,
author = {Sedrick Scott Keh and
Steven Y. Feng and
Varun Gangal and
Malihe Alikhani and
Eduard H. Hovy},
editor = {Andreas Vlachos and
Isabelle Augenstein},
title = {{PANCETTA:} Phoneme Aware Neural Completion to Elicit Tongue Twisters
Automatically},
booktitle = {Proceedings of the 17th Conference of the European Chapter of the
Association for Computational Linguistics, {EACL} 2023, Dubrovnik,
Croatia, May 2-6, 2023},
pages = {491--504},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.eacl-main.36},
doi = {10.18653/V1/2023.EACL-MAIN.36},
timestamp = {Thu, 05 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eacl/KehFGAH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiHL23,
author = {Miao Li and
Eduard H. Hovy and
Jey Han Lau},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Summarizing Multiple Documents with Conversational Structure for Meta-Review
Generation},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {7089--7112},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.472},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.472},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LiHL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiHYEL00YTHJ23,
author = {Sha Li and
Chi Han and
Pengfei Yu and
Carl Edwards and
Manling Li and
Xingyao Wang and
Yi Ren Fung and
Charles Yu and
Joel R. Tetreault and
Eduard H. Hovy and
Heng Ji},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Defining a New {NLP} Playground},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {11932--11951},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.799},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.799},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LiHYEL00YTHJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhangSH23,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Data-efficient Active Learning for Structured Prediction with Partial
Annotation and Self-Training},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {12991--13008},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.865},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.865},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/RajagopalKSGFH23,
author = {Dheeraj Rajagopal and
Vivek Khetan and
Bogdan Sacaleanu and
Anatole Gershman and
Andrew E. Fano and
Eduard H. Hovy},
editor = {Jong C. Park and
Yuki Arase and
Baotian Hu and
Wei Lu and
Derry Wijaya and
Ayu Purwarianti and
Adila Alfa Krisnadhi},
title = {Template Filling for Controllable Commonsense Reasoning},
booktitle = {Findings of the Association for Computational Linguistics: {IJCNLP-AACL}
2023 - Findings, Nusa Dua, Bali, November 1-4, 2023},
pages = {250--260},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-ijcnlp.23},
doi = {10.18653/V1/2023.FINDINGS-IJCNLP.23},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/RajagopalKSGFH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sustainlp/ZhangSH23,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
editor = {Nafise Sadat Moosavi and
Iryna Gurevych and
Yufang Hou and
Gyuwan Kim and
Young Jin Kim and
Tal Schuster and
Ameeta Agrawal},
title = {On the Interactions of Structural Constraints and Data Resources for
Structured Prediction},
booktitle = {Proceedings of The Fourth Workshop on Simple and Efficient Natural
Language Processing, SustaiNLP 2023, Toronto, Canada (Hybrid), July
13, 2023},
pages = {147--157},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.sustainlp-1.10},
doi = {10.18653/V1/2023.SUSTAINLP-1.10},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sustainlp/ZhangSH23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-01498,
author = {Miao Li and
Eduard H. Hovy and
Jey Han Lau},
title = {Towards Summarizing Multiple Documents with Hierarchical Relationships},
journal = {CoRR},
volume = {abs/2305.01498},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.01498},
doi = {10.48550/ARXIV.2305.01498},
eprinttype = {arXiv},
eprint = {2305.01498},
timestamp = {Fri, 05 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-01498.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-08414,
author = {Simone Tedeschi and
Johan Bos and
Thierry Declerck and
Jan Hajic and
Daniel Hershcovich and
Eduard H. Hovy and
Alexander Koller and
Simon Krek and
Steven Schockaert and
Rico Sennrich and
Ekaterina Shutova and
Roberto Navigli},
title = {What's the Meaning of Superhuman Performance in Today's NLU?},
journal = {CoRR},
volume = {abs/2305.08414},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.08414},
doi = {10.48550/ARXIV.2305.08414},
eprinttype = {arXiv},
eprint = {2305.08414},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-08414.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-12634,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
title = {Data-efficient Active Learning for Structured Prediction with Partial
Annotation and Self-Training},
journal = {CoRR},
volume = {abs/2305.12634},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.12634},
doi = {10.48550/ARXIV.2305.12634},
eprinttype = {arXiv},
eprint = {2305.12634},
timestamp = {Fri, 26 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-12634.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-05189,
author = {Isabelle Augenstein and
Timothy Baldwin and
Meeyoung Cha and
Tanmoy Chakraborty and
Giovanni Luca Ciampaglia and
David P. A. Corney and
Renee DiResta and
Emilio Ferrara and
Scott Hale and
Alon Y. Halevy and
Eduard H. Hovy and
Heng Ji and
Filippo Menczer and
Rub{\'{e}}n M{\'{\i}}guez and
Preslav Nakov and
Dietram Scheufele and
Shivam Sharma and
Giovanni Zagni},
title = {Factuality Challenges in the Era of Large Language Models},
journal = {CoRR},
volume = {abs/2310.05189},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.05189},
doi = {10.48550/ARXIV.2310.05189},
eprinttype = {arXiv},
eprint = {2310.05189},
timestamp = {Fri, 20 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-05189.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2310-20633,
author = {Sha Li and
Chi Han and
Pengfei Yu and
Carl Edwards and
Manling Li and
Xingyao Wang and
Yi R. Fung and
Charles Yu and
Joel R. Tetreault and
Eduard H. Hovy and
Heng Ji},
title = {Defining a New {NLP} Playground},
journal = {CoRR},
volume = {abs/2310.20633},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2310.20633},
doi = {10.48550/ARXIV.2310.20633},
eprinttype = {arXiv},
eprint = {2310.20633},
timestamp = {Fri, 17 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2310-20633.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2312-05603,
author = {Shuhe Wang and
Beiming Cao and
Shengyu Zhang and
Xiaoya Li and
Jiwei Li and
Fei Wu and
Guoyin Wang and
Eduard H. Hovy},
title = {Sim-GPT: Text Similarity via {GPT} Annotated Data},
journal = {CoRR},
volume = {abs/2312.05603},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2312.05603},
doi = {10.48550/ARXIV.2312.05603},
eprinttype = {arXiv},
eprint = {2312.05603},
timestamp = {Wed, 03 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2312-05603.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/FengLTAMHG22,
author = {Steven Y. Feng and
Kevin Lu and
Zhuofu Tao and
Malihe Alikhani and
Teruko Mitamura and
Eduard H. Hovy and
Varun Gangal},
title = {Retrieve, Caption, Generate: Visual Grounding for Enhancing Commonsense
in Text Generation Models},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {10618--10626},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i10.21306},
doi = {10.1609/AAAI.V36I10.21306},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/FengLTAMHG22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/GangalFAMH22,
author = {Varun Gangal and
Steven Y. Feng and
Malihe Alikhani and
Teruko Mitamura and
Eduard H. Hovy},
title = {{NAREOR:} The Narrative Reordering Problem},
booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI}
2022, Thirty-Fourth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22
- March 1, 2022},
pages = {10645--10653},
publisher = {{AAAI} Press},
year = {2022},
url = {https://doi.org/10.1609/aaai.v36i10.21309},
doi = {10.1609/AAAI.V36I10.21309},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/GangalFAMH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/KehLGFJAH22,
author = {Sedrick Scott Keh and
Kevin Lu and
Varun Gangal and
Steven Y. Feng and
Harsh Jhamtani and
Malihe Alikhani and
Eduard H. Hovy},
editor = {Nicoletta Calzolari and
Chu{-}Ren Huang and
Hansaem Kim and
James Pustejovsky and
Leo Wanner and
Key{-}Sun Choi and
Pum{-}Mo Ryu and
Hsin{-}Hsi Chen and
Lucia Donatelli and
Heng Ji and
Sadao Kurohashi and
Patrizia Paggio and
Nianwen Xue and
Seokhwan Kim and
Younggyun Hahm and
Zhong He and
Tony Kyungil Lee and
Enrico Santus and
Francis Bond and
Seung{-}Hoon Na},
title = {{PINEAPPLE:} Personifying INanimate Entities by Acquiring Parallel
Personification Data for Learning Enhanced Generation},
booktitle = {Proceedings of the 29th International Conference on Computational
Linguistics, {COLING} 2022, Gyeongju, Republic of Korea, October 12-17,
2022},
pages = {6270--6284},
publisher = {International Committee on Computational Linguistics},
year = {2022},
url = {https://aclanthology.org/2022.coling-1.547},
timestamp = {Thu, 13 Oct 2022 17:29:38 +0200},
biburl = {https://dblp.org/rec/conf/coling/KehLGFJAH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/SpiliopoulouPBH22,
author = {Evangelia Spiliopoulou and
Artidoro Pagnoni and
Yonatan Bisk and
Eduard H. Hovy},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {EvEntS ReaLM: Event Reasoning of Entity States via Language Models},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {1982--1997},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.129},
doi = {10.18653/V1/2022.EMNLP-MAIN.129},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/SpiliopoulouPBH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhangSH22,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {Transfer Learning from Semantic Role Labeling to Event Argument Extraction
with Template-based Slot Querying},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {2627--2647},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.169},
doi = {10.18653/V1/2022.EMNLP-MAIN.169},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ReddyCWFCEPNHSJ22,
author = {Revanth Gangi Reddy and
Sai Chetan Chinthakindi and
Zhenhailong Wang and
Yi R. Fung and
Kathryn Conger and
Ahmed Elsayed and
Martha Palmer and
Preslav Nakov and
Eduard H. Hovy and
Kevin Small and
Heng Ji},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {NewsClaims: {A} New Benchmark for Claim Detection from News with Attribute
Knowledge},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {6002--6018},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.403},
doi = {10.18653/V1/2022.EMNLP-MAIN.403},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ReddyCWFCEPNHSJ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhangSH22a,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {A Survey of Active Learning for Natural Language Processing},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {6166--6190},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.414},
doi = {10.18653/V1/2022.EMNLP-MAIN.414},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH22a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/RajagopalZGJYH22,
author = {Dheeraj Rajagopal and
Xuchao Zhang and
Michael Gamon and
Sujay Kumar Jauhar and
Diyi Yang and
Eduard H. Hovy},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Jan Odijk and
Stelios Piperidis},
title = {One Document, Many Revisions: {A} Dataset for Classification and Description
of Edit Intents},
booktitle = {Proceedings of the Thirteenth Language Resources and Evaluation Conference,
{LREC} 2022, Marseille, France, 20-25 June 2022},
pages = {5517--5524},
publisher = {European Language Resources Association},
year = {2022},
url = {https://aclanthology.org/2022.lrec-1.591},
timestamp = {Mon, 10 Oct 2022 16:57:52 +0200},
biburl = {https://dblp.org/rec/conf/lrec/RajagopalZGJYH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tsd/Echizen-yaAH22,
author = {Hiroshi Echizen{-}ya and
Kenji Araki and
Eduard H. Hovy},
editor = {Petr Sojka and
Ales Hor{\'{a}}k and
Ivan Kopecek and
Karel Pala},
title = {{OPTICS:} Automatic {MT} Evaluation Based on Optimal Transport by
Integration of Contextual Representations and Static Word Embeddings},
booktitle = {Text, Speech, and Dialogue - 25th International Conference, {TSD}
2022, Brno, Czech Republic, September 6-9, 2022, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {13502},
pages = {225--237},
publisher = {Springer},
year = {2022},
url = {https://doi.org/10.1007/978-3-031-16270-1\_19},
doi = {10.1007/978-3-031-16270-1\_19},
timestamp = {Mon, 28 Aug 2023 21:17:25 +0200},
biburl = {https://dblp.org/rec/conf/tsd/Echizen-yaAH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-12416,
author = {Dheeraj Rajagopal and
Siamak Shakeri and
C{\'{\i}}cero Nogueira dos Santos and
Eduard H. Hovy and
Chung{-}Ching Chang},
title = {Counterfactual Data Augmentation improves Factuality of Abstractive
Summarization},
journal = {CoRR},
volume = {abs/2205.12416},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.12416},
doi = {10.48550/ARXIV.2205.12416},
eprinttype = {arXiv},
eprint = {2205.12416},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-12416.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-06275,
author = {Sedrick Scott Keh and
Steven Y. Feng and
Varun Gangal and
Malihe Alikhani and
Eduard H. Hovy},
title = {{PANCETTA:} Phoneme Aware Neural Completion to Elicit Tongue Twisters
Automatically},
journal = {CoRR},
volume = {abs/2209.06275},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.06275},
doi = {10.48550/ARXIV.2209.06275},
eprinttype = {arXiv},
eprint = {2209.06275},
timestamp = {Tue, 27 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-06275.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-07752,
author = {Sedrick Scott Keh and
Kevin Lu and
Varun Gangal and
Steven Y. Feng and
Harsh Jhamtani and
Malihe Alikhani and
Eduard H. Hovy},
title = {{PINEAPPLE:} Personifying INanimate Entities by Acquiring Parallel
Personification data for Learning Enhanced generation},
journal = {CoRR},
volume = {abs/2209.07752},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.07752},
doi = {10.48550/ARXIV.2209.07752},
eprinttype = {arXiv},
eprint = {2209.07752},
timestamp = {Tue, 27 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-07752.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-04191,
author = {Steven Y. Feng and
Vivek Khetan and
Bogdan Sacaleanu and
Anatole Gershman and
Eduard H. Hovy},
title = {{CHARD:} Clinical Health-Aware Reasoning Across Dimensions for Text
Generation Models},
journal = {CoRR},
volume = {abs/2210.04191},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.04191},
doi = {10.48550/ARXIV.2210.04191},
eprinttype = {arXiv},
eprint = {2210.04191},
timestamp = {Wed, 12 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-04191.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-10109,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
title = {A Survey of Active Learning for Natural Language Processing},
journal = {CoRR},
volume = {abs/2210.10109},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.10109},
doi = {10.48550/ARXIV.2210.10109},
eprinttype = {arXiv},
eprint = {2210.10109},
timestamp = {Mon, 24 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-10109.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-05392,
author = {Evangelia Spiliopoulou and
Artidoro Pagnoni and
Yonatan Bisk and
Eduard H. Hovy},
title = {EvEntS ReaLM: Event Reasoning of Entity States via Language Models},
journal = {CoRR},
volume = {abs/2211.05392},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.05392},
doi = {10.48550/ARXIV.2211.05392},
eprinttype = {arXiv},
eprint = {2211.05392},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-05392.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/JoBRH21,
author = {Yohan Jo and
Seojin Bang and
Chris Reed and
Eduard H. Hovy},
title = {Classifying Argumentative Relations Using Logical Mechanisms and Argumentation
Schemes},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {9},
pages = {721--739},
year = {2021},
url = {https://doi.org/10.1162/tacl\_a\_00394},
doi = {10.1162/TACL\_A\_00394},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tacl/JoBRH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/ElazarKRRHSG21,
author = {Yanai Elazar and
Nora Kassner and
Shauli Ravfogel and
Abhilasha Ravichander and
Eduard H. Hovy and
Hinrich Sch{\"{u}}tze and
Yoav Goldberg},
title = {Measuring and Improving Consistency in Pretrained Language Models},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {9},
pages = {1012--1031},
year = {2021},
url = {https://doi.org/10.1162/tacl\_a\_00410},
doi = {10.1162/TACL\_A\_00410},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tacl/ElazarKRRHSG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/ElazarKRRHSG21a,
author = {Yanai Elazar and
Nora Kassner and
Shauli Ravfogel and
Abhilasha Ravichander and
Eduard H. Hovy and
Hinrich Sch{\"{u}}tze and
Yoav Goldberg},
title = {Erratum: Measuring and Improving Consistency in Pretrained Language
Models},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {9},
pages = {1407},
year = {2021},
url = {https://doi.org/10.1162/tacl\_x\_00455},
doi = {10.1162/TACL\_X\_00455},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tacl/ElazarKRRHSG21a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/FengGWCVMH21,
author = {Steven Y. Feng and
Varun Gangal and
Jason Wei and
Sarath Chandar and
Soroush Vosoughi and
Teruko Mitamura and
Eduard H. Hovy},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {A Survey of Data Augmentation Approaches for {NLP}},
booktitle = {Findings of the Association for Computational Linguistics: {ACL/IJCNLP}
2021, Online Event, August 1-6, 2021},
series = {Findings of {ACL}},
volume = {{ACL/IJCNLP} 2021},
pages = {968--988},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.findings-acl.84},
doi = {10.18653/V1/2021.FINDINGS-ACL.84},
timestamp = {Fri, 27 Aug 2021 08:39:19 +0200},
biburl = {https://dblp.org/rec/conf/acl/FengGWCVMH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/BhardwajMPH20,
author = {Rishabh Bhardwaj and
Navonil Majumder and
Soujanya Poria and
Eduard H. Hovy},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {More Identifiable yet Equally Performant Transformers for Text Classification},
booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational
Linguistics and the 11th International Joint Conference on Natural
Language Processing, {ACL/IJCNLP} 2021, (Volume 1: Long Papers), Virtual
Event, August 1-6, 2021},
pages = {1172--1182},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.acl-long.94},
doi = {10.18653/V1/2021.ACL-LONG.94},
timestamp = {Mon, 09 Aug 2021 16:25:37 +0200},
biburl = {https://dblp.org/rec/conf/acl/BhardwajMPH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/KangH20a,
author = {Dongyeop Kang and
Eduard H. Hovy},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {Style is {NOT} a single variable: Case Studies for Cross-Stylistic
Language Understanding},
booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational
Linguistics and the 11th International Joint Conference on Natural
Language Processing, {ACL/IJCNLP} 2021, (Volume 1: Long Papers), Virtual
Event, August 1-6, 2021},
pages = {2376--2387},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.acl-long.185},
doi = {10.18653/V1/2021.ACL-LONG.185},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/KangH20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/GangalJHB21,
author = {Varun Gangal and
Harsh Jhamtani and
Eduard H. Hovy and
Taylor Berg{-}Kirkpatrick},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {Improving Automated Evaluation of Open Domain Dialog via Diverse Reference
Augmentation},
booktitle = {Findings of the Association for Computational Linguistics: {ACL/IJCNLP}
2021, Online Event, August 1-6, 2021},
series = {Findings of {ACL}},
volume = {{ACL/IJCNLP} 2021},
pages = {4079--4090},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.findings-acl.357},
doi = {10.18653/V1/2021.FINDINGS-ACL.357},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/GangalJHB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/MadaanRTYH21,
author = {Aman Madaan and
Dheeraj Rajagopal and
Niket Tandon and
Yiming Yang and
Eduard H. Hovy},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {Could you give me a hint ? Generating inference graphs for defeasible
reasoning},
booktitle = {Findings of the Association for Computational Linguistics: {ACL/IJCNLP}
2021, Online Event, August 1-6, 2021},
series = {Findings of {ACL}},
volume = {{ACL/IJCNLP} 2021},
pages = {5138--5147},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.findings-acl.456},
doi = {10.18653/V1/2021.FINDINGS-ACL.456},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/MadaanRTYH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiCFMWH20,
author = {Ruifan Li and
Hao Chen and
Fangxiang Feng and
Zhanyu Ma and
Xiaojie Wang and
Eduard H. Hovy},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {Dual Graph Convolutional Networks for Aspect-based Sentiment Analysis},
booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational
Linguistics and the 11th International Joint Conference on Natural
Language Processing, {ACL/IJCNLP} 2021, (Volume 1: Long Papers), Virtual
Event, August 1-6, 2021},
pages = {6319--6329},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.acl-long.494},
doi = {10.18653/V1/2021.ACL-LONG.494},
timestamp = {Mon, 16 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LiCFMWH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-spnlp/ZhangSH21,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
editor = {Zornitsa Kozareva and
Sujith Ravi and
Andreas Vlachos and
Priyanka Agrawal and
Andr{\'{e}} F. T. Martins},
title = {Comparing Span Extraction Methods for Semantic Role Labeling},
booktitle = {Proceedings of the 5th Workshop on Structured Prediction for NLP,
SPNLP@ACL-IJCNLP 2021, Online, August 6, 2021},
pages = {67--77},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.spnlp-1.8},
doi = {10.18653/V1/2021.SPNLP-1.8},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-spnlp/ZhangSH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/RavichanderDRMH21,
author = {Abhilasha Ravichander and
Siddharth Dalmia and
Maria Ryskina and
Florian Metze and
Eduard H. Hovy and
Alan W. Black},
editor = {Paola Merlo and
J{\"{o}}rg Tiedemann and
Reut Tsarfaty},
title = {NoiseQA: Challenge Set Evaluation for User-Centric Question Answering},
booktitle = {Proceedings of the 16th Conference of the European Chapter of the
Association for Computational Linguistics: Main Volume, {EACL} 2021,
Online, April 19 - 23, 2021},
pages = {2976--2992},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.eacl-main.259},
doi = {10.18653/V1/2021.EACL-MAIN.259},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eacl/RavichanderDRMH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/RavichanderBH21,
author = {Abhilasha Ravichander and
Yonatan Belinkov and
Eduard H. Hovy},
editor = {Paola Merlo and
J{\"{o}}rg Tiedemann and
Reut Tsarfaty},
title = {Probing the Probing Paradigm: Does Probing Accuracy Entail Task Relevance?},
booktitle = {Proceedings of the 16th Conference of the European Chapter of the
Association for Computational Linguistics: Main Volume, {EACL} 2021,
Online, April 19 - 23, 2021},
pages = {3363--3377},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.eacl-main.295},
doi = {10.18653/V1/2021.EACL-MAIN.295},
timestamp = {Thu, 20 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eacl/RavichanderBH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/RajagopalBHT21,
author = {Dheeraj Rajagopal and
Vidhisha Balachandran and
Eduard H. Hovy and
Yulia Tsvetkov},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {{SELFEXPLAIN:} {A} Self-Explaining Architecture for Neural Text Classifiers},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {836--850},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.64},
doi = {10.18653/V1/2021.EMNLP-MAIN.64},
timestamp = {Fri, 16 Feb 2024 08:27:36 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/RajagopalBHT21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/JoYBORH21,
author = {Yohan Jo and
Haneul Yoo and
JinYeong Bak and
Alice Oh and
Chris Reed and
Eduard H. Hovy},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {Knowledge-Enhanced Evidence Retrieval for Counterargument Generation},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2021, Virtual Event / Punta Cana, Dominican Republic, 16-20 November,
2021},
pages = {3074--3094},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.findings-emnlp.264},
doi = {10.18653/V1/2021.FINDINGS-EMNLP.264},
timestamp = {Fri, 16 Feb 2024 08:27:36 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/JoYBORH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhangSH21,
author = {Zhisong Zhang and
Emma Strubell and
Eduard H. Hovy},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {On the Benefit of Syntactic Supervision for Cross-lingual Transfer
in Semantic Role Labeling},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {6229--6246},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.503},
doi = {10.18653/V1/2021.EMNLP-MAIN.503},
timestamp = {Thu, 20 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/MadaanTRCYH21,
author = {Aman Madaan and
Niket Tandon and
Dheeraj Rajagopal and
Peter Clark and
Yiming Yang and
Eduard H. Hovy},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {Think about it! Improving defeasible reasoning by first modeling the
question scenario},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {6291--6310},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.508},
doi = {10.18653/V1/2021.EMNLP-MAIN.508},
timestamp = {Thu, 20 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/MadaanTRCYH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/JhamtaniGHB21,
author = {Harsh Jhamtani and
Varun Gangal and
Eduard H. Hovy and
Taylor Berg{-}Kirkpatrick},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {Investigating Robustness of Dialog Models to Popular Figurative Language
Constructs},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican
Republic, 7-11 November, 2021},
pages = {7476--7485},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-main.592},
doi = {10.18653/V1/2021.EMNLP-MAIN.592},
timestamp = {Thu, 20 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/JhamtaniGHB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/KaushikSHL21,
author = {Divyansh Kaushik and
Amrith Setlur and
Eduard H. Hovy and
Zachary Chase Lipton},
title = {Explaining the Efficacy of Counterfactually Augmented Data},
booktitle = {9th International Conference on Learning Representations, {ICLR} 2021,
Virtual Event, Austria, May 3-7, 2021},
publisher = {OpenReview.net},
year = {2021},
url = {https://openreview.net/forum?id=HHiiQKWsOcV},
timestamp = {Wed, 23 Jun 2021 17:36:39 +0200},
biburl = {https://dblp.org/rec/conf/iclr/KaushikSHL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/MaKZH21,
author = {Xuezhe Ma and
Xiang Kong and
Shanghang Zhang and
Eduard H. Hovy},
title = {Decoupling Global and Local Representations via Invertible Generative
Flows},
booktitle = {9th International Conference on Learning Representations, {ICLR} 2021,
Virtual Event, Austria, May 3-7, 2021},
publisher = {OpenReview.net},
year = {2021},
url = {https://openreview.net/forum?id=iWLByfvUhN},
timestamp = {Wed, 23 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/MaKZH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/FengHNHG21,
author = {Steven Y. Feng and
Jessica Huynh and
Chaitanya Prasad Narisetty and
Eduard H. Hovy and
Varun Gangal},
editor = {Anya Belz and
Angela Fan and
Ehud Reiter and
Yaji Sripada},
title = {{SAPPHIRE:} Approaches for Enhanced Concept-to-Text Generation},
booktitle = {Proceedings of the 14th International Conference on Natural Language
Generation, {INLG} 2021, Aberdeen, Scotland, UK, 20-24 September,
2021},
pages = {212--225},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.inlg-1.21},
doi = {10.18653/V1/2021.INLG-1.21},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/FengHNHG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/LyuLPHPSM21,
author = {Yiwei Lyu and
Paul Pu Liang and
Hai Pham and
Eduard H. Hovy and
Barnab{\'{a}}s P{\'{o}}czos and
Ruslan Salakhutdinov and
Louis{-}Philippe Morency},
editor = {Kristina Toutanova and
Anna Rumshisky and
Luke Zettlemoyer and
Dilek Hakkani{-}T{\"{u}}r and
Iz Beltagy and
Steven Bethard and
Ryan Cotterell and
Tanmoy Chakraborty and
Yichao Zhou},
title = {StylePTB: {A} Compositional Benchmark for Fine-grained Controllable
Text Style Transfer},
booktitle = {Proceedings of the 2021 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2021, Online, June 6-11, 2021},
pages = {2116--2138},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.naacl-main.171},
doi = {10.18653/V1/2021.NAACL-MAIN.171},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/LyuLPHPSM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-01017,
author = {Yanai Elazar and
Nora Kassner and
Shauli Ravfogel and
Abhilasha Ravichander and
Eduard H. Hovy and
Hinrich Sch{\"{u}}tze and
Yoav Goldberg},
title = {Measuring and Improving Consistency in Pretrained Language Models},
journal = {CoRR},
volume = {abs/2102.01017},
year = {2021},
url = {https://arxiv.org/abs/2102.01017},
eprinttype = {arXiv},
eprint = {2102.01017},
timestamp = {Tue, 09 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-01017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2102-08345,
author = {Abhilasha Ravichander and
Siddharth Dalmia and
Maria Ryskina and
Florian Metze and
Eduard H. Hovy and
Alan W. Black},
title = {NoiseQA: Challenge Set Evaluation for User-Centric Question Answering},
journal = {CoRR},
volume = {abs/2102.08345},
year = {2021},
url = {https://arxiv.org/abs/2102.08345},
eprinttype = {arXiv},
eprint = {2102.08345},
timestamp = {Fri, 19 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2102-08345.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-12279,
author = {Dheeraj Rajagopal and
Vidhisha Balachandran and
Eduard H. Hovy and
Yulia Tsvetkov},
title = {SelfExplain: {A} Self-Explaining Architecture for Neural Text Classifiers},
journal = {CoRR},
volume = {abs/2103.12279},
year = {2021},
url = {https://arxiv.org/abs/2103.12279},
eprinttype = {arXiv},
eprint = {2103.12279},
timestamp = {Tue, 06 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2103-12279.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-00814,
author = {Dheeraj Rajagopal and
Aman Madaan and
Niket Tandon and
Yiming Yang and
Shrimai Prabhumoye and
Abhilasha Ravichander and
Peter Clark and
Eduard H. Hovy},
title = {{CURIE:} An Iterative Querying Approach for Reasoning About Situations},
journal = {CoRR},
volume = {abs/2104.00814},
year = {2021},
url = {https://arxiv.org/abs/2104.00814},
eprinttype = {arXiv},
eprint = {2104.00814},
timestamp = {Mon, 12 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-00814.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-05196,
author = {Yiwei Lyu and
Paul Pu Liang and
Hai Pham and
Eduard H. Hovy and
Barnab{\'{a}}s P{\'{o}}czos and
Ruslan Salakhutdinov and
Louis{-}Philippe Morency},
title = {StylePTB: {A} Compositional Benchmark for Fine-grained Controllable
Text Style Transfer},
journal = {CoRR},
volume = {abs/2104.05196},
year = {2021},
url = {https://arxiv.org/abs/2104.05196},
eprinttype = {arXiv},
eprint = {2104.05196},
timestamp = {Mon, 19 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-05196.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-06669,
author = {Varun Gangal and
Steven Y. Feng and
Eduard H. Hovy and
Teruko Mitamura},
title = {{NAREOR:} The Narrative Reordering Problem},
journal = {CoRR},
volume = {abs/2104.06669},
year = {2021},
url = {https://arxiv.org/abs/2104.06669},
eprinttype = {arXiv},
eprint = {2104.06669},
timestamp = {Mon, 19 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-06669.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-08765,
author = {Aman Madaan and
Niket Tandon and
Dheeraj Rajagopal and
Yiming Yang and
Peter Clark and
Keisuke Sakaguchi and
Eduard H. Hovy},
title = {Improving Neural Model Performance through Natural Language Feedback
on Their Explanations},
journal = {CoRR},
volume = {abs/2104.08765},
year = {2021},
url = {https://arxiv.org/abs/2104.08765},
eprinttype = {arXiv},
eprint = {2104.08765},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-08765.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-03075,
author = {Steven Y. Feng and
Varun Gangal and
Jason Wei and
Sarath Chandar and
Soroush Vosoughi and
Teruko Mitamura and
Eduard H. Hovy},
title = {A Survey of Data Augmentation Approaches for {NLP}},
journal = {CoRR},
volume = {abs/2105.03075},
year = {2021},
url = {https://arxiv.org/abs/2105.03075},
eprinttype = {arXiv},
eprint = {2105.03075},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-03075.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-05418,
author = {Aman Madaan and
Dheeraj Rajagopal and
Niket Tandon and
Yiming Yang and
Eduard H. Hovy},
title = {Could you give me a hint? Generating inference graphs for defeasible
reasoning},
journal = {CoRR},
volume = {abs/2105.05418},
year = {2021},
url = {https://arxiv.org/abs/2105.05418},
eprinttype = {arXiv},
eprint = {2105.05418},
timestamp = {Tue, 18 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-05418.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-07571,
author = {Yohan Jo and
Seojin Bang and
Chris Reed and
Eduard H. Hovy},
title = {Classifying Argumentative Relations Using Logical Mechanisms and Argumentation
Schemes},
journal = {CoRR},
volume = {abs/2105.07571},
year = {2021},
url = {https://arxiv.org/abs/2105.07571},
eprinttype = {arXiv},
eprint = {2105.07571},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-07571.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-01269,
author = {Rishabh Bhardwaj and
Navonil Majumder and
Soujanya Poria and
Eduard H. Hovy},
title = {More Identifiable yet Equally Performant Transformers for Text Classification},
journal = {CoRR},
volume = {abs/2106.01269},
year = {2021},
url = {https://arxiv.org/abs/2106.01269},
eprinttype = {arXiv},
eprint = {2106.01269},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-01269.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-02833,
author = {Varun Gangal and
Harsh Jhamtani and
Eduard H. Hovy and
Taylor Berg{-}Kirkpatrick},
title = {Improving Automated Evaluation of Open Domain Dialog via Diverse Reference
Augmentation},
journal = {CoRR},
volume = {abs/2106.02833},
year = {2021},
url = {https://arxiv.org/abs/2106.02833},
eprinttype = {arXiv},
eprint = {2106.02833},
timestamp = {Thu, 10 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-02833.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-12698,
author = {Maria Ryskina and
Eduard H. Hovy and
Taylor Berg{-}Kirkpatrick and
Matthew R. Gormley},
title = {Comparative Error Analysis in Neural and Finite-state Models for Unsupervised
Character-level Transduction},
journal = {CoRR},
volume = {abs/2106.12698},
year = {2021},
url = {https://arxiv.org/abs/2106.12698},
eprinttype = {arXiv},
eprint = {2106.12698},
timestamp = {Wed, 30 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-12698.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-06643,
author = {Steven Y. Feng and
Jessica Huynh and
Chaitanya Narisetty and
Eduard H. Hovy and
Varun Gangal},
title = {{SAPPHIRE:} Approaches for Enhanced Concept-to-Text Generation},
journal = {CoRR},
volume = {abs/2108.06643},
year = {2021},
url = {https://arxiv.org/abs/2108.06643},
eprinttype = {arXiv},
eprint = {2108.06643},
timestamp = {Wed, 18 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-06643.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-03892,
author = {Steven Y. Feng and
Kevin Lu and
Zhuofu Tao and
Malihe Alikhani and
Teruko Mitamura and
Eduard H. Hovy and
Varun Gangal},
title = {Retrieve, Caption, Generate: Visual Grounding for Enhancing Commonsense
in Text Generation Models},
journal = {CoRR},
volume = {abs/2109.03892},
year = {2021},
url = {https://arxiv.org/abs/2109.03892},
eprinttype = {arXiv},
eprint = {2109.03892},
timestamp = {Mon, 20 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-03892.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-09057,
author = {Yohan Jo and
Haneul Yoo and
JinYeong Bak and
Alice Oh and
Chris Reed and
Eduard H. Hovy},
title = {Knowledge-Enhanced Evidence Retrieval for Counterargument Generation},
journal = {CoRR},
volume = {abs/2109.09057},
year = {2021},
url = {https://arxiv.org/abs/2109.09057},
eprinttype = {arXiv},
eprint = {2109.09057},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-09057.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-00687,
author = {Harsh Jhamtani and
Varun Gangal and
Eduard H. Hovy and
Taylor Berg{-}Kirkpatrick},
title = {Investigating Robustness of Dialog Models to Popular Figurative Language
Constructs},
journal = {CoRR},
volume = {abs/2110.00687},
year = {2021},
url = {https://arxiv.org/abs/2110.00687},
eprinttype = {arXiv},
eprint = {2110.00687},
timestamp = {Fri, 08 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-00687.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-10470,
author = {Xiaofei Sun and
Diyi Yang and
Xiaoya Li and
Tianwei Zhang and
Yuxian Meng and
Han Qiu and
Guoyin Wang and
Eduard H. Hovy and
Jiwei Li},
title = {Interpreting Deep Learning Models in Natural Language Processing:
{A} Review},
journal = {CoRR},
volume = {abs/2110.10470},
year = {2021},
url = {https://arxiv.org/abs/2110.10470},
eprinttype = {arXiv},
eprint = {2110.10470},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-10470.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-12349,
author = {Aman Madaan and
Niket Tandon and
Dheeraj Rajagopal and
Peter Clark and
Yiming Yang and
Eduard H. Hovy},
title = {Think about it! Improving defeasible reasoning by first modeling the
question scenario},
journal = {CoRR},
volume = {abs/2110.12349},
year = {2021},
url = {https://arxiv.org/abs/2110.12349},
eprinttype = {arXiv},
eprint = {2110.12349},
timestamp = {Thu, 28 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-12349.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-00539,
author = {Dheeraj Rajagopal and
Vivek Khetan and
Bogdan Sacaleanu and
Anatole Gershman and
Andrew E. Fano and
Eduard H. Hovy},
title = {Cross-Domain Reasoning via Template Filling},
journal = {CoRR},
volume = {abs/2111.00539},
year = {2021},
url = {https://arxiv.org/abs/2111.00539},
eprinttype = {arXiv},
eprint = {2111.00539},
timestamp = {Fri, 05 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2111-00539.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-02721,
author = {Kaustubh D. Dhole and
Varun Gangal and
Sebastian Gehrmann and
Aadesh Gupta and
Zhenhao Li and
Saad Mahamood and
Abinaya Mahendiran and
Simon Mille and
Ashish Srivastava and
Samson Tan and
Tongshuang Wu and
Jascha Sohl{-}Dickstein and
Jinho D. Choi and
Eduard H. Hovy and
Ondrej Dusek and
Sebastian Ruder and
Sajant Anand and
Nagender Aneja and
Rabin Banjade and
Lisa Barthe and
Hanna Behnke and
Ian Berlot{-}Attwell and
Connor Boyle and
Caroline Brun and
Marco Antonio Sobrevilla Cabezudo and
Samuel Cahyawijaya and
Emile Chapuis and
Wanxiang Che and
Mukund Choudhary and
Christian Clauss and
Pierre Colombo and
Filip Cornell and
Gautier Dagan and
Mayukh Das and
Tanay Dixit and
Thomas Dopierre and
Paul{-}Alexis Dray and
Suchitra Dubey and
Tatiana Ekeinhor and
Marco Di Giovanni and
Rishabh Gupta and
Rishabh Gupta and
Louanes Hamla and
Sang Han and
Fabrice Harel{-}Canada and
Antoine Honore and
Ishan Jindal and
Przemyslaw K. Joniak and
Denis Kleyko and
Venelin Kovatchev and
et al.},
title = {NL-Augmenter: {A} Framework for Task-Sensitive Natural Language Augmentation},
journal = {CoRR},
volume = {abs/2112.02721},
year = {2021},
url = {https://arxiv.org/abs/2112.02721},
eprinttype = {arXiv},
eprint = {2112.02721},
timestamp = {Wed, 08 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-02721.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/ShibuyaH20,
author = {Takashi Shibuya and
Eduard H. Hovy},
title = {Nested Named Entity Recognition via Second-best Sequence Learning
and Decoding},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {8},
pages = {605--620},
year = {2020},
url = {https://doi.org/10.1162/tacl\_a\_00334},
doi = {10.1162/TACL\_A\_00334},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tacl/ShibuyaH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ws/IlievskiHVSX20,
author = {Filip Ilievski and
Eduard H. Hovy and
Piek Vossen and
Stefan Schlobach and
Qizhe Xie},
title = {The role of knowledge in determining identity of long-tail entities},
journal = {J. Web Semant.},
volume = {61-62},
pages = {100565},
year = {2020},
url = {https://doi.org/10.1016/j.websem.2020.100565},
doi = {10.1016/J.WEBSEM.2020.100565},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ws/IlievskiHVSX20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZongRH20,
author = {Shi Zong and
Alan Ritter and
Eduard H. Hovy},
editor = {Dan Jurafsky and
Joyce Chai and
Natalie Schluter and
Joel R. Tetreault},
title = {Measuring Forecasting Skill from Text},
booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2020, Online, July 5-10, 2020},
pages = {5317--5331},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.acl-main.473},
doi = {10.18653/V1/2020.ACL-MAIN.473},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZongRH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/KongGH20,
author = {Xiang Kong and
Varun Gangal and
Eduard H. Hovy},
editor = {Dan Jurafsky and
Joyce Chai and
Natalie Schluter and
Joel R. Tetreault},
title = {{SCDE:} Sentence Cloze Dataset with High Quality Distractors From
Examinations},
booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2020, Online, July 5-10, 2020},
pages = {5668--5683},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.acl-main.502},
doi = {10.18653/V1/2020.ACL-MAIN.502},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/KongGH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhangKLMH20,
author = {Zhisong Zhang and
Xiang Kong and
Zhengzhong Liu and
Xuezhe Ma and
Eduard H. Hovy},
editor = {Dan Jurafsky and
Joyce Chai and
Natalie Schluter and
Joel R. Tetreault},
title = {A Two-Step Approach for Implicit Event Argument Detection},
booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2020, Online, July 5-10, 2020},
pages = {7479--7485},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.acl-main.667},
doi = {10.18653/V1/2020.ACL-MAIN.667},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhangKLMH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blackboxnlp/GangalH20,
author = {Varun Gangal and
Eduard H. Hovy},
editor = {Afra Alishahi and
Yonatan Belinkov and
Grzegorz Chrupala and
Dieuwke Hupkes and
Yuval Pinter and
Hassan Sajjad},
title = {BERTering {RAMS:} What and How Much does {BERT} Already Know About
Event Arguments? - {A} Study on the {RAMS} Dataset},
booktitle = {Proceedings of the Third BlackboxNLP Workshop on Analyzing and Interpreting
Neural Networks for NLP, BlackboxNLP@EMNLP 2020, Online, November
2020},
pages = {1--10},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.blackboxnlp-1.1},
doi = {10.18653/V1/2020.BLACKBOXNLP-1.1},
timestamp = {Fri, 15 Sep 2023 14:10:05 +0200},
biburl = {https://dblp.org/rec/conf/blackboxnlp/GangalH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/blackboxnlp/RungeH20,
author = {Andrew Runge and
Eduard H. Hovy},
editor = {Afra Alishahi and
Yonatan Belinkov and
Grzegorz Chrupala and
Dieuwke Hupkes and
Yuval Pinter and
Hassan Sajjad},
title = {Exploring Neural Entity Representations for Semantic Information},
booktitle = {Proceedings of the Third BlackboxNLP Workshop on Analyzing and Interpreting
Neural Networks for NLP, BlackboxNLP@EMNLP 2020, Online, November
2020},
pages = {204--216},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.blackboxnlp-1.20},
doi = {10.18653/V1/2020.BLACKBOXNLP-1.20},
timestamp = {Mon, 09 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/blackboxnlp/RungeH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/SpiliopoulouPH20,
author = {Evangelia Spiliopoulou and
Artidoro Pagnoni and
Eduard H. Hovy},
editor = {Donia Scott and
N{\'{u}}ria Bel and
Chengqing Zong},
title = {Definition Frames: Using Definitions for Hybrid Concept Representations},
booktitle = {Proceedings of the 28th International Conference on Computational
Linguistics, {COLING} 2020, Barcelona, Spain (Online), December 8-13,
2020},
pages = {3060--3068},
publisher = {International Committee on Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.coling-main.273},
doi = {10.18653/V1/2020.COLING-MAIN.273},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/SpiliopoulouPH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/XieLHL20,
author = {Qizhe Xie and
Minh{-}Thang Luong and
Eduard H. Hovy and
Quoc V. Le},
title = {Self-Training With Noisy Student Improves ImageNet Classification},
booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
{CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
pages = {10684--10695},
publisher = {Computer Vision Foundation / {IEEE}},
year = {2020},
url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Xie\_Self-Training\_With\_Noisy\_Student\_Improves\_ImageNet\_Classification\_CVPR\_2020\_paper.html},
doi = {10.1109/CVPR42600.2020.01070},
timestamp = {Tue, 31 Aug 2021 14:00:04 +0200},
biburl = {https://dblp.org/rec/conf/cvpr/XieLHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ChandrasekaranF20,
author = {Muthu Kumar Chandrasekaran and
Guy Feigenblat and
Dayne Freitag and
Tirthankar Ghosal and
Eduard H. Hovy and
Philipp Mayr and
Michal Shmueli{-}Scheuer and
Anita de Waard},
editor = {Muthu Kumar Chandrasekaran and
Anita de Waard and
Guy Feigenblat and
Dayne Freitag and
Tirthankar Ghosal and
Eduard H. Hovy and
Petr Knoth and
David Konopnicki and
Philipp Mayr and
Robert M. Patton and
Michal Shmueli{-}Scheuer},
title = {Overview of the First Workshop on Scholarly Document Processing {(SDP)}},
booktitle = {Proceedings of the First Workshop on Scholarly Document Processing,
SDP@EMNLP 2020, Online, November 19, 2020},
pages = {1--6},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.sdp-1.1},
doi = {10.18653/V1/2020.SDP-1.1},
timestamp = {Fri, 06 Aug 2021 00:40:22 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ChandrasekaranF20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/JoBMHR20,
author = {Yohan Jo and
Seojin Bang and
Emaad A. Manzoor and
Eduard H. Hovy and
Chris Reed},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {Detecting Attackable Sentences in Arguments},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {1--23},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.1},
doi = {10.18653/V1/2020.EMNLP-MAIN.1},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/JoBMHR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/JoVRH20,
author = {Yohan Jo and
Jacky Visser and
Chris Reed and
Eduard H. Hovy},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {Extracting Implicitly Asserted Propositions in Argumentation},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {24--38},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.2},
doi = {10.18653/V1/2020.EMNLP-MAIN.2},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/JoVRH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ChandrasekaranF20a,
author = {Muthu Kumar Chandrasekaran and
Guy Feigenblat and
Eduard H. Hovy and
Abhilasha Ravichander and
Michal Shmueli{-}Scheuer and
Anita de Waard},
editor = {Muthu Kumar Chandrasekaran and
Anita de Waard and
Guy Feigenblat and
Dayne Freitag and
Tirthankar Ghosal and
Eduard H. Hovy and
Petr Knoth and
David Konopnicki and
Philipp Mayr and
Robert M. Patton and
Michal Shmueli{-}Scheuer},
title = {Overview and Insights from the Shared Tasks at Scholarly Document
Processing 2020: CL-SciSumm, LaySumm and LongSumm},
booktitle = {Proceedings of the First Workshop on Scholarly Document Processing,
SDP@EMNLP 2020, Online, November 19, 2020},
pages = {214--224},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.sdp-1.24},
doi = {10.18653/V1/2020.SDP-1.24},
timestamp = {Fri, 18 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/ChandrasekaranF20a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KongZH20,
author = {Xiang Kong and
Zhisong Zhang and
Eduard H. Hovy},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {Incorporating a Local Translation Mechanism into Non-autoregressive
Translation},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {1067--1073},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.79},
doi = {10.18653/V1/2020.EMNLP-MAIN.79},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/KongZH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhangKLH20,
author = {Zhisong Zhang and
Xiang Kong and
Lori S. Levin and
Eduard H. Hovy},
editor = {Trevor Cohn and
Yulan He and
Yang Liu},
title = {An Empirical Exploration of Local Ordering Pre-training for Structured
Learning},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2020, Online Event, 16-20 November 2020},
series = {Findings of {ACL}},
volume = {{EMNLP} 2020},
pages = {1770--1783},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.findings-emnlp.160},
doi = {10.18653/V1/2020.FINDINGS-EMNLP.160},
timestamp = {Wed, 23 Mar 2022 10:11:55 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/ZhangKLH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/RajagopalTCDH20,
author = {Dheeraj Rajagopal and
Niket Tandon and
Peter Clark and
Bhavana Dalvi and
Eduard H. Hovy},
editor = {Trevor Cohn and
Yulan He and
Yang Liu},
title = {What-if {I} ask you to explain: Explaining the effects of perturbations
in procedural text},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2020, Online Event, 16-20 November 2020},
series = {Findings of {ACL}},
volume = {{EMNLP} 2020},
pages = {3345--3355},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.findings-emnlp.300},
doi = {10.18653/V1/2020.FINDINGS-EMNLP.300},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/RajagopalTCDH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/MazaSHH20,
author = {Salvador Medina Maza and
Evangelia Spiliopoulou and
Eduard H. Hovy and
Alexander G. Hauptmann},
editor = {Trevor Cohn and
Yulan He and
Yang Liu},
title = {Event-Related Bias Removal for Real-time Disaster Events},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2020, Online Event, 16-20 November 2020},
series = {Findings of {ACL}},
volume = {{EMNLP} 2020},
pages = {3858--3868},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.findings-emnlp.344},
doi = {10.18653/V1/2020.FINDINGS-EMNLP.344},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/MazaSHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/TandonSDRCGRH20,
author = {Niket Tandon and
Keisuke Sakaguchi and
Bhavana Dalvi and
Dheeraj Rajagopal and
Peter Clark and
Michal Guerquin and
Kyle Richardson and
Eduard H. Hovy},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {A Dataset for Tracking Entities in Open Domain Procedural Text},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {6408--6417},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.520},
doi = {10.18653/V1/2020.EMNLP-MAIN.520},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/TandonSDRCGRH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KangH20,
author = {Dongyeop Kang and
Eduard H. Hovy},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {Plan ahead: Self-Supervised Text Planning for Paragraph Completion
Task},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {6533--6543},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.529},
doi = {10.18653/V1/2020.EMNLP-MAIN.529},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/KangH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/KaushikHL20,
author = {Divyansh Kaushik and
Eduard H. Hovy and
Zachary Chase Lipton},
title = {Learning The Difference That Makes {A} Difference With Counterfactually-Augmented
Data},
booktitle = {8th International Conference on Learning Representations, {ICLR} 2020,
Addis Ababa, Ethiopia, April 26-30, 2020},
publisher = {OpenReview.net},
year = {2020},
url = {https://openreview.net/forum?id=Sklgs0NFvr},
timestamp = {Thu, 07 May 2020 17:11:47 +0200},
biburl = {https://dblp.org/rec/conf/iclr/KaushikHL20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/JoMRH20,
author = {Yohan Jo and
Elijah Mayfield and
Chris Reed and
Eduard H. Hovy},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Machine-Aided Annotation for Fine-Grained Proposition Types in Argumentation},
booktitle = {Proceedings of The 12th Language Resources and Evaluation Conference,
{LREC} 2020, Marseille, France, May 11-16, 2020},
pages = {1008--1018},
publisher = {European Language Resources Association},
year = {2020},
url = {https://aclanthology.org/2020.lrec-1.127/},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/JoMRH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/0001CHH20,
author = {Po{-}Yao Huang and
Xiaojun Chang and
Alexander G. Hauptmann and
Eduard H. Hovy},
editor = {Cathal Gurrin and
Bj{\"{o}}rn {\TH}{\'{o}}r J{\'{o}}nsson and
Noriko Kando and
Klaus Sch{\"{o}}ffmann and
Yi{-}Ping Phoebe Chen and
Noel E. O'Connor},
title = {Forward and Backward Multimodal {NMT} for Improved Monolingual and
Multilingual Cross-Modal Retrieval},
booktitle = {Proceedings of the 2020 on International Conference on Multimedia
Retrieval, {ICMR} 2020, Dublin, Ireland, June 8-11, 2020},
pages = {53--62},
publisher = {{ACM}},
year = {2020},
url = {https://doi.org/10.1145/3372278.3390674},
doi = {10.1145/3372278.3390674},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mir/0001CHH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/XieDHL020,
author = {Qizhe Xie and
Zihang Dai and
Eduard H. Hovy and
Thang Luong and
Quoc Le},
editor = {Hugo Larochelle and
Marc'Aurelio Ranzato and
Raia Hadsell and
Maria{-}Florina Balcan and
Hsuan{-}Tien Lin},
title = {Unsupervised Data Augmentation for Consistency Training},
booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference
on Neural Information Processing Systems 2020, NeurIPS 2020, December
6-12, 2020, virtual},
year = {2020},
url = {https://proceedings.neurips.cc/paper/2020/hash/44feb0096faa8326192570788b38c1d1-Abstract.html},
timestamp = {Tue, 19 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/XieDHL020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/starsem/RavichanderHSTC20,
author = {Abhilasha Ravichander and
Eduard H. Hovy and
Kaheer Suleman and
Adam Trischler and
Jackie Chi Kit Cheung},
editor = {Iryna Gurevych and
Marianna Apidianaki and
Manaal Faruqui},
title = {On the Systematicity of Probing Contextualized Word Representations:
The Case of Hypernymy in {BERT}},
booktitle = {Proceedings of the Ninth Joint Conference on Lexical and Computational
Semantics, *SEM@COLING 2020, Barcelona, Spain (Online), December 12-13,
2020},
pages = {88--102},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://aclanthology.org/2020.starsem-1.10/},
timestamp = {Wed, 25 Aug 2021 17:11:16 +0200},
biburl = {https://dblp.org/rec/conf/starsem/RavichanderHSTC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/emnlp/2020sdp,
editor = {Muthu Kumar Chandrasekaran and
Anita de Waard and
Guy Feigenblat and
Dayne Freitag and
Tirthankar Ghosal and
Eduard H. Hovy and
Petr Knoth and
David Konopnicki and
Philipp Mayr and
Robert M. Patton and
Michal Shmueli{-}Scheuer},
title = {Proceedings of the First Workshop on Scholarly Document Processing,
SDP@EMNLP 2020, Online, November 19, 2020},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://aclanthology.org/volumes/2020.sdp-1/},
isbn = {978-1-952148-70-5},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/2020sdp.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eval4nlp/2020,
editor = {Steffen Eger and
Yang Gao and
Maxime Peyrard and
Wei Zhao and
Eduard H. Hovy},
title = {Proceedings of the First Workshop on Evaluation and Comparison of
{NLP} Systems, Eval4NLP 2020, Online, November 20, 2020},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://www.aclweb.org/anthology/volumes/2020.eval4nlp-1/},
isbn = {978-1-952148-82-8},
timestamp = {Tue, 16 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eval4nlp/2020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-11820,
author = {Xuezhe Ma and
Xiang Kong and
Shanghang Zhang and
Eduard H. Hovy},
title = {Decoupling Global and Local Representations from/for Image Generation},
journal = {CoRR},
volume = {abs/2004.11820},
year = {2020},
url = {https://arxiv.org/abs/2004.11820},
eprinttype = {arXiv},
eprint = {2004.11820},
timestamp = {Tue, 28 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-11820.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-12934,
author = {Xiang Kong and
Varun Gangal and
Eduard H. Hovy},
title = {{SCDE:} Sentence Cloze Dataset with High Quality Distractors From
Examinations},
journal = {CoRR},
volume = {abs/2004.12934},
year = {2020},
url = {https://arxiv.org/abs/2004.12934},
eprinttype = {arXiv},
eprint = {2004.12934},
timestamp = {Wed, 29 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-12934.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-00719,
author = {Abhilasha Ravichander and
Yonatan Belinkov and
Eduard H. Hovy},
title = {Probing the Probing Paradigm: Does Probing Accuracy Entail Task Relevance?},
journal = {CoRR},
volume = {abs/2005.00719},
year = {2020},
url = {https://arxiv.org/abs/2005.00719},
eprinttype = {arXiv},
eprint = {2005.00719},
timestamp = {Fri, 08 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-00719.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-01526,
author = {Dheeraj Rajagopal and
Niket Tandon and
Peter Clark and
Bhavana Dalvi and
Eduard H. Hovy},
title = {What-if {I} ask you to explain: Explaining the effects of perturbations
in procedural text},
journal = {CoRR},
volume = {abs/2005.01526},
year = {2020},
url = {https://arxiv.org/abs/2005.01526},
eprinttype = {arXiv},
eprint = {2005.01526},
timestamp = {Wed, 03 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-01526.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-07425,
author = {Shi Zong and
Alan Ritter and
Eduard H. Hovy},
title = {Measuring Forecasting Skill from Text},
journal = {CoRR},
volume = {abs/2006.07425},
year = {2020},
url = {https://arxiv.org/abs/2006.07425},
eprinttype = {arXiv},
eprint = {2006.07425},
timestamp = {Wed, 17 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-07425.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-01794,
author = {Steven Y. Feng and
Varun Gangal and
Dongyeop Kang and
Teruko Mitamura and
Eduard H. Hovy},
title = {GenAug: Data Augmentation for Finetuning Text Generators},
journal = {CoRR},
volume = {abs/2010.01794},
year = {2020},
url = {https://arxiv.org/abs/2010.01794},
eprinttype = {arXiv},
eprint = {2010.01794},
timestamp = {Mon, 12 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-01794.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02114,
author = {Divyansh Kaushik and
Amrith Setlur and
Eduard H. Hovy and
Zachary C. Lipton},
title = {Explaining The Efficacy of Counterfactually-Augmented Data},
journal = {CoRR},
volume = {abs/2010.02114},
year = {2020},
url = {https://arxiv.org/abs/2010.02114},
eprinttype = {arXiv},
eprint = {2010.02114},
timestamp = {Mon, 12 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02114.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02654,
author = {Yohan Jo and
Jacky Visser and
Chris Reed and
Eduard H. Hovy},
title = {Extracting Implicitly Asserted Propositions in Argumentation},
journal = {CoRR},
volume = {abs/2010.02654},
year = {2020},
url = {https://arxiv.org/abs/2010.02654},
eprinttype = {arXiv},
eprint = {2010.02654},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02654.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02660,
author = {Yohan Jo and
Seojin Bang and
Emaad A. Manzoor and
Eduard H. Hovy and
Chris Reed},
title = {Detecting Attackable Sentences in Arguments},
journal = {CoRR},
volume = {abs/2010.02660},
year = {2020},
url = {https://arxiv.org/abs/2010.02660},
eprinttype = {arXiv},
eprint = {2010.02660},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02660.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-04098,
author = {Varun Gangal and
Eduard H. Hovy},
title = {BERTering {RAMS:} What and How Much does {BERT} Already Know About
Event Arguments? - {A} Study on the {RAMS} Dataset},
journal = {CoRR},
volume = {abs/2010.04098},
year = {2020},
url = {https://arxiv.org/abs/2010.04098},
eprinttype = {arXiv},
eprint = {2010.04098},
timestamp = {Tue, 13 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-04098.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-05141,
author = {Dongyeop Kang and
Eduard H. Hovy},
title = {Plan ahead: Self-Supervised Text Planning for Paragraph Completion
Task},
journal = {CoRR},
volume = {abs/2010.05141},
year = {2020},
url = {https://arxiv.org/abs/2010.05141},
eprinttype = {arXiv},
eprint = {2010.05141},
timestamp = {Tue, 20 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-05141.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-06943,
author = {Yuxian Meng and
Chun Fan and
Zijun Sun and
Eduard H. Hovy and
Fei Wu and
Jiwei Li},
title = {Pair the Dots: Jointly Examining Training History and Test Stimuli
for Model Interpretability},
journal = {CoRR},
volume = {abs/2010.06943},
year = {2020},
url = {https://arxiv.org/abs/2010.06943},
eprinttype = {arXiv},
eprint = {2010.06943},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-06943.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-11764,
author = {Aman Madaan and
Dheeraj Rajagopal and
Yiming Yang and
Abhilasha Ravichander and
Eduard H. Hovy and
Shrimai Prabhumoye},
title = {{EIGEN:} Event Influence GENeration using Pre-trained Language Models},
journal = {CoRR},
volume = {abs/2010.11764},
year = {2020},
url = {https://arxiv.org/abs/2010.11764},
eprinttype = {arXiv},
eprint = {2010.11764},
timestamp = {Tue, 27 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-11764.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-00681,
author = {Evangelia Spiliopoulou and
Salvador Medina Maza and
Eduard H. Hovy and
Alexander G. Hauptmann},
title = {Event-Related Bias Removal for Real-time Disaster Events},
journal = {CoRR},
volume = {abs/2011.00681},
year = {2020},
url = {https://arxiv.org/abs/2011.00681},
eprinttype = {arXiv},
eprint = {2011.00681},
timestamp = {Fri, 06 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-00681.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-06132,
author = {Xiang Kong and
Zhisong Zhang and
Eduard H. Hovy},
title = {Incorporating a Local Translation Mechanism into Non-autoregressive
Translation},
journal = {CoRR},
volume = {abs/2011.06132},
year = {2020},
url = {https://arxiv.org/abs/2011.06132},
eprinttype = {arXiv},
eprint = {2011.06132},
timestamp = {Wed, 18 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-06132.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-08092,
author = {Niket Tandon and
Keisuke Sakaguchi and
Bhavana Dalvi Mishra and
Dheeraj Rajagopal and
Peter Clark and
Michal Guerquin and
Kyle Richardson and
Eduard H. Hovy},
title = {A Dataset for Tracking Entities in Open Domain Procedural Text},
journal = {CoRR},
volume = {abs/2011.08092},
year = {2020},
url = {https://arxiv.org/abs/2011.08092},
eprinttype = {arXiv},
eprint = {2011.08092},
timestamp = {Fri, 12 Mar 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-08092.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-08951,
author = {Andrew Runge and
Eduard H. Hovy},
title = {Exploring Neural Entity Representations for Semantic Information},
journal = {CoRR},
volume = {abs/2011.08951},
year = {2020},
url = {https://arxiv.org/abs/2011.08951},
eprinttype = {arXiv},
eprint = {2011.08951},
timestamp = {Wed, 25 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-08951.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/PoriaMMH19,
author = {Soujanya Poria and
Navonil Majumder and
Rada Mihalcea and
Eduard H. Hovy},
title = {Emotion Recognition in Conversation: Research Challenges, Datasets,
and Recent Advances},
journal = {{IEEE} Access},
volume = {7},
pages = {100943--100953},
year = {2019},
url = {https://doi.org/10.1109/ACCESS.2019.2929050},
doi = {10.1109/ACCESS.2019.2929050},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/access/PoriaMMH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/SachanDHMRX19,
author = {Mrinmaya Sachan and
Avinava Dubey and
Eduard H. Hovy and
Tom M. Mitchell and
Dan Roth and
Eric P. Xing},
title = {Discourse in Multimedia: {A} Case Study in Extracting Geometry Knowledge
from Textbooks},
journal = {Comput. Linguistics},
volume = {45},
number = {4},
pages = {627--665},
year = {2019},
url = {https://doi.org/10.1162/coli\_a\_00360},
doi = {10.1162/COLI\_A\_00360},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/coling/SachanDHMRX19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lre/SutcliffeHCWCR19,
author = {Richard F. E. Sutcliffe and
Eduard H. Hovy and
Tom Collins and
Stephen Wan and
Tim Crawford and
Deane L. Root},
title = {Searching for musical features using natural language queries: the
C@merata evaluations at MediaEval},
journal = {Lang. Resour. Evaluation},
volume = {53},
number = {1},
pages = {87--140},
year = {2019},
url = {https://doi.org/10.1007/s10579-018-9422-2},
doi = {10.1007/S10579-018-9422-2},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lre/SutcliffeHCWCR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/KongTSHZ19,
author = {Xiang Kong and
Zhaopeng Tu and
Shuming Shi and
Eduard H. Hovy and
Tong Zhang},
title = {Neural Machine Translation with Adequacy-Oriented Learning},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {6618--6625},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33016618},
doi = {10.1609/AAAI.V33I01.33016618},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/KongTSHZ19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/KongXDH19,
author = {Xiang Kong and
Qizhe Xie and
Zihang Dai and
Eduard H. Hovy},
title = {Fast and Simple Mixture of Softmaxes with {BPE} and Hybrid-LightRNN
for Language Generation},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {6626--6633},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33016626},
doi = {10.1609/AAAI.V33I01.33016626},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaai/KongXDH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/NaikRRH19,
author = {Aakanksha Naik and
Abhilasha Ravichander and
Carolyn P. Ros{\'{e}} and
Eduard H. Hovy},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {Exploring Numeracy in Word Embeddings},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {3374--3380},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1329},
doi = {10.18653/V1/P19-1329},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/NaikRRH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/GarimellaBHM19,
author = {Aparna Garimella and
Carmen Banea and
Eduard H. Hovy and
Rada Mihalcea},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {Women's Syntactic Resilience and Men's Grammatical Luck: Gender-Bias
in Part-of-Speech Tagging and Dependency Parsing},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {3493--3498},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1339},
doi = {10.18653/V1/P19-1339},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/GarimellaBHM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/OtaniH19,
author = {Naoki Otani and
Eduard H. Hovy},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {Toward Comprehensive Understanding of a Sentiment Based on Human Motives},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {4672--4677},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1461},
doi = {10.18653/V1/P19-1461},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/OtaniH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhangMH19,
author = {Zhisong Zhang and
Xuezhe Ma and
Eduard H. Hovy},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {An Empirical Investigation of Structured Output Modeling for Graph-based
Neural Dependency Parsing},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {5592--5598},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1562},
doi = {10.18653/V1/P19-1562},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhangMH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/argmining/JoVRH19,
author = {Yohan Jo and
Jacky Visser and
Chris Reed and
Eduard H. Hovy},
editor = {Benno Stein and
Henning Wachsmuth},
title = {A Cascade Model for Proposition Extraction in Argumentation},
booktitle = {Proceedings of the 6th Workshop on Argument Mining, ArgMining@ACL
2019, Florence, Italy, August 1, 2019},
pages = {11--24},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/w19-4502},
doi = {10.18653/V1/W19-4502},
timestamp = {Wed, 09 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/argmining/JoVRH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/RajagopalVSRTH19,
author = {Dheeraj Rajagopal and
Nidhi Vyas and
Aditya Siddhant and
Anirudha Rayasam and
Niket Tandon and
Eduard H. Hovy},
editor = {Dina Demner{-}Fushman and
Kevin Bretonnel Cohen and
Sophia Ananiadou and
Junichi Tsujii},
title = {Domain Adaptation of {SRL} Systems for Biological Processes},
booktitle = {Proceedings of the 18th BioNLP Workshop and Shared Task, BioNLP@ACL
2019, Florence, Italy, August 1, 2019},
pages = {80--87},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/w19-5009},
doi = {10.18653/V1/W19-5009},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bionlp/RajagopalVSRTH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conll/RavichanderNRH19,
author = {Abhilasha Ravichander and
Aakanksha Naik and
Carolyn P. Ros{\'{e}} and
Eduard H. Hovy},
editor = {Mohit Bansal and
Aline Villavicencio},
title = {{EQUATE:} {A} Benchmark Evaluation Framework for Quantitative Reasoning
in Natural Language Inference},
booktitle = {Proceedings of the 23rd Conference on Computational Natural Language
Learning, CoNLL 2019, Hong Kong, China, November 3-4, 2019},
pages = {349--361},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/K19-1033},
doi = {10.18653/V1/K19-1033},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/conll/RavichanderNRH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KangGH19,
author = {Dongyeop Kang and
Varun Gangal and
Eduard H. Hovy},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {(Male, Bachelor) and (Female, Ph.D) have different connotations: Parallelly
Annotated Stylistic Language Dataset with Multiple Personas},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {1696--1706},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1179},
doi = {10.18653/V1/D19-1179},
timestamp = {Thu, 07 Apr 2022 09:14:07 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/KangGH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/JungKMH19,
author = {Taehee Jung and
Dongyeop Kang and
Lucas Mentch and
Eduard H. Hovy},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {Earlier Isn't Always Better: Sub-aspect Analysis on Corpus and System
Biases in Summarization},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {3322--3333},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1327},
doi = {10.18653/V1/D19-1327},
timestamp = {Thu, 12 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/JungKMH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/MaZLNH19,
author = {Xuezhe Ma and
Chunting Zhou and
Xian Li and
Graham Neubig and
Eduard H. Hovy},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {FlowSeq: Non-Autoregressive Conditional Sequence Generation with Generative
Flow},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {4281--4291},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1437},
doi = {10.18653/V1/D19-1437},
timestamp = {Thu, 12 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/MaZLNH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KangH19,
author = {Dongyeop Kang and
Eduard H. Hovy},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {Linguistic Versus Latent Relations for Modeling Coherent Flow in Paragraphs},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {5808--5814},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1589},
doi = {10.18653/V1/D19-1589},
timestamp = {Thu, 12 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/KangH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/VyasRMHB19,
author = {Nidhi Vyas and
Sai Krishna Rallabandi and
Lalitesh Morishetti and
Eduard H. Hovy and
Alan W. Black},
title = {Learning Disentangled Representation in Latent Stochastic Models:
{A} Case Study with Image Captioning},
booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing,
{ICASSP} 2019, Brighton, United Kingdom, May 12-17, 2019},
pages = {4010--4014},
publisher = {{IEEE}},
year = {2019},
url = {https://doi.org/10.1109/ICASSP.2019.8683370},
doi = {10.1109/ICASSP.2019.8683370},
timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
biburl = {https://dblp.org/rec/conf/icassp/VyasRMHB19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/MaZH19,
author = {Xuezhe Ma and
Chunting Zhou and
Eduard H. Hovy},
title = {{MAE:} Mutual Posterior-Divergence Regularization for Variational
AutoEncoders},
booktitle = {7th International Conference on Learning Representations, {ICLR} 2019,
New Orleans, LA, USA, May 6-9, 2019},
publisher = {OpenReview.net},
year = {2019},
url = {https://openreview.net/forum?id=Hke4l2AcKQ},
timestamp = {Thu, 25 Jul 2019 13:03:15 +0200},
biburl = {https://dblp.org/rec/conf/iclr/MaZH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Echizen-yaAH19,
author = {Hiroshi Echizen{-}ya and
Kenji Araki and
Eduard H. Hovy},
editor = {Jill Burstein and
Christy Doran and
Thamar Solorio},
title = {Word Embedding-Based Automatic {MT} Evaluation Metric using Word Position
Information},
booktitle = {Proceedings of the 2019 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long
and Short Papers)},
pages = {1874--1883},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/n19-1186},
doi = {10.18653/V1/N19-1186},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Echizen-yaAH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/AhmadZMHCP19,
author = {Wasi Uddin Ahmad and
Zhisong Zhang and
Xuezhe Ma and
Eduard H. Hovy and
Kai{-}Wei Chang and
Nanyun Peng},
editor = {Jill Burstein and
Christy Doran and
Thamar Solorio},
title = {On Difficulties of Cross-Lingual Transfer with Order Differences:
{A} Case Study on Dependency Parsing},
booktitle = {Proceedings of the 2019 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long
and Short Papers)},
pages = {2440--2452},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/n19-1253},
doi = {10.18653/V1/N19-1253},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/AhmadZMHCP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Dasigi0MZH19,
author = {Pradeep Dasigi and
Matt Gardner and
Shikhar Murty and
Luke Zettlemoyer and
Eduard H. Hovy},
editor = {Jill Burstein and
Christy Doran and
Thamar Solorio},
title = {Iterative Search for Weakly Supervised Semantic Parsing},
booktitle = {Proceedings of the 2019 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long
and Short Papers)},
pages = {2669--2680},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/n19-1273},
doi = {10.18653/V1/N19-1273},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Dasigi0MZH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/YangCYJH19,
author = {Diyi Yang and
Jiaao Chen and
Zichao Yang and
Dan Jurafsky and
Eduard H. Hovy},
editor = {Jill Burstein and
Christy Doran and
Thamar Solorio},
title = {Let's Make Your Request More Persuasive: Modeling Persuasive Strategies
via Semi-Supervised Neural Nets on Crowdfunding Platforms},
booktitle = {Proceedings of the 2019 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long
and Short Papers)},
pages = {3620--3630},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/n19-1364},
doi = {10.18653/V1/N19-1364},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/YangCYJH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/MaKZH19,
author = {Xuezhe Ma and
Xiang Kong and
Shanghang Zhang and
Eduard H. Hovy},
editor = {Hanna M. Wallach and
Hugo Larochelle and
Alina Beygelzimer and
Florence d'Alch{\'{e}}{-}Buc and
Emily B. Fox and
Roman Garnett},
title = {MaCow: Masked Convolutional Generative Flow},
booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference
on Neural Information Processing Systems 2019, NeurIPS 2019, December
8-14, 2019, Vancouver, BC, Canada},
pages = {5891--5900},
year = {2019},
url = {https://proceedings.neurips.cc/paper/2019/hash/20c86a628232a67e7bd46f76fba7ce12-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/MaKZH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/textgraphs/VaibhavAH19,
author = {Vaibhav Vaibhav and
Raghuram Mandyam Annasamy and
Eduard H. Hovy},
editor = {Dmitry Ustalov and
Swapna Somasundaran and
Peter Jansen and
Goran Glavas and
Martin Riedl and
Mihai Surdeanu and
Michalis Vazirgiannis},
title = {Do Sentence Interactions Matter? Leveraging Sentence Level Representations
for Fake News Classification},
booktitle = {Proceedings of the Thirteenth Workshop on Graph-Based Methods for
Natural Language Processing, TextGraphs@EMNLP 2019, Hong Kong, November
4, 2019},
pages = {134--139},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-5316},
doi = {10.18653/V1/D19-5316},
timestamp = {Thu, 05 May 2022 07:34:24 +0200},
biburl = {https://dblp.org/rec/conf/textgraphs/VaibhavAH19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/PenasRMFHSG19,
author = {Anselmo Pe{\~{n}}as and
{\'{A}}lvaro Rodrigo and
Bernardo Magnini and
Pamela Forner and
Eduard H. Hovy and
Richard F. E. Sutcliffe and
Danilo Giampiccolo},
editor = {Nicola Ferro and
Carol Peters},
title = {Results and Lessons of the Question Answering Track at {CLEF}},
booktitle = {Information Retrieval Evaluation in a Changing World - Lessons Learned
from 20 Years of {CLEF}},
series = {The Information Retrieval Series},
volume = {41},
pages = {441--460},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-22948-1\_18},
doi = {10.1007/978-3-030-22948-1\_18},
timestamp = {Thu, 15 Aug 2019 08:40:53 +0200},
biburl = {https://dblp.org/rec/books/sp/19/PenasRMFHSG19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/HovyCCGHMMSDCCK19,
author = {Eduard H. Hovy and
Jaime G. Carbonell and
Hans Chalupsky and
Anatole Gershman and
Alex Hauptmann and
Florian Metze and
Teruko Mitamura and
Zaid Sheikh and
Ankit Dangi and
Aditi Chaudhary and
Xianyang Chen and
Xiang Kong and
Bernie Huang and
Salvador Medina and
Hector Liu and
Xuezhe Ma and
Maria Ryskina and
Ramon Sanabria and
Varun Gangal},
title = {{OPERA:} Operations-oriented Probabilistic Extraction, Reasoning,
and Analysis},
booktitle = {Proceedings of the 2019 Text Analysis Conference, {TAC} 2019, Gaithersburg,
Maryland, USA, November 12-13, 2019},
publisher = {{NIST}},
year = {2019},
url = {https://tac.nist.gov/publications/2019/participant.papers/TAC2019.OPERA.proceedings.pdf},
timestamp = {Mon, 19 Apr 2021 12:42:35 +0200},
biburl = {https://dblp.org/rec/conf/tac/HovyCCGHMMSDCCK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1901-01498,
author = {Xuezhe Ma and
Chunting Zhou and
Eduard H. Hovy},
title = {{MAE:} Mutual Posterior-Divergence Regularization for Variational
AutoEncoders},
journal = {CoRR},
volume = {abs/1901.01498},
year = {2019},
url = {http://arxiv.org/abs/1901.01498},
eprinttype = {arXiv},
eprint = {1901.01498},
timestamp = {Thu, 31 Jan 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1901-01498.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1901-03735,
author = {Abhilasha Ravichander and
Aakanksha Naik and
Carolyn P. Ros{\'{e}} and
Eduard H. Hovy},
title = {{EQUATE:} {A} Benchmark Evaluation Framework for Quantitative Reasoning
in Natural Language Inference},
journal = {CoRR},
volume = {abs/1901.03735},
year = {2019},
url = {http://arxiv.org/abs/1901.03735},
eprinttype = {arXiv},
eprint = {1901.03735},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1901-03735.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1901-07129,
author = {Xiang Kong and
Bohan Li and
Graham Neubig and
Eduard H. Hovy and
Yiming Yang},
title = {An Adversarial Approach to High-Quality, Sentiment-Controlled Neural
Dialogue Generation},
journal = {CoRR},
volume = {abs/1901.07129},
year = {2019},
url = {http://arxiv.org/abs/1901.07129},
eprinttype = {arXiv},
eprint = {1901.07129},
timestamp = {Fri, 01 Feb 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1901-07129.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-04208,
author = {Xuezhe Ma and
Eduard H. Hovy},
title = {MaCow: Masked Convolutional Generative Flow},
journal = {CoRR},
volume = {abs/1902.04208},
year = {2019},
url = {http://arxiv.org/abs/1902.04208},
eprinttype = {arXiv},
eprint = {1902.04208},
timestamp = {Tue, 21 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-04208.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1902-08899,
author = {Aditi Chaudhary and
Siddharth Dalmia and
Junjie Hu and
Xinjian Li and
Austin Matthews and
Aldrian Obaja Muis and
Naoki Otani and
Shruti Rijhwani and
Zaid Sheikh and
Nidhi Vyas and
Xinyi Wang and
Jiateng Xie and
Ruochen Xu and
Chunting Zhou and
Peter J. Jansen and
Yiming Yang and
Lori S. Levin and
Florian Metze and
Teruko Mitamura and
David R. Mortensen and
Graham Neubig and
Eduard H. Hovy and
Alan W. Black and
Jaime G. Carbonell and
Graham Horwood and
Shabnam Tafreshi and
Mona T. Diab and
Efsun Sarioglu Kayi and
Noura Farra and
Kathleen R. McKeown},
title = {The {ARIEL-CMU} Systems for LoReHLT18},
journal = {CoRR},
volume = {abs/1902.08899},
year = {2019},
url = {http://arxiv.org/abs/1902.08899},
eprinttype = {arXiv},
eprint = {1902.08899},
timestamp = {Fri, 03 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1902-08899.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-12848,
author = {Qizhe Xie and
Zihang Dai and
Eduard H. Hovy and
Minh{-}Thang Luong and
Quoc V. Le},
title = {Unsupervised Data Augmentation},
journal = {CoRR},
volume = {abs/1904.12848},
year = {2019},
url = {http://arxiv.org/abs/1904.12848},
eprinttype = {arXiv},
eprint = {1904.12848},
timestamp = {Thu, 02 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1904-12848.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-02947,
author = {Soujanya Poria and
Navonil Majumder and
Rada Mihalcea and
Eduard H. Hovy},
title = {Emotion Recognition in Conversation: Research Challenges, Datasets,
and Recent Advances},
journal = {CoRR},
volume = {abs/1905.02947},
year = {2019},
url = {http://arxiv.org/abs/1905.02947},
eprinttype = {arXiv},
eprint = {1905.02947},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1905-02947.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-11723,
author = {Taehee Jung and
Dongyeop Kang and
Lucas Mentch and
Eduard H. Hovy},
title = {Earlier Isn't Always Better: Sub-aspect Analysis on Corpus and System
Biases in Summarization},
journal = {CoRR},
volume = {abs/1908.11723},
year = {2019},
url = {http://arxiv.org/abs/1908.11723},
eprinttype = {arXiv},
eprint = {1908.11723},
timestamp = {Wed, 04 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1908-11723.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-11790,
author = {Dongyeop Kang and
Hiroaki Hayashi and
Alan W. Black and
Eduard H. Hovy},
title = {Linguistic Versus Latent Relations for Modeling Coherent Flow in Paragraphs},
journal = {CoRR},
volume = {abs/1908.11790},
year = {2019},
url = {http://arxiv.org/abs/1908.11790},
eprinttype = {arXiv},
eprint = {1908.11790},
timestamp = {Wed, 04 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1908-11790.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-00098,
author = {Dongyeop Kang and
Varun Gangal and
Eduard H. Hovy},
title = {(Male, Bachelor) and (Female, Ph.D) have different connotations: Parallelly
Annotated Stylistic Language Dataset with Multiple Personas},
journal = {CoRR},
volume = {abs/1909.00098},
year = {2019},
url = {http://arxiv.org/abs/1909.00098},
eprinttype = {arXiv},
eprint = {1909.00098},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-00098.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-02250,
author = {Takashi Shibuya and
Eduard H. Hovy},
title = {Nested Named Entity Recognition via Second-best Sequence Learning
and Decoding},
journal = {CoRR},
volume = {abs/1909.02250},
year = {2019},
url = {http://arxiv.org/abs/1909.02250},
eprinttype = {arXiv},
eprint = {1909.02250},
timestamp = {Mon, 24 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-02250.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-02480,
author = {Xuezhe Ma and
Chunting Zhou and
Xian Li and
Graham Neubig and
Eduard H. Hovy},
title = {FlowSeq: Non-Autoregressive Conditional Sequence Generation with Generative
Flow},
journal = {CoRR},
volume = {abs/1909.02480},
year = {2019},
url = {http://arxiv.org/abs/1909.02480},
eprinttype = {arXiv},
eprint = {1909.02480},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-02480.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-04793,
author = {Evangelia Spiliopoulou and
Eduard H. Hovy},
title = {Definition Frames: Using Definitions for Hybrid Concept Representations},
journal = {CoRR},
volume = {abs/1909.04793},
year = {2019},
url = {http://arxiv.org/abs/1909.04793},
eprinttype = {arXiv},
eprint = {1909.04793},
timestamp = {Tue, 17 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-04793.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-12434,
author = {Divyansh Kaushik and
Eduard H. Hovy and
Zachary C. Lipton},
title = {Learning the Difference that Makes a Difference with Counterfactually-Augmented
Data},
journal = {CoRR},
volume = {abs/1909.12434},
year = {2019},
url = {http://arxiv.org/abs/1909.12434},
eprinttype = {arXiv},
eprint = {1909.12434},
timestamp = {Mon, 06 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-12434.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-12203,
author = {Vaibhav Vaibhav and
Raghuram Mandyam Annasamy and
Eduard H. Hovy},
title = {Do Sentence Interactions Matter? Leveraging Sentence Level Representations
for Fake News Classification},
journal = {CoRR},
volume = {abs/1910.12203},
year = {2019},
url = {http://arxiv.org/abs/1910.12203},
eprinttype = {arXiv},
eprint = {1910.12203},
timestamp = {Mon, 06 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-12203.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-03663,
author = {Dongyeop Kang and
Eduard H. Hovy},
title = {xSLUE: {A} Benchmark and Analysis Platform for Cross-Style Language
Understanding and Evaluation},
journal = {CoRR},
volume = {abs/1911.03663},
year = {2019},
url = {http://arxiv.org/abs/1911.03663},
eprinttype = {arXiv},
eprint = {1911.03663},
timestamp = {Sun, 01 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-03663.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-04053,
author = {Xiang Kong and
Xianyang Chen and
Eduard H. Hovy},
title = {Decompressing Knowledge Graph Representations for Link Prediction},
journal = {CoRR},
volume = {abs/1911.04053},
year = {2019},
url = {http://arxiv.org/abs/1911.04053},
eprinttype = {arXiv},
eprint = {1911.04053},
timestamp = {Sun, 01 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-04053.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1911-04252,
author = {Qizhe Xie and
Eduard H. Hovy and
Minh{-}Thang Luong and
Quoc V. Le},
title = {Self-training with Noisy Student improves ImageNet classification},
journal = {CoRR},
volume = {abs/1911.04252},
year = {2019},
url = {http://arxiv.org/abs/1911.04252},
eprinttype = {arXiv},
eprint = {1911.04252},
timestamp = {Sun, 01 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1911-04252.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mt/LittellTXSMLTHH18,
author = {Patrick Littell and
Tian Tian and
Ruochen Xu and
Zaid Sheikh and
David R. Mortensen and
Lori S. Levin and
Francis M. Tyers and
Hiroaki Hayashi and
Graham Horwood and
Steve Sloto and
Emily Tagtow and
Alan W. Black and
Yiming Yang and
Teruko Mitamura and
Eduard H. Hovy},
title = {The {ARIEL-CMU} situation frame detection pipeline for LoReHLT16:
a model translation approach},
journal = {Mach. Transl.},
volume = {32},
number = {1-2},
pages = {105--126},
year = {2018},
url = {https://doi.org/10.1007/s10590-017-9205-3},
doi = {10.1007/S10590-017-9205-3},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mt/LittellTXSMLTHH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/SubramanianPJBH18,
author = {Anant Subramanian and
Danish Pruthi and
Harsh Jhamtani and
Taylor Berg{-}Kirkpatrick and
Eduard H. Hovy},
editor = {Sheila A. McIlraith and
Kilian Q. Weinberger},
title = {{SPINE:} SParse Interpretable Neural Embeddings},
booktitle = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence,
(AAAI-18), the 30th innovative Applications of Artificial Intelligence
(IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in
Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February
2-7, 2018},
pages = {4921--4928},
publisher = {{AAAI} Press},
year = {2018},
url = {https://doi.org/10.1609/aaai.v32i1.11935},
doi = {10.1609/AAAI.V32I1.11935},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/SubramanianPJBH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HovyMNPHL18,
author = {Xuezhe Ma and
Zecong Hu and
Jingzhou Liu and
Nanyun Peng and
Graham Neubig and
Eduard H. Hovy},
editor = {Iryna Gurevych and
Yusuke Miyao},
title = {Stack-Pointer Networks for Dependency Parsing},
booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume
1: Long Papers},
pages = {1403--1414},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/P18-1130/},
doi = {10.18653/V1/P18-1130},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HovyMNPHL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HovyNBGJ18,
author = {Harsh Jhamtani and
Varun Gangal and
Eduard H. Hovy and
Graham Neubig and
Taylor Berg{-}Kirkpatrick},
editor = {Iryna Gurevych and
Yusuke Miyao},
title = {Learning to Generate Move-by-Move Commentary for Chess Games from
Large-Scale Social Forum Data},
booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume
1: Long Papers},
pages = {1661--1671},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/P18-1154/},
doi = {10.18653/V1/P18-1154},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HovyNBGJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HovyXD18,
author = {Zihang Dai and
Qizhe Xie and
Eduard H. Hovy},
editor = {Iryna Gurevych and
Yusuke Miyao},
title = {From Credit Assignment to Entropy Regularization: Two New Algorithms
for Neural Sequence Prediction},
booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume
1: Long Papers},
pages = {1672--1682},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/P18-1155/},
doi = {10.18653/V1/P18-1155},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HovyXD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HovyKSK18,
author = {Dongyeop Kang and
Tushar Khot and
Ashish Sabharwal and
Eduard H. Hovy},
editor = {Iryna Gurevych and
Yusuke Miyao},
title = {AdvEntuRe: Adversarial Training for Textual Entailment with Knowledge-Guided
Examples},
booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume
1: Long Papers},
pages = {2418--2428},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/P18-1225/},
doi = {10.18653/V1/P18-1225},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HovyKSK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/MuisOVXYMH18,
author = {Aldrian Obaja Muis and
Naoki Otani and
Nidhi Vyas and
Ruochen Xu and
Yiming Yang and
Teruko Mitamura and
Eduard H. Hovy},
editor = {Emily M. Bender and
Leon Derczynski and
Pierre Isabelle},
title = {Low-resource Cross-lingual Event Type Detection via Distant Supervision
with Minimal Effort},
booktitle = {Proceedings of the 27th International Conference on Computational
Linguistics, {COLING} 2018, Santa Fe, New Mexico, USA, August 20-26,
2018},
pages = {70--82},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/C18-1007/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/MuisOVXYMH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/LiuMH18,
author = {Zhengzhong Liu and
Teruko Mitamura and
Eduard H. Hovy},
editor = {Emily M. Bender and
Leon Derczynski and
Pierre Isabelle},
title = {Graph Based Decoding for Event Sequencing and Coreference Resolution},
booktitle = {Proceedings of the 27th International Conference on Computational
Linguistics, {COLING} 2018, Santa Fe, New Mexico, USA, August 20-26,
2018},
pages = {3645--3657},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/C18-1309/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/LiuMH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiuXMH18,
author = {Zhengzhong Liu and
Chenyan Xiong and
Teruko Mitamura and
Eduard H. Hovy},
editor = {Ellen Riloff and
David Chiang and
Julia Hockenmaier and
Jun'ichi Tsujii},
title = {Automatic Event Salience Identification},
booktitle = {Proceedings of the 2018 Conference on Empirical Methods in Natural
Language Processing, Brussels, Belgium, October 31 - November 4, 2018},
pages = {1226--1236},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://doi.org/10.18653/v1/d18-1154},
doi = {10.18653/V1/D18-1154},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LiuXMH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/XieLDH18,
author = {Qizhe Xie and
Guokun Lai and
Zihang Dai and
Eduard H. Hovy},
editor = {Ellen Riloff and
David Chiang and
Julia Hockenmaier and
Jun'ichi Tsujii},
title = {Large-scale Cloze Test Dataset Created by Teachers},
booktitle = {Proceedings of the 2018 Conference on Empirical Methods in Natural
Language Processing, Brussels, Belgium, October 31 - November 4, 2018},
pages = {2344--2356},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://doi.org/10.18653/v1/d18-1257},
doi = {10.18653/V1/D18-1257},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/XieLDH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icaart/Hovy18,
author = {Eduard H. Hovy},
editor = {Ana Paula Rocha and
H. Jaap van den Herik},
title = {Reading Agents that Hunger for Knowledge},
booktitle = {Proceedings of the 10th International Conference on Agents and Artificial
Intelligence, {ICAART} 2018, Volume 1, Funchal, Madeira, Portugal,
January 16-18, 2018},
pages = {9},
publisher = {SciTePress},
year = {2018},
timestamp = {Fri, 04 Oct 2019 14:17:27 +0200},
biburl = {https://dblp.org/rec/conf/icaart/Hovy18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/KangADZKHS18,
author = {Dongyeop Kang and
Waleed Ammar and
Bhavana Dalvi and
Madeleine van Zuylen and
Sebastian Kohlmeier and
Eduard H. Hovy and
Roy Schwartz},
editor = {Marilyn A. Walker and
Heng Ji and
Amanda Stent},
title = {A Dataset of Peer Reviews (PeerRead): Collection, Insights and {NLP}
Applications},
booktitle = {Proceedings of the 2018 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2018, New Orleans, Louisiana, USA, June 1-6, 2018, Volume
1 (Long Papers)},
pages = {1647--1661},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://doi.org/10.18653/v1/n18-1149},
doi = {10.18653/V1/N18-1149},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/KangADZKHS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/coling/2018eventstory,
editor = {Tommaso Caselli and
Ben Miller and
Marieke van Erp and
Piek Vossen and
Martha Palmer and
Eduard H. Hovy and
Teruko Mitamura and
David Caswell and
Susan Windisch Brown and
Claire Bonial},
title = {Proceedings of the Workshop Events and Stories in the News, EventStory@Coling
2018, Santa Fe, New Mexico, USA, August 20, 2018},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/volumes/W18-43/},
isbn = {978-1-948087-59-9},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/2018eventstory.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/textgraphs/2018,
editor = {Goran Glavas and
Swapna Somasundaran and
Martin Riedl and
Eduard H. Hovy},
title = {Proceedings of the Twelfth Workshop on Graph-Based Methods for Natural
Language Processing, TextGraphs@NAACL-HLT 2018, New Orleans, Louisiana,
USA, June 6, 2018},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/volumes/W18-17/},
isbn = {978-1-948087-25-4},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/textgraphs/2018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/HovyBCCGHMMCCHL18,
author = {Eduard H. Hovy and
Taylor Berg{-}Kirkpatrick and
Jaime G. Carbonell and
Hans Chalupsky and
Anatole Gershman and
Alexander G. Hauptmann and
Florian Metze and
Teruko Mitamura and
Aditi Chaudhary and
Xianyang Chen and
Bernie Po{-}Yao Huang and
Hector Zhengzhong Liu and
Xuezhe Ma and
Shruti Palaskar and
Dheeraj Rajagopal and
Maria Ryskina and
Ramon Sanabria},
title = {{OPERA:} Operations-oriented Probabilistic Extraction, Reasoning,
and Analysis},
booktitle = {Proceedings of the 2018 Text Analysis Conference, {TAC} 2018, Gaithersburg,
Maryland, USA, November 13-14, 2018},
publisher = {{NIST}},
year = {2018},
url = {https://tac.nist.gov/publications/2018/participant.papers/TAC2018.OPERA.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 14:30:47 +0200},
biburl = {https://dblp.org/rec/conf/tac/HovyBCCGHMMCCHL18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-09635,
author = {Dongyeop Kang and
Waleed Ammar and
Bhavana Dalvi and
Madeleine van Zuylen and
Sebastian Kohlmeier and
Eduard H. Hovy and
Roy Schwartz},
title = {A Dataset of Peer Reviews (PeerRead): Collection, Insights and {NLP}
Applications},
journal = {CoRR},
volume = {abs/1804.09635},
year = {2018},
url = {http://arxiv.org/abs/1804.09635},
eprinttype = {arXiv},
eprint = {1804.09635},
timestamp = {Wed, 23 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1804-09635.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-10974,
author = {Zihang Dai and
Qizhe Xie and
Eduard H. Hovy},
title = {From Credit Assignment to Entropy Regularization: Two New Algorithms
for Neural Sequence Prediction},
journal = {CoRR},
volume = {abs/1804.10974},
year = {2018},
url = {http://arxiv.org/abs/1804.10974},
eprinttype = {arXiv},
eprint = {1804.10974},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1804-10974.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-01087,
author = {Xuezhe Ma and
Zecong Hu and
Jingzhou Liu and
Nanyun Peng and
Graham Neubig and
Eduard H. Hovy},
title = {Stack-Pointer Networks for Dependency Parsing},
journal = {CoRR},
volume = {abs/1805.01087},
year = {2018},
url = {http://arxiv.org/abs/1805.01087},
eprinttype = {arXiv},
eprint = {1805.01087},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-01087.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-04680,
author = {Dongyeop Kang and
Tushar Khot and
Ashish Sabharwal and
Eduard H. Hovy},
title = {AdvEntuRe: Adversarial Training for Textual Entailment with Knowledge-Guided
Examples},
journal = {CoRR},
volume = {abs/1805.04680},
year = {2018},
url = {http://arxiv.org/abs/1805.04680},
eprinttype = {arXiv},
eprint = {1805.04680},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-04680.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1806-05099,
author = {Zhengzhong Liu and
Teruko Mitamura and
Eduard H. Hovy},
title = {Graph-Based Decoding for Event Sequencing and Coreference Resolution},
journal = {CoRR},
volume = {abs/1806.05099},
year = {2018},
url = {http://arxiv.org/abs/1806.05099},
eprinttype = {arXiv},
eprint = {1806.05099},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1806-05099.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-00647,
author = {Zhengzhong Liu and
Chenyan Xiong and
Teruko Mitamura and
Eduard H. Hovy},
title = {Automatic Event Salience Identification},
journal = {CoRR},
volume = {abs/1809.00647},
year = {2018},
url = {http://arxiv.org/abs/1809.00647},
eprinttype = {arXiv},
eprint = {1809.00647},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-00647.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-09296,
author = {Xiang Kong and
Qizhe Xie and
Zihang Dai and
Eduard H. Hovy},
title = {Fast and Simple Mixture of Softmaxes with {BPE} and Hybrid-LightRNN
for Language Generation},
journal = {CoRR},
volume = {abs/1809.09296},
year = {2018},
url = {http://arxiv.org/abs/1809.09296},
eprinttype = {arXiv},
eprint = {1809.09296},
timestamp = {Fri, 05 Oct 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-09296.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-00782,
author = {Filip Ilievski and
Eduard H. Hovy and
Qizhe Xie and
Piek Vossen},
title = {The Profiling Machine: Active Generalization over Knowledge},
journal = {CoRR},
volume = {abs/1810.00782},
year = {2018},
url = {http://arxiv.org/abs/1810.00782},
eprinttype = {arXiv},
eprint = {1810.00782},
timestamp = {Tue, 30 Oct 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-00782.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-00570,
author = {Wasi Uddin Ahmad and
Zhisong Zhang and
Xuezhe Ma and
Eduard H. Hovy and
Kai{-}Wei Chang and
Nanyun Peng},
title = {Near or Far, Wide Range Zero-Shot Cross-Lingual Dependency Parsing},
journal = {CoRR},
volume = {abs/1811.00570},
year = {2018},
url = {http://arxiv.org/abs/1811.00570},
eprinttype = {arXiv},
eprint = {1811.00570},
timestamp = {Thu, 22 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-00570.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-05546,
author = {Mrinmaya Sachan and
Kumar Avinava Dubey and
Eduard H. Hovy and
Tom M. Mitchell and
Dan Roth and
Eric P. Xing},
title = {Discourse in Multimedia: {A} Case Study in Information Extraction},
journal = {CoRR},
volume = {abs/1811.05546},
year = {2018},
url = {http://arxiv.org/abs/1811.05546},
eprinttype = {arXiv},
eprint = {1811.05546},
timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-05546.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-08541,
author = {Xiang Kong and
Zhaopeng Tu and
Shuming Shi and
Eduard H. Hovy and
Tong Zhang},
title = {Neural Machine Translation with Adequacy-Oriented Learning},
journal = {CoRR},
volume = {abs/1811.08541},
year = {2018},
url = {http://arxiv.org/abs/1811.08541},
eprinttype = {arXiv},
eprint = {1811.08541},
timestamp = {Mon, 18 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-08541.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/SpiliopoulouHM17,
author = {Evangelia Spiliopoulou and
Eduard H. Hovy and
Teruko Mitamura},
editor = {Tommaso Caselli and
Ben Miller and
Marieke van Erp and
Piek Vossen and
Martha Palmer and
Eduard H. Hovy and
Teruko Mitamura and
David Caswell},
title = {Event Detection Using Frame-Semantic Parser},
booktitle = {Proceedings of the Events and Stories in the News Workshop@ACL 2017,
Vancouver, Canada, August 4, 2017},
pages = {15--20},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/w17-2703},
doi = {10.18653/V1/W17-2703},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/SpiliopoulouHM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/XieMDH17,
author = {Qizhe Xie and
Xuezhe Ma and
Zihang Dai and
Eduard H. Hovy},
editor = {Regina Barzilay and
Min{-}Yen Kan},
title = {An Interpretable Knowledge Transfer Model for Knowledge Base Completion},
booktitle = {Proceedings of the 55th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2017, Vancouver, Canada, July 30 - August 4, Volume
1: Long Papers},
pages = {950--962},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/P17-1088},
doi = {10.18653/V1/P17-1088},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/XieMDH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/DasigiADH17,
author = {Pradeep Dasigi and
Waleed Ammar and
Chris Dyer and
Eduard H. Hovy},
editor = {Regina Barzilay and
Min{-}Yen Kan},
title = {Ontology-Aware Token Embeddings for Prepositional Phrase Attachment},
booktitle = {Proceedings of the 55th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2017, Vancouver, Canada, July 30 - August 4, Volume
1: Long Papers},
pages = {2089--2098},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/P17-1191},
doi = {10.18653/V1/P17-1191},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/DasigiADH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aclnut/SalehiHHS17,
author = {Bahar Salehi and
Dirk Hovy and
Eduard H. Hovy and
Anders S{\o}gaard},
editor = {Leon Derczynski and
Wei Xu and
Alan Ritter and
Tim Baldwin},
title = {Huntsville, hospitals, and hockey teams: Names can reveal your location},
booktitle = {Proceedings of the 3rd Workshop on Noisy User-generated Text, NUT@EMNLP
2017, Copenhagen, Denmark, September 7, 2017},
pages = {116--121},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/w17-4415},
doi = {10.18653/V1/W17-4415},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclnut/SalehiHHS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/XiongLCH17,
author = {Chenyan Xiong and
Zhengzhong Liu and
Jamie Callan and
Eduard H. Hovy},
editor = {Ee{-}Peng Lim and
Marianne Winslett and
Mark Sanderson and
Ada Wai{-}Chee Fu and
Jimeng Sun and
J. Shane Culpepper and
Eric Lo and
Joyce C. Ho and
Debora Donato and
Rakesh Agrawal and
Yu Zheng and
Carlos Castillo and
Aixin Sun and
Vincent S. Tseng and
Chenliang Li},
title = {JointSem: Combining Query Entity Linking and Entity based Document
Ranking},
booktitle = {Proceedings of the 2017 {ACM} on Conference on Information and Knowledge
Management, {CIKM} 2017, Singapore, November 06 - 10, 2017},
pages = {2391--2394},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3132847.3133048},
doi = {10.1145/3132847.3133048},
timestamp = {Tue, 29 Aug 2023 16:24:43 +0200},
biburl = {https://dblp.org/rec/conf/cikm/XiongLCH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LaiXLYH17,
author = {Guokun Lai and
Qizhe Xie and
Hanxiao Liu and
Yiming Yang and
Eduard H. Hovy},
editor = {Martha Palmer and
Rebecca Hwa and
Sebastian Riedel},
title = {{RACE:} Large-scale ReAding Comprehension Dataset From Examinations},
booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September
9-11, 2017},
pages = {785--794},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/d17-1082},
doi = {10.18653/V1/D17-1082},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LaiXLYH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/YangHKH17,
author = {Diyi Yang and
Aaron Halfaker and
Robert E. Kraut and
Eduard H. Hovy},
editor = {Martha Palmer and
Rebecca Hwa and
Sebastian Riedel},
title = {Identifying Semantic Edit Intentions from Revisions in Wikipedia},
booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September
9-11, 2017},
pages = {2000--2010},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/d17-1213},
doi = {10.18653/V1/D17-1213},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/YangHKH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KangGLCH17,
author = {Dongyeop Kang and
Varun Gangal and
Ang Lu and
Zheng Chen and
Eduard H. Hovy},
editor = {Martha Palmer and
Rebecca Hwa and
Sebastian Riedel},
title = {Detecting and Explaining Causes From Text For a Time Series Event},
booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September
9-11, 2017},
pages = {2758--2767},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/d17-1292},
doi = {10.18653/V1/D17-1292},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/KangGLCH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/GangalJNHN17,
author = {Varun Gangal and
Harsh Jhamtani and
Graham Neubig and
Eduard H. Hovy and
Eric Nyberg},
editor = {Martha Palmer and
Rebecca Hwa and
Sebastian Riedel},
title = {Charmanteau: Character Embedding Models For Portmanteau Creation},
booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September
9-11, 2017},
pages = {2917--2922},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/d17-1315},
doi = {10.18653/V1/D17-1315},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/GangalJNHN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/DaiABHC17,
author = {Zihang Dai and
Amjad Almahairi and
Philip Bachman and
Eduard H. Hovy and
Aaron C. Courville},
title = {Calibrating Energy-based Generative Adversarial Networks},
booktitle = {5th International Conference on Learning Representations, {ICLR} 2017,
Toulon, France, April 24-26, 2017, Conference Track Proceedings},
publisher = {OpenReview.net},
year = {2017},
url = {https://openreview.net/forum?id=SyxeqhP9ll},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/DaiABHC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/MaGHYDH17,
author = {Xuezhe Ma and
Yingkai Gao and
Zhiting Hu and
Yaoliang Yu and
Yuntian Deng and
Eduard H. Hovy},
title = {Dropout with Expectation-linear Regularization},
booktitle = {5th International Conference on Learning Representations, {ICLR} 2017,
Toulon, France, April 24-26, 2017, Conference Track Proceedings},
publisher = {OpenReview.net},
year = {2017},
url = {https://openreview.net/forum?id=rkGabzZgl},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/MaGHYDH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/MaH17,
author = {Xuezhe Ma and
Eduard H. Hovy},
editor = {Greg Kondrak and
Taro Watanabe},
title = {Neural Probabilistic Model for Non-projective {MST} Parsing},
booktitle = {Proceedings of the Eighth International Joint Conference on Natural
Language Processing, {IJCNLP} 2017, Taipei, Taiwan, November 27 -
December 1, 2017 - Volume 1: Long Papers},
pages = {59--69},
publisher = {Asian Federation of Natural Language Processing},
year = {2017},
url = {https://aclanthology.org/I17-1007/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/MaH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/XuMTH17,
author = {Jiarui Xu and
Xuezhe Ma and
Chen{-}Tse Tsai and
Eduard H. Hovy},
editor = {Seong{-}Bae Park and
Thepchai Supnithi},
title = {{STCP:} Simplified-Traditional Chinese Conversion and Proofreading},
booktitle = {Proceedings of the {IJCNLP} 2017, Tapei, Taiwan, November 27 - December
1, 2017, System Demonstrations},
pages = {61--64},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://aclanthology.org/I17-3016/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/XuMTH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mediaeval/SutcliffeMH17,
author = {Richard F. E. Sutcliffe and
Donncha {\'{O}} Maid{\'{\i}}n and
Eduard H. Hovy},
editor = {Guillaume Gravier and
Benjamin Bischke and
Claire{-}H{\'{e}}l{\`{e}}ne Demarty and
Maia Zaharieva and
Michael Riegler and
Emmanuel Dellandr{\'{e}}a and
Dmitry Bogdanov and
Richard F. E. Sutcliffe and
Gareth J. F. Jones and
Martha A. Larson},
title = {The C@merata task at MediaEval 2017: Natural Language Queries about
Music, their {JSON} Representations, and Matching Passages in MusicXML
Scores},
booktitle = {Working Notes Proceedings of the MediaEval 2017 Workshop co-located
with the Conference and Labs of the Evaluation Forum {(CLEF} 2017),
Dublin, Ireland, September 13-15, 2017},
series = {{CEUR} Workshop Proceedings},
volume = {1984},
publisher = {CEUR-WS.org},
year = {2017},
url = {https://ceur-ws.org/Vol-1984/Mediaeval\_2017\_paper\_35.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:12 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeMH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/XieDDHN17,
author = {Qizhe Xie and
Zihang Dai and
Yulun Du and
Eduard H. Hovy and
Graham Neubig},
editor = {Isabelle Guyon and
Ulrike von Luxburg and
Samy Bengio and
Hanna M. Wallach and
Rob Fergus and
S. V. N. Vishwanathan and
Roman Garnett},
title = {Controllable Invariance through Adversarial Feature Learning},
booktitle = {Advances in Neural Information Processing Systems 30: Annual Conference
on Neural Information Processing Systems 2017, December 4-9, 2017,
Long Beach, CA, {USA}},
pages = {585--596},
year = {2017},
url = {https://proceedings.neurips.cc/paper/2017/hash/8cb22bdd0b7ba1ab13d742e22eed8da2-Abstract.html},
timestamp = {Thu, 21 Jan 2021 13:58:27 +0100},
biburl = {https://dblp.org/rec/conf/nips/XieDDHN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semweb/BurnsDH17,
author = {Gully Burns and
Pradeep Dasigi and
Eduard H. Hovy},
editor = {Daniel Garijo and
Willem Robert van Hage and
Tomi Kauppinen and
Tobias Kuhn and
Jun Zhao},
title = {Extracting Evidence Fragments for Distant Supervision of Molecular
Interactions},
booktitle = {Proceedings of the First Workshop on Enabling Open Semantic Science
co-located with 16th International Semantic Web Conference {(ISWC}
2017), Vienna, Austria, October 21st, 2017},
series = {{CEUR} Workshop Proceedings},
volume = {1931},
pages = {7--14},
publisher = {CEUR-WS.org},
year = {2017},
url = {https://ceur-ws.org/Vol-1931/paper-02.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:05 +0100},
biburl = {https://dblp.org/rec/conf/semweb/BurnsDH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdial/JangMHR17,
author = {Hyeju Jang and
Keith Maki and
Eduard H. Hovy and
Carolyn P. Ros{\'{e}}},
editor = {Kristiina Jokinen and
Manfred Stede and
David DeVault and
Annie Louis},
title = {Finding Structure in Figurative Language: Metaphor Detection with
Topic-based Frames},
booktitle = {Proceedings of the 18th Annual SIGdial Meeting on Discourse and Dialogue,
Saarbr{\"{u}}cken, Germany, August 15-17, 2017},
pages = {320--330},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/w17-5538},
doi = {10.18653/V1/W17-5538},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigdial/JangMHR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/starsem/JauharH17,
author = {Sujay Kumar Jauhar and
Eduard H. Hovy},
editor = {Nancy Ide and
Aur{\'{e}}lie Herbelot and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {Embedded Semantic Lexicon Induction with Joint Global and Local Optimization},
booktitle = {Proceedings of the 6th Joint Conference on Lexical and Computational
Semantics, *SEM @ACM 2017, Vancouver, Canada, August 3-4, 2017},
pages = {209--219},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/S17-1025},
doi = {10.18653/V1/S17-1025},
timestamp = {Fri, 06 Aug 2021 00:40:02 +0200},
biburl = {https://dblp.org/rec/conf/starsem/JauharH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acl/2017news,
editor = {Tommaso Caselli and
Ben Miller and
Marieke van Erp and
Piek Vossen and
Martha Palmer and
Eduard H. Hovy and
Teruko Mitamura and
David Caswell},
title = {Proceedings of the Events and Stories in the News Workshop@ACL 2017,
Vancouver, Canada, August 4, 2017},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://aclanthology.org/volumes/W17-27/},
isbn = {978-1-945626-63-0},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/2017news.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/textgraphs/2017,
editor = {Martin Riedl and
Swapna Somasundaran and
Goran Glavas and
Eduard H. Hovy},
title = {Proceedings of TextGraphs@ACL 2017: the 11th Workshop on Graph-based
Methods for Natural Language Processing, Vancouver, Canada, August
3, 2017},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://aclanthology.org/volumes/W17-24/},
isbn = {978-1-945626-60-9},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/textgraphs/2017.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/ChalupskyAHHLMS17,
author = {Hans Chalupsky and
Jun Araki and
Eduard H. Hovy and
Andrew Hsi and
Zhengzhong Liu and
Xuezhe Ma and
Evangelia Spiliopoulou and
Shuxin Yao},
title = {Multi-lingual Extraction and Integration of Entities, Relations, Events
and Sentiments into ColdStart++ KBs with the {SAFT} System},
booktitle = {Proceedings of the 2017 Text Analysis Conference, {TAC} 2017, Gaithersburg,
Maryland, USA, November 13-14, 2017},
publisher = {{NIST}},
year = {2017},
url = {https://tac.nist.gov/publications/2017/participant.papers/TAC2017.SAFT\_ISI.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 13:25:18 +0200},
biburl = {https://dblp.org/rec/conf/tac/ChalupskyAHHLMS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/MaFLH17,
author = {Xuezhe Ma and
Nicolas R. Fauceglia and
Yiu{-}Chang Lin and
Eduard H. Hovy},
title = {{CMU} System for Entity Discovery and Linking at {TAC-KBP} 2017},
booktitle = {Proceedings of the 2017 Text Analysis Conference, {TAC} 2017, Gaithersburg,
Maryland, USA, November 13-14, 2017},
publisher = {{NIST}},
year = {2017},
url = {https://tac.nist.gov/publications/2017/participant.papers/TAC2017.CMUCS\_EDL.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tac/MaFLH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/MitamuraLH17,
author = {Teruko Mitamura and
Zhengzhong Liu and
Eduard H. Hovy},
title = {Events Detection, Coreference and Sequencing: What's next? Overview
of the {TAC} {KBP} 2017 Event Track},
booktitle = {Proceedings of the 2017 Text Analysis Conference, {TAC} 2017, Gaithersburg,
Maryland, USA, November 13-14, 2017},
publisher = {{NIST}},
year = {2017},
url = {https://tac.nist.gov/publications/2017/additional.papers/TAC2017.KBP\_Event\_Nugget\_overview.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tac/MitamuraLH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MaH17,
author = {Xuezhe Ma and
Eduard H. Hovy},
title = {Neural Probabilistic Model for Non-projective {MST} Parsing},
journal = {CoRR},
volume = {abs/1701.00874},
year = {2017},
url = {http://arxiv.org/abs/1701.00874},
eprinttype = {arXiv},
eprint = {1701.00874},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MaH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DaiABHC17,
author = {Zihang Dai and
Amjad Almahairi and
Philip Bachman and
Eduard H. Hovy and
Aaron C. Courville},
title = {Calibrating Energy-based Generative Adversarial Networks},
journal = {CoRR},
volume = {abs/1702.01691},
year = {2017},
url = {http://arxiv.org/abs/1702.01691},
eprinttype = {arXiv},
eprint = {1702.01691},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DaiABHC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DasigiBHW17,
author = {Pradeep Dasigi and
Gully A. P. C. Burns and
Eduard H. Hovy and
Anita de Waard},
title = {Experiment Segmentation in Scientific Discourse as Clause-level Structured
Prediction using Recurrent Neural Networks},
journal = {CoRR},
volume = {abs/1702.05398},
year = {2017},
url = {http://arxiv.org/abs/1702.05398},
eprinttype = {arXiv},
eprint = {1702.05398},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DasigiBHW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LaiXLYH17,
author = {Guokun Lai and
Qizhe Xie and
Hanxiao Liu and
Yiming Yang and
Eduard H. Hovy},
title = {{RACE:} Large-scale ReAding Comprehension Dataset From Examinations},
journal = {CoRR},
volume = {abs/1704.04683},
year = {2017},
url = {http://arxiv.org/abs/1704.04683},
eprinttype = {arXiv},
eprint = {1704.04683},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/LaiXLYH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/XieMDH17,
author = {Qizhe Xie and
Xuezhe Ma and
Zihang Dai and
Eduard H. Hovy},
title = {An Interpretable Knowledge Transfer Model for Knowledge Base Completion},
journal = {CoRR},
volume = {abs/1704.05908},
year = {2017},
url = {http://arxiv.org/abs/1704.05908},
eprinttype = {arXiv},
eprint = {1704.05908},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/XieMDH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/DasigiADH17,
author = {Pradeep Dasigi and
Waleed Ammar and
Chris Dyer and
Eduard H. Hovy},
title = {Ontology-Aware Token Embeddings for Prepositional Phrase Attachment},
journal = {CoRR},
volume = {abs/1705.02925},
year = {2017},
url = {http://arxiv.org/abs/1705.02925},
eprinttype = {arXiv},
eprint = {1705.02925},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/DasigiADH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MaYLNH17,
author = {Xuezhe Ma and
Pengcheng Yin and
Jingzhou Liu and
Graham Neubig and
Eduard H. Hovy},
title = {Softmax Q-Distribution Estimation for Structured Prediction: {A} Theoretical
Interpretation for {RAML}},
journal = {CoRR},
volume = {abs/1705.07136},
year = {2017},
url = {http://arxiv.org/abs/1705.07136},
eprinttype = {arXiv},
eprint = {1705.07136},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MaYLNH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/XieDDHN17,
author = {Qizhe Xie and
Zihang Dai and
Yulun Du and
Eduard H. Hovy and
Graham Neubig},
title = {Controllable Invariance through Adversarial Feature Learning},
journal = {CoRR},
volume = {abs/1705.11122},
year = {2017},
url = {http://arxiv.org/abs/1705.11122},
eprinttype = {arXiv},
eprint = {1705.11122},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/XieDDHN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JhamtaniGHN17,
author = {Harsh Jhamtani and
Varun Gangal and
Eduard H. Hovy and
Eric Nyberg},
title = {Shakespearizing Modern Language Using Copy-Enriched Sequence-to-Sequence
Models},
journal = {CoRR},
volume = {abs/1707.01161},
year = {2017},
url = {http://arxiv.org/abs/1707.01161},
eprinttype = {arXiv},
eprint = {1707.01161},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/JhamtaniGHN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GangalJNHN17,
author = {Varun Gangal and
Harsh Jhamtani and
Graham Neubig and
Eduard H. Hovy and
Eric Nyberg},
title = {CharManteau: Character Embedding Models For Portmanteau Creation},
journal = {CoRR},
volume = {abs/1707.01176},
year = {2017},
url = {http://arxiv.org/abs/1707.01176},
eprinttype = {arXiv},
eprint = {1707.01176},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/GangalJNHN17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/KangGLCH17,
author = {Dongyeop Kang and
Varun Gangal and
Ang Lu and
Zheng Chen and
Eduard H. Hovy},
title = {Detecting and Explaining Causes From Text For a Time Series Event},
journal = {CoRR},
volume = {abs/1707.08852},
year = {2017},
url = {http://arxiv.org/abs/1707.08852},
eprinttype = {arXiv},
eprint = {1707.08852},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/KangGLCH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1711-03225,
author = {Qizhe Xie and
Guokun Lai and
Zihang Dai and
Eduard H. Hovy},
title = {Large-scale Cloze Test Dataset Designed by Teachers},
journal = {CoRR},
volume = {abs/1711.03225},
year = {2017},
url = {http://arxiv.org/abs/1711.03225},
eprinttype = {arXiv},
eprint = {1711.03225},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1711-03225.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1711-08792,
author = {Anant Subramanian and
Danish Pruthi and
Harsh Jhamtani and
Taylor Berg{-}Kirkpatrick and
Eduard H. Hovy},
title = {{SPINE:} SParse Interpretable Neural Embeddings},
journal = {CoRR},
volume = {abs/1711.08792},
year = {2017},
url = {http://arxiv.org/abs/1711.08792},
eprinttype = {arXiv},
eprint = {1711.08792},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1711-08792.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biodb/BurnsDWH16,
author = {Gully A. P. C. Burns and
Pradeep Dasigi and
Anita de Waard and
Eduard H. Hovy},
title = {Automated detection of discourse segment and experimental types from
the text of cancer pathway results sections},
journal = {Database J. Biol. Databases Curation},
volume = {2016},
year = {2016},
url = {https://doi.org/10.1093/database/baw122},
doi = {10.1093/DATABASE/BAW122},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biodb/BurnsDWH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HuMLHX16,
author = {Zhiting Hu and
Xuezhe Ma and
Zhengzhong Liu and
Eduard H. Hovy and
Eric P. Xing},
title = {Harnessing Deep Neural Networks with Logic Rules},
booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume
1: Long Papers},
publisher = {The Association for Computer Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/p16-1228},
doi = {10.18653/V1/P16-1228},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/HuMLHX16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/JauharTH16,
author = {Sujay Kumar Jauhar and
Peter D. Turney and
Eduard H. Hovy},
title = {Tables as Semi-structured Knowledge for Question Answering},
booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume
1: Long Papers},
publisher = {The Association for Computer Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/p16-1045},
doi = {10.18653/V1/P16-1045},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/JauharTH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/MaH16,
author = {Xuezhe Ma and
Eduard H. Hovy},
title = {End-to-end Sequence Labeling via Bi-directional LSTM-CNNs-CRF},
booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume
1: Long Papers},
publisher = {The Association for Computer Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/p16-1101},
doi = {10.18653/V1/P16-1101},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/MaH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/WilsonSDLCLAZSR16,
author = {Shomir Wilson and
Florian Schaub and
Aswarth Abhilash Dara and
Frederick Liu and
Sushain Cherivirala and
Pedro Giovanni Leon and
Mads Schaarup Andersen and
Sebastian Zimmeck and
Kanthashree Mysore Sathyendra and
N. Cameron Russell and
Thomas B. Norton and
Eduard H. Hovy and
Joel R. Reidenberg and
Norman M. Sadeh},
title = {The Creation and Analysis of a Website Privacy Policy Corpus},
booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume
1: Long Papers},
publisher = {The Association for Computer Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/p16-1126},
doi = {10.18653/V1/P16-1126},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/WilsonSDLCLAZSR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccis/DustdarHLG16,
author = {Schahram Dustdar and
Eduard H. Hovy and
Xiangyang Li and
Moncef Gabbouj},
title = {Keynote speech},
booktitle = {4th International Conference on Cloud Computing and Intelligence Systems,
{CCIS} 2016, Beijing, China, August 17-19, 2016},
publisher = {{IEEE}},
year = {2016},
url = {https://doi.org/10.1109/CCIS.2016.7790315},
doi = {10.1109/CCIS.2016.7790315},
timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
biburl = {https://dblp.org/rec/conf/ccis/DustdarHLG16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/BurnsWDH16,
author = {Gully A. P. C. Burns and
Anita de Waard and
Pradeep Dasigi and
Eduard H. Hovy},
editor = {Pankaj Jaiswal and
Robert Hoehndorf and
Cecilia N. Arighi and
Austin Meier},
title = {Cycles of Scientific Investigation in Discourse - Machine Reading
Methods for the Primary Research Contributions of a Paper},
booktitle = {Proceedings of the Joint International Conference on Biological Ontology
and BioCreative, Corvallis, Oregon, United States, August 1-4, 2016},
series = {{CEUR} Workshop Proceedings},
volume = {1747},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1747/BT102\_ICBO2016.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:23 +0100},
biburl = {https://dblp.org/rec/conf/icbo/BurnsWDH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwsm/YangHKH16,
author = {Diyi Yang and
Aaron Halfaker and
Robert E. Kraut and
Eduard H. Hovy},
title = {Who Did What: Editor Role Identification in Wikipedia},
booktitle = {Proceedings of the Tenth International Conference on Web and Social
Media, Cologne, Germany, May 17-20, 2016},
pages = {446--455},
publisher = {{AAAI} Press},
year = {2016},
url = {http://www.aaai.org/ocs/index.php/ICWSM/ICWSM16/paper/view/13077},
timestamp = {Fri, 05 Feb 2021 11:07:46 +0100},
biburl = {https://dblp.org/rec/conf/icwsm/YangHKH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/YangHKH16,
author = {Diyi Yang and
Aaron Halfaker and
Robert E. Kraut and
Eduard H. Hovy},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Sara Goggi and
Marko Grobelnik and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Edit Categories and Editor Role Identification in Wikipedia},
booktitle = {Proceedings of the Tenth International Conference on Language Resources
and Evaluation {LREC} 2016, Portoro{\v{z}}, Slovenia, May 23-28, 2016},
publisher = {European Language Resources Association {(ELRA)}},
year = {2016},
url = {http://www.lrec-conf.org/proceedings/lrec2016/summaries/582.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/YangHKH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mediaeval/SutcliffeCHLFR16,
author = {Richard F. E. Sutcliffe and
Tom Collins and
Eduard H. Hovy and
Richard Lewis and
Chris Fox and
Deane L. Root},
editor = {Guillaume Gravier and
Claire{-}H{\'{e}}l{\`{e}}ne Demarty and
Herv{\'{e}} Bredin and
Bogdan Ionescu and
Christina Boididou and
Emmanuel Dellandr{\'{e}}a and
Jaeyoung Choi and
Michael Riegler and
Richard F. E. Sutcliffe and
Igor Sz{\"{o}}ke and
Gareth J. F. Jones and
Martha A. Larson},
title = {The C@merata task at MediaEval 2016: Natural Language Queries Derived
from Exam Papers, Articles and Other Sources against Classical Music
Scores in MusicXML},
booktitle = {Working Notes Proceedings of the MediaEval 2016 Workshop, Hilversum,
The Netherlands, October 20-21, 2016},
series = {{CEUR} Workshop Proceedings},
volume = {1739},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1739/MediaEval\_2016\_paper\_55.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:12 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeCHLFR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/LiCHJ16,
author = {Jiwei Li and
Xinlei Chen and
Eduard H. Hovy and
Dan Jurafsky},
editor = {Kevin Knight and
Ani Nenkova and
Owen Rambow},
title = {Visualizing and Understanding Neural Models in {NLP}},
booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter
of the Association for Computational Linguistics: Human Language Technologies,
San Diego California, USA, June 12-17, 2016},
pages = {681--691},
publisher = {The Association for Computational Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/n16-1082},
doi = {10.18653/V1/N16-1082},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/naacl/LiCHJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/MaLH16,
author = {Xuezhe Ma and
Zhengzhong Liu and
Eduard H. Hovy},
editor = {Kevin Knight and
Ani Nenkova and
Owen Rambow},
title = {Unsupervised Ranking Model for Entity Coreference Resolution},
booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter
of the Association for Computational Linguistics: Human Language Technologies,
San Diego California, USA, June 12-17, 2016},
pages = {1012--1018},
publisher = {The Association for Computational Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/n16-1116},
doi = {10.18653/V1/N16-1116},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/MaLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/YangYDHSH16,
author = {Zichao Yang and
Diyi Yang and
Chris Dyer and
Xiaodong He and
Alexander J. Smola and
Eduard H. Hovy},
editor = {Kevin Knight and
Ani Nenkova and
Owen Rambow},
title = {Hierarchical Attention Networks for Document Classification},
booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter
of the Association for Computational Linguistics: Human Language Technologies,
San Diego California, USA, June 12-17, 2016},
pages = {1480--1489},
publisher = {The Association for Computational Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/n16-1174},
doi = {10.18653/V1/N16-1174},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/YangYDHSH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aclevents/2016,
editor = {Martha Palmer and
Eduard H. Hovy and
Teruko Mitamura and
Tim O'Gorman},
title = {Proceedings of the Fourth Workshop on Events, EVENTS@HLT-NAACL 2016,
San Diego, California, USA, June 17, 2016},
publisher = {Association for Computational Linguistics},
year = {2016},
url = {https://aclanthology.org/volumes/W16-10/},
isbn = {978-1-941643-89-1},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclevents/2016.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/LiuAMH16,
author = {Zhengzhong Liu and
Jun Araki and
Teruko Mitamura and
Eduard H. Hovy},
title = {{CMU-LTI} at {KBP} 2016 Event Nugget Track},
booktitle = {Proceedings of the 2016 Text Analysis Conference, {TAC} 2016, Gaithersburg,
Maryland, USA, November 14-15, 2016},
publisher = {{NIST}},
year = {2016},
url = {https://tac.nist.gov/publications/2016/participant.papers/TAC2016.LTI\_CMU.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 13:25:24 +0200},
biburl = {https://dblp.org/rec/conf/tac/LiuAMH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/MaFLH16,
author = {Xuezhe Ma and
Nicolas R. Fauceglia and
Yiu{-}Chang Lin and
Eduard H. Hovy},
title = {{CMU} System for Entity Discovery and Linking at {TAC-KBP} 2016},
booktitle = {Proceedings of the 2016 Text Analysis Conference, {TAC} 2016, Gaithersburg,
Maryland, USA, November 14-15, 2016},
publisher = {{NIST}},
year = {2016},
url = {https://tac.nist.gov/publications/2016/participant.papers/TAC2016.CMU\_CS\_EDL.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tac/MaFLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/MitamuraLH16,
author = {Teruko Mitamura and
Zhengzhong Liu and
Eduard H. Hovy},
title = {Overview of {TAC-KBP} 2016 Event Nugget Track},
booktitle = {Proceedings of the 2016 Text Analysis Conference, {TAC} 2016, Gaithersburg,
Maryland, USA, November 14-15, 2016},
publisher = {{NIST}},
year = {2016},
url = {https://tac.nist.gov/publications/2016/additional.papers/TAC2016.KBP\_Event\_Nugget\_overview.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tac/MitamuraLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JauharTH16,
author = {Sujay Kumar Jauhar and
Peter D. Turney and
Eduard H. Hovy},
title = {TabMCQ: {A} Dataset of General Knowledge Tables and Multiple-choice
Questions},
journal = {CoRR},
volume = {abs/1602.03960},
year = {2016},
url = {http://arxiv.org/abs/1602.03960},
eprinttype = {arXiv},
eprint = {1602.03960},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/JauharTH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MaH16,
author = {Xuezhe Ma and
Eduard H. Hovy},
title = {End-to-end Sequence Labeling via Bi-directional LSTM-CNNs-CRF},
journal = {CoRR},
volume = {abs/1603.01354},
year = {2016},
url = {http://arxiv.org/abs/1603.01354},
eprinttype = {arXiv},
eprint = {1603.01354},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MaH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MaLH16,
author = {Xuezhe Ma and
Zhengzhong Liu and
Eduard H. Hovy},
title = {Unsupervised Ranking Model for Entity Coreference Resolution},
journal = {CoRR},
volume = {abs/1603.04553},
year = {2016},
url = {http://arxiv.org/abs/1603.04553},
eprinttype = {arXiv},
eprint = {1603.04553},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MaLH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/HuMLHX16,
author = {Zhiting Hu and
Xuezhe Ma and
Zhengzhong Liu and
Eduard H. Hovy and
Eric P. Xing},
title = {Harnessing Deep Neural Networks with Logic Rules},
journal = {CoRR},
volume = {abs/1603.06318},
year = {2016},
url = {http://arxiv.org/abs/1603.06318},
eprinttype = {arXiv},
eprint = {1603.06318},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/HuMLHX16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MaGHYDH16,
author = {Xuezhe Ma and
Yingkai Gao and
Zhiting Hu and
Yaoliang Yu and
Yuntian Deng and
Eduard H. Hovy},
title = {Dropout with Expectation-linear Regularization},
journal = {CoRR},
volume = {abs/1609.08017},
year = {2016},
url = {http://arxiv.org/abs/1609.08017},
eprinttype = {arXiv},
eprint = {1609.08017},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/MaGHYDH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/CirikHM16,
author = {Volkan Cirik and
Eduard H. Hovy and
Louis{-}Philippe Morency},
title = {Visualizing and Understanding Curriculum Learning for Long Short-Term
Memory Networks},
journal = {CoRR},
volume = {abs/1611.06204},
year = {2016},
url = {http://arxiv.org/abs/1611.06204},
eprinttype = {arXiv},
eprint = {1611.06204},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/CirikHM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/WangHD15,
author = {Haoyu Wang and
Eduard H. Hovy and
Mark Dredze},
editor = {Arash Shaban{-}Nejad and
David L. Buckeridge and
John S. Brownstein},
title = {The Hurricane Sandy Twitter Corpus},
booktitle = {World Wide Web and Public Health Intelligence, Papers from the 2015
{AAAI} Workshop, Austin, Texas, USA, January, 2015},
series = {{AAAI} Technical Report},
volume = {{WS-15-15}},
publisher = {{AAAI} Press},
year = {2015},
url = {http://aaai.org/ocs/index.php/WS/AAAIW15/paper/view/10079},
timestamp = {Tue, 05 Sep 2023 08:59:27 +0200},
biburl = {https://dblp.org/rec/conf/aaai/WangHD15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aclevents/FaucegliaLMH15,
author = {Nicolas R. Fauceglia and
Yiu{-}Chang Lin and
Xuezhe Ma and
Eduard H. Hovy},
editor = {Eduard H. Hovy and
Teruko Mitamura and
Martha Palmer},
title = {Word Sense Disambiguation via PropStore and OntoNotes for Event Mention
Detection},
booktitle = {Proceedings of the The 3rd Workshop on {EVENTS:} Definition, Detection,
Coreference, and Representation, EVENTS@HLP-NAACL 2015, Denver, Colorado,
USA, June 4, 2015},
pages = {11--15},
publisher = {Association for Computational Linguistics},
year = {2015},
url = {https://doi.org/10.3115/v1/W15-0802},
doi = {10.3115/V1/W15-0802},
timestamp = {Fri, 06 Aug 2021 00:40:18 +0200},
biburl = {https://dblp.org/rec/conf/aclevents/FaucegliaLMH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aclevents/LiuMH15,
author = {Zhengzhong Liu and
Teruko Mitamura and
Eduard H. Hovy},
editor = {Eduard H. Hovy and
Teruko Mitamura and
Martha Palmer},
title = {Evaluation Algorithms for Event Nugget Detection : {A} Pilot Study},
booktitle = {Proceedings of the The 3rd Workshop on {EVENTS:} Definition, Detection,
Coreference, and Representation, EVENTS@HLP-NAACL 2015, Denver, Colorado,
USA, June 4, 2015},
pages = {53--57},
publisher = {Association for Computational Linguistics},
year = {2015},
url = {https://doi.org/10.3115/v1/W15-0807},
doi = {10.3115/V1/W15-0807},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclevents/LiuMH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/RodrigoPMHK15,
author = {{\'{A}}lvaro Rodrigo and
Anselmo Pe{\~{n}}as and
Yusuke Miyao and
Eduard H. Hovy and
Noriko Kando},
editor = {Linda Cappellato and
Nicola Ferro and
Gareth J. F. Jones and
Eric SanJuan},
title = {Overview of {CLEF} {QA} Entrance Exams Task 2015},
booktitle = {Working Notes of {CLEF} 2015 - Conference and Labs of the Evaluation
forum, Toulouse, France, September 8-11, 2015},
series = {{CEUR} Workshop Proceedings},
volume = {1391},
publisher = {CEUR-WS.org},
year = {2015},
url = {https://ceur-ws.org/Vol-1391/171-CR.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:42 +0100},
biburl = {https://dblp.org/rec/conf/clef/RodrigoPMHK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/MaH15,
author = {Xuezhe Ma and
Eduard H. Hovy},
editor = {Llu{\'{\i}}s M{\`{a}}rquez and
Chris Callison{-}Burch and
Jian Su and
Daniele Pighin and
Yuval Marton},
title = {Efficient Inner-to-outer Greedy Algorithm for Higher-order Labeled
Dependency Parsing},
booktitle = {Proceedings of the 2015 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2015, Lisbon, Portugal, September 17-21,
2015},
pages = {1322--1328},
publisher = {The Association for Computational Linguistics},
year = {2015},
url = {https://doi.org/10.18653/v1/d15-1154},
doi = {10.18653/V1/D15-1154},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/MaH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiLJH15,
author = {Jiwei Li and
Thang Luong and
Dan Jurafsky and
Eduard H. Hovy},
editor = {Llu{\'{\i}}s M{\`{a}}rquez and
Chris Callison{-}Burch and
Jian Su and
Daniele Pighin and
Yuval Marton},
title = {When Are Tree Structures Necessary for Deep Learning of Representations?},
booktitle = {Proceedings of the 2015 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2015, Lisbon, Portugal, September 17-21,
2015},
pages = {2304--2314},
publisher = {The Association for Computational Linguistics},
year = {2015},
url = {https://doi.org/10.18653/v1/d15-1278},
doi = {10.18653/V1/D15-1278},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/LiLJH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/YangLDH15,
author = {Diyi Yang and
Alon Lavie and
Chris Dyer and
Eduard H. Hovy},
editor = {Llu{\'{\i}}s M{\`{a}}rquez and
Chris Callison{-}Burch and
Jian Su and
Daniele Pighin and
Yuval Marton},
title = {Humor Recognition and Humor Anchor Extraction},
booktitle = {Proceedings of the 2015 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2015, Lisbon, Portugal, September 17-21,
2015},
pages = {2367--2376},
publisher = {The Association for Computational Linguistics},
year = {2015},
url = {https://doi.org/10.18653/v1/d15-1284},
doi = {10.18653/V1/D15-1284},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/YangLDH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/SachanHX15,
author = {Mrinmaya Sachan and
Eduard H. Hovy and
Eric P. Xing},
editor = {Qiang Yang and
Michael J. Wooldridge},
title = {An Active Learning Approach to Coreference Resolution},
booktitle = {Proceedings of the Twenty-Fourth International Joint Conference on
Artificial Intelligence, {IJCAI} 2015, Buenos Aires, Argentina, July
25-31, 2015},
pages = {1312--1318},
publisher = {{AAAI} Press},
year = {2015},
url = {http://ijcai.org/Abstract/15/189},
timestamp = {Tue, 20 Aug 2019 16:16:43 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/SachanHX15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismir/SutcliffeCFRHL15,
author = {Richard F. E. Sutcliffe and
Tim Crawford and
Chris Fox and
Deane L. Root and
Eduard H. Hovy and
Richard Lewis},
editor = {Meinard M{\"{u}}ller and
Frans Wiering},
title = {Relating Natural Language Text to Musical Passages},
booktitle = {Proceedings of the 16th International Society for Music Information
Retrieval Conference, {ISMIR} 2015, M{\'{a}}laga, Spain, October
26-30, 2015},
pages = {524--530},
year = {2015},
url = {http://ismir2015.uma.es/articles/263\_Paper.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ismir/SutcliffeCFRHL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mediaeval/SutcliffeFRHL15,
author = {Richard F. E. Sutcliffe and
Chris Fox and
Deane L. Root and
Eduard H. Hovy and
Richard Lewis},
editor = {Martha A. Larson and
Bogdan Ionescu and
Mats Sj{\"{o}}berg and
Xavier Anguera and
Johann Poignant and
Michael Riegler and
Maria Eskevich and
Claudia Hauff and
Richard F. E. Sutcliffe and
Gareth J. F. Jones and
Yi{-}Hsuan Yang and
Mohammad Soleymani and
Symeon Papadopoulos},
title = {The C@merata Task at MediaEval 2015: Natural Language Queries on Classical
Music Scores},
booktitle = {Working Notes Proceedings of the MediaEval 2015 Workshop, Wurzen,
Germany, September 14-15, 2015},
series = {{CEUR} Workshop Proceedings},
volume = {1436},
publisher = {CEUR-WS.org},
year = {2015},
url = {https://ceur-ws.org/Vol-1436/Paper12.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:12 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeFRHL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/JauharDH15,
author = {Sujay Kumar Jauhar and
Chris Dyer and
Eduard H. Hovy},
editor = {Rada Mihalcea and
Joyce Yue Chai and
Anoop Sarkar},
title = {Ontologically Grounded Multi-sense Representation Learning for Semantic
Vector Space Models},
booktitle = {{NAACL} {HLT} 2015, The 2015 Conference of the North American Chapter
of the Association for Computational Linguistics: Human Language Technologies,
Denver, Colorado, USA, May 31 - June 5, 2015},
pages = {683--693},
publisher = {The Association for Computational Linguistics},
year = {2015},
url = {https://doi.org/10.3115/v1/n15-1070},
doi = {10.3115/V1/N15-1070},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/JauharDH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/FaruquiDJDHS15,
author = {Manaal Faruqui and
Jesse Dodge and
Sujay Kumar Jauhar and
Chris Dyer and
Eduard H. Hovy and
Noah A. Smith},
editor = {Rada Mihalcea and
Joyce Yue Chai and
Anoop Sarkar},
title = {Retrofitting Word Vectors to Semantic Lexicons},
booktitle = {{NAACL} {HLT} 2015, The 2015 Conference of the North American Chapter
of the Association for Computational Linguistics: Human Language Technologies,
Denver, Colorado, USA, May 31 - June 5, 2015},
pages = {1606--1615},
publisher = {The Association for Computational Linguistics},
year = {2015},
url = {https://doi.org/10.3115/v1/n15-1184},
doi = {10.3115/V1/N15-1184},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/FaruquiDJDHS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aclevents/2015,
editor = {Eduard H. Hovy and
Teruko Mitamura and
Martha Palmer},
title = {Proceedings of the The 3rd Workshop on {EVENTS:} Definition, Detection,
Coreference, and Representation, EVENTS@HLP-NAACL 2015, Denver, Colorado,
USA, June 4, 2015},
publisher = {Association for Computational Linguistics},
year = {2015},
url = {https://aclanthology.org/volumes/W15-08/},
isbn = {978-1-941643-37-2},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclevents/2015.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/FaucegliaLMH15,
author = {Nicolas R. Fauceglia and
Yiu{-}Chang Lin and
Xuezhe Ma and
Eduard H. Hovy},
title = {{CMU} System for Entity Discovery and Linking at {TAC-KBP} 2015},
booktitle = {Proceedings of the 2015 Text Analysis Conference, {TAC} 2015, Gaithersburg,
Maryland, USA, November 16-17, 2015, 2015},
publisher = {{NIST}},
year = {2015},
url = {https://tac.nist.gov/publications/2015/participant.papers/TAC2015.CMU\_Edvisees.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 13:25:17 +0200},
biburl = {https://dblp.org/rec/conf/tac/FaucegliaLMH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/LiuADMH15,
author = {Zhengzhong Liu and
Jun Araki and
Dheeru Dua and
Teruko Mitamura and
Eduard H. Hovy},
title = {{CMU-LTI} at {KBP} 2015 Event Track},
booktitle = {Proceedings of the 2015 Text Analysis Conference, {TAC} 2015, Gaithersburg,
Maryland, USA, November 16-17, 2015, 2015},
publisher = {{NIST}},
year = {2015},
url = {https://tac.nist.gov/publications/2015/participant.papers/TAC2015.LTI.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tac/LiuADMH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/MitamuraLH15,
author = {Teruko Mitamura and
Zhengzhong Liu and
Eduard H. Hovy},
title = {Overview of {TAC} {KBP} 2015 Event Nugget Track},
booktitle = {Proceedings of the 2015 Text Analysis Conference, {TAC} 2015, Gaithersburg,
Maryland, USA, November 16-17, 2015, 2015},
publisher = {{NIST}},
year = {2015},
url = {https://tac.nist.gov/publications/2015/additional.papers/TAC2015.KBP\_Event\_Nugget\_overview.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tac/MitamuraLH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiH15,
author = {Jiwei Li and
Eduard H. Hovy},
title = {The {NLP} Engine: {A} Universal Turing Machine for {NLP}},
journal = {CoRR},
volume = {abs/1503.00168},
year = {2015},
url = {http://arxiv.org/abs/1503.00168},
eprinttype = {arXiv},
eprint = {1503.00168},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/LiH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiJH15,
author = {Jiwei Li and
Dan Jurafsky and
Eduard H. Hovy},
title = {When Are Tree Structures Necessary for Deep Learning of Representations?},
journal = {CoRR},
volume = {abs/1503.00185},
year = {2015},
url = {http://arxiv.org/abs/1503.00185},
eprinttype = {arXiv},
eprint = {1503.00185},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/LiJH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiCHJ15,
author = {Jiwei Li and
Xinlei Chen and
Eduard H. Hovy and
Dan Jurafsky},
title = {Visualizing and Understanding Neural Models in {NLP}},
journal = {CoRR},
volume = {abs/1506.01066},
year = {2015},
url = {http://arxiv.org/abs/1506.01066},
eprinttype = {arXiv},
eprint = {1506.01066},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/LiCHJ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiH15b,
author = {Jiwei Li and
Eduard H. Hovy},
title = {Reflections on Sentiment/Opinion Analysis},
journal = {CoRR},
volume = {abs/1507.01636},
year = {2015},
url = {http://arxiv.org/abs/1507.01636},
eprinttype = {arXiv},
eprint = {1507.01636},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/LiH15b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dagstuhl-reports/GurevychHSS15,
author = {Iryna Gurevych and
Eduard H. Hovy and
Noam Slonim and
Benno Stein},
title = {Debating Technologies (Dagstuhl Seminar 15512)},
journal = {Dagstuhl Reports},
volume = {5},
number = {12},
pages = {18--46},
year = {2015},
url = {https://doi.org/10.4230/DagRep.5.12.18},
doi = {10.4230/DAGREP.5.12.18},
timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dagstuhl-reports/GurevychHSS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LuoPRH14,
author = {Xiaoqiang Luo and
Sameer Pradhan and
Marta Recasens and
Eduard H. Hovy},
title = {An Extension of {BLANC} to System Mentions},
booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational
Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume
2: Short Papers},
pages = {24--29},
publisher = {The Association for Computer Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/p14-2005},
doi = {10.3115/V1/P14-2005},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/LuoPRH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/PradhanLRHNS14,
author = {Sameer Pradhan and
Xiaoqiang Luo and
Marta Recasens and
Eduard H. Hovy and
Vincent Ng and
Michael Strube},
title = {Scoring Coreference Partitions of Predicted Mentions: {A} Reference
Implementation},
booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational
Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume
2: Short Papers},
pages = {30--35},
publisher = {The Association for Computer Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/p14-2006},
doi = {10.3115/V1/P14-2006},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/PradhanLRHNS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiRH14,
author = {Jiwei Li and
Alan Ritter and
Eduard H. Hovy},
title = {Weakly Supervised User Profile Extraction from Twitter},
booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational
Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume
1: Long Papers},
pages = {165--174},
publisher = {The Association for Computer Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/p14-1016},
doi = {10.3115/V1/P14-1016},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/LiRH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/SrivastavaH14,
author = {Shashank Srivastava and
Eduard H. Hovy},
title = {Vector space semantics with frequency-driven motifs},
booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational
Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume
1: Long Papers},
pages = {634--643},
publisher = {The Association for Computer Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/p14-1060},
doi = {10.3115/V1/P14-1060},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/SrivastavaH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiOCH14,
author = {Jiwei Li and
Myle Ott and
Claire Cardie and
Eduard H. Hovy},
title = {Towards a General Rule for Identifying Deceptive Opinion Spam},
booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational
Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume
1: Long Papers},
pages = {1566--1576},
publisher = {The Association for Computer Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/p14-1147},
doi = {10.3115/V1/P14-1147},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/LiOCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aclevents/ArakiHM14,
author = {Jun Araki and
Eduard H. Hovy and
Teruko Mitamura},
editor = {Teruko Mitamura and
Eduard H. Hovy and
Martha Palmer},
title = {Evaluation for Partial Event Coreference},
booktitle = {Proceedings of the Second Workshop on {EVENTS:} Definition, Detection,
Coreference, and Representation, EVENTS@ACL 2014, Baltimore, Maryland,
USA, June 2014},
pages = {68--76},
publisher = {Association for Computational Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/W14-2910},
doi = {10.3115/V1/W14-2910},
timestamp = {Fri, 06 Aug 2021 00:40:18 +0200},
biburl = {https://dblp.org/rec/conf/aclevents/ArakiHM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/LiWH14,
author = {Jiwei Li and
Xun Wang and
Eduard H. Hovy},
editor = {Jianzhong Li and
Xiaoyang Sean Wang and
Minos N. Garofalakis and
Ian Soboroff and
Torsten Suel and
Min Wang},
title = {What a Nasty Day: Exploring Mood-Weather Relationship from Twitter},
booktitle = {Proceedings of the 23rd {ACM} International Conference on Conference
on Information and Knowledge Management, {CIKM} 2014, Shanghai, China,
November 3-7, 2014},
pages = {1309--1318},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2661829.2662090},
doi = {10.1145/2661829.2662090},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/LiWH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/PenasMRHK14,
author = {Anselmo Pe{\~{n}}as and
Yusuke Miyao and
{\'{A}}lvaro Rodrigo and
Eduard H. Hovy and
Noriko Kando},
editor = {Linda Cappellato and
Nicola Ferro and
Martin Halvey and
Wessel Kraaij},
title = {Overview of {CLEF} {QA} Entrance Exams Task 2014},
booktitle = {Working Notes for {CLEF} 2014 Conference, Sheffield, UK, September
15-18, 2014},
series = {{CEUR} Workshop Proceedings},
volume = {1180},
pages = {1194--1200},
publisher = {CEUR-WS.org},
year = {2014},
url = {https://ceur-ws.org/Vol-1180/CLEF2014wn-QA-PenasEt2014.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:41 +0100},
biburl = {https://dblp.org/rec/conf/clef/PenasMRHK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/JauharH14,
author = {Sujay Kumar Jauhar and
Eduard H. Hovy},
editor = {Jan Hajic and
Junichi Tsujii},
title = {Inducing Latent Semantic Relations for Structured Distributional Semantics},
booktitle = {{COLING} 2014, 25th International Conference on Computational Linguistics,
Proceedings of the Conference: Technical Papers, August 23-29, 2014,
Dublin, Ireland},
pages = {698--708},
publisher = {{ACL}},
year = {2014},
url = {https://aclanthology.org/C14-1066/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/JauharH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/GoyalH14,
author = {Kartik Goyal and
Eduard H. Hovy},
editor = {Jan Hajic and
Junichi Tsujii},
title = {Unsupervised Word Sense Induction using Distributional Statistics},
booktitle = {{COLING} 2014, 25th International Conference on Computational Linguistics,
Proceedings of the Conference: Technical Papers, August 23-29, 2014,
Dublin, Ireland},
pages = {1302--1310},
publisher = {{ACL}},
year = {2014},
url = {https://aclanthology.org/C14-1123/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/GoyalH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/DasigiH14,
author = {Pradeep Dasigi and
Eduard H. Hovy},
editor = {Jan Hajic and
Junichi Tsujii},
title = {Modeling Newswire Events using Neural Networks for Anomaly Detection},
booktitle = {{COLING} 2014, 25th International Conference on Computational Linguistics,
Proceedings of the Conference: Technical Papers, August 23-29, 2014,
Dublin, Ireland},
pages = {1414--1422},
publisher = {{ACL}},
year = {2014},
url = {https://aclanthology.org/C14-1134/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/DasigiH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/KlaperH14,
author = {David Klaper and
Eduard H. Hovy},
editor = {Gabriel Puron Cid and
Scott P. Robertson and
Jing Zhang and
J. Ram{\'{o}}n Gil{-}Garc{\'{\i}}a},
title = {A taxonomy and a knowledge portal for cybersecurity},
booktitle = {15th Annual International Conference on Digital Government Research,
dg.o '14, Aguascalientes, Mexico, June 18-21, 2014},
pages = {79--85},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2612733.2612759},
doi = {10.1145/2612733.2612759},
timestamp = {Fri, 08 Sep 2023 15:13:05 +0200},
biburl = {https://dblp.org/rec/conf/dgo/KlaperH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/SilvaPSBH14,
author = {Daniel Ribeiro Silva and
Andrew Philpot and
Abhishek Sundararajan and
Nicole Marie Bryan and
Eduard H. Hovy},
editor = {Gabriel Puron Cid and
Scott P. Robertson and
Jing Zhang and
J. Ram{\'{o}}n Gil{-}Garc{\'{\i}}a},
title = {Data integration from open internet sources and network detection
to combat underage sex trafficking},
booktitle = {15th Annual International Conference on Digital Government Research,
dg.o '14, Aguascalientes, Mexico, June 18-21, 2014},
pages = {86--90},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2612733.2612746},
doi = {10.1145/2612733.2612746},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/SilvaPSBH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiH14,
author = {Jiwei Li and
Eduard H. Hovy},
editor = {Alessandro Moschitti and
Bo Pang and
Walter Daelemans},
title = {Sentiment Analysis on the People's Daily},
booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar,
{A} meeting of SIGDAT, a Special Interest Group of the {ACL}},
pages = {467--476},
publisher = {{ACL}},
year = {2014},
url = {https://doi.org/10.3115/v1/d14-1053},
doi = {10.3115/V1/D14-1053},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/LiH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiRCH14,
author = {Jiwei Li and
Alan Ritter and
Claire Cardie and
Eduard H. Hovy},
editor = {Alessandro Moschitti and
Bo Pang and
Walter Daelemans},
title = {Major Life Event Extraction from Twitter based on Congratulations/Condolences
Speech Acts},
booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar,
{A} meeting of SIGDAT, a Special Interest Group of the {ACL}},
pages = {1997--2007},
publisher = {{ACL}},
year = {2014},
url = {https://doi.org/10.3115/v1/d14-1214},
doi = {10.3115/V1/D14-1214},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/LiRCH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiH14a,
author = {Jiwei Li and
Eduard H. Hovy},
editor = {Alessandro Moschitti and
Bo Pang and
Walter Daelemans},
title = {A Model of Coherence Based on Distributed Sentence Representation},
booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar,
{A} meeting of SIGDAT, a Special Interest Group of the {ACL}},
pages = {2039--2048},
publisher = {{ACL}},
year = {2014},
url = {https://doi.org/10.3115/v1/d14-1218},
doi = {10.3115/V1/D14-1218},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/LiH14a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiLH14,
author = {Jiwei Li and
Rumeng Li and
Eduard H. Hovy},
editor = {Alessandro Moschitti and
Bo Pang and
Walter Daelemans},
title = {Recursive Deep Models for Discourse Parsing},
booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar,
{A} meeting of SIGDAT, a Special Interest Group of the {ACL}},
pages = {2061--2069},
publisher = {{ACL}},
year = {2014},
url = {https://doi.org/10.3115/v1/d14-1220},
doi = {10.3115/V1/D14-1220},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/LiLH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/JainBRH14,
author = {Siddharth Jain and
Archna Bhatia and
Angelique Rein and
Eduard H. Hovy},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Hrafn Loftsson and
Bente Maegaard and
Joseph Mariani and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {A Corpus of Participant Roles in Contentious Discussions},
booktitle = {Proceedings of the Ninth International Conference on Language Resources
and Evaluation, {LREC} 2014, Reykjavik, Iceland, May 26-31, 2014},
pages = {1751--1756},
publisher = {European Language Resources Association {(ELRA)}},
year = {2014},
url = {http://www.lrec-conf.org/proceedings/lrec2014/summaries/1019.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/JainBRH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/LiuAHM14,
author = {Zhengzhong Liu and
Jun Araki and
Eduard H. Hovy and
Teruko Mitamura},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Hrafn Loftsson and
Bente Maegaard and
Joseph Mariani and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Supervised Within-Document Event Coreference using Information Propagation},
booktitle = {Proceedings of the Ninth International Conference on Language Resources
and Evaluation, {LREC} 2014, Reykjavik, Iceland, May 26-31, 2014},
pages = {4539--4544},
publisher = {European Language Resources Association {(ELRA)}},
year = {2014},
url = {http://www.lrec-conf.org/proceedings/lrec2014/summaries/646.html},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/LiuAHM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/ArakiLHM14,
author = {Jun Araki and
Zhengzhong Liu and
Eduard H. Hovy and
Teruko Mitamura},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Hrafn Loftsson and
Bente Maegaard and
Joseph Mariani and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Detecting Subevent Structure for Event Coreference Resolution},
booktitle = {Proceedings of the Ninth International Conference on Language Resources
and Evaluation, {LREC} 2014, Reykjavik, Iceland, May 26-31, 2014},
pages = {4553--4558},
publisher = {European Language Resources Association {(ELRA)}},
year = {2014},
url = {http://www.lrec-conf.org/proceedings/lrec2014/summaries/963.html},
timestamp = {Tue, 20 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/ArakiLHM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mediaeval/SutcliffeCFRH14,
author = {Richard F. E. Sutcliffe and
Tim Crawford and
Chris Fox and
Deane L. Root and
Eduard H. Hovy},
editor = {Martha A. Larson and
Bogdan Ionescu and
Xavier Anguera and
Maria Eskevich and
Pavel Korshunov and
Markus Schedl and
Mohammad Soleymani and
Georgios Petkos and
Richard F. E. Sutcliffe and
Jaeyoung Choi and
Gareth J. F. Jones},
title = {The C@merata Task at MediaEval 2014: Natural Language Queries on Classical
Music Scores},
booktitle = {Working Notes Proceedings of the MediaEval 2014 Workshop, Barcelona,
Catalunya, Spain, October 16-17, 2014},
series = {{CEUR} Workshop Proceedings},
volume = {1263},
publisher = {CEUR-WS.org},
year = {2014},
url = {https://ceur-ws.org/Vol-1263/mediaeval2014\_submission\_46.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:12 +0100},
biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeCFRH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/Hovy14,
author = {Eduard H. Hovy},
editor = {Julio Gonzalo and
Hang Li and
Alessandro Moschitti and
Jun Xu},
title = {Distributional Semantics for {IR}},
booktitle = {Proceedings of Workshop on Semantic Matching in Information Retrieval
co-located with the 37th international {ACM} {SIGIR} conference on
research and development in information retrieval, SMIR@SIGIR 2014,
Queensland, Australia, July 11, 2014},
series = {{CEUR} Workshop Proceedings},
volume = {1204},
pages = {2--3},
publisher = {CEUR-WS.org},
year = {2014},
url = {https://ceur-ws.org/Vol-1204/papers/invited\_paper\_5.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:16 +0100},
biburl = {https://dblp.org/rec/conf/sigir/Hovy14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/specom/Echizen-yaAUH14,
author = {Hiroshi Echizen{-}ya and
Kenji Araki and
Yuzu Uchida and
Eduard H. Hovy},
editor = {Andrey Ronzhin and
Rodmonga Potapova and
Vlado Delic},
title = {Automatic Post-Editing Method Using Translation Knowledge Based on
Intuitive Common Parts Continuum for Statistical Machine Translation},
booktitle = {Speech and Computer - 16th International Conference, {SPECOM} 2014,
Novi Sad, Serbia, October 5-9, 2014. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8773},
pages = {129--136},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-11581-8\_16},
doi = {10.1007/978-3-319-11581-8\_16},
timestamp = {Tue, 29 Dec 2020 18:27:39 +0100},
biburl = {https://dblp.org/rec/conf/specom/Echizen-yaAUH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wmt/Echizen-yaAH14,
author = {Hiroshi Echizen{-}ya and
Kenji Araki and
Eduard H. Hovy},
title = {Application of Prize based on Sentence Length in Chunk-based Automatic
Evaluation of Machine Translation},
booktitle = {Proceedings of the Ninth Workshop on Statistical Machine Translation,
WMT@ACL 2014, June 26-27, 2014, Baltimore, Maryland, {USA}},
pages = {381--386},
publisher = {The Association for Computer Linguistics},
year = {2014},
url = {https://doi.org/10.3115/v1/w14-3349},
doi = {10.3115/V1/W14-3349},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wmt/Echizen-yaAH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsdm/SachanDSXH14,
author = {Mrinmaya Sachan and
Avinava Dubey and
Shashank Srivastava and
Eric P. Xing and
Eduard H. Hovy},
editor = {Ben Carterette and
Fernando Diaz and
Carlos Castillo and
Donald Metzler},
title = {Spatial compactness meets topical consistency: jointly modeling links
and content for community detection},
booktitle = {Seventh {ACM} International Conference on Web Search and Data Mining,
{WSDM} 2014, New York, NY, USA, February 24-28, 2014},
pages = {503--512},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2556195.2556219},
doi = {10.1145/2556195.2556219},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wsdm/SachanDSXH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aclevents/2014,
editor = {Teruko Mitamura and
Eduard H. Hovy and
Martha Palmer},
title = {Proceedings of the Second Workshop on {EVENTS:} Definition, Detection,
Coreference, and Representation, EVENTS@ACL 2014, Baltimore, Maryland,
USA, June 2014},
publisher = {Association for Computational Linguistics},
year = {2014},
url = {https://aclanthology.org/volumes/W14-29/},
isbn = {978-1-941643-14-3},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aclevents/2014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiWH14,
author = {Jiwei Li and
Xun Wang and
Eduard H. Hovy},
title = {What a Nasty day: Exploring Mood-Weather Relationship from Twitter},
journal = {CoRR},
volume = {abs/1410.8749},
year = {2014},
url = {http://arxiv.org/abs/1410.8749},
eprinttype = {arXiv},
eprint = {1410.8749},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/LiWH14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/FaruquiDJDHS14,
author = {Manaal Faruqui and
Jesse Dodge and
Sujay Kumar Jauhar and
Chris Dyer and
Eduard H. Hovy and
Noah A. Smith},
title = {Retrofitting Word Vectors to Semantic Lexicons},
journal = {CoRR},
volume = {abs/1411.4166},
year = {2014},
url = {http://arxiv.org/abs/1411.4166},
eprinttype = {arXiv},
eprint = {1411.4166},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/FaruquiDJDHS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/HovyNP13,
author = {Eduard H. Hovy and
Roberto Navigli and
Simone Paolo Ponzetto},
title = {Editorial},
journal = {Artif. Intell.},
volume = {194},
pages = {1},
year = {2013},
url = {https://doi.org/10.1016/j.artint.2012.11.001},
doi = {10.1016/J.ARTINT.2012.11.001},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ai/HovyNP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/HovyNP13a,
author = {Eduard H. Hovy and
Roberto Navigli and
Simone Paolo Ponzetto},
title = {Collaboratively built semi-structured content and Artificial Intelligence:
The story so far},
journal = {Artif. Intell.},
volume = {194},
pages = {2--27},
year = {2013},
url = {https://doi.org/10.1016/j.artint.2012.10.002},
doi = {10.1016/J.ARTINT.2012.10.002},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ai/HovyNP13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/BhagatH13,
author = {Rahul Bhagat and
Eduard H. Hovy},
title = {What Is a Paraphrase?},
journal = {Comput. Linguistics},
volume = {39},
number = {3},
pages = {463--472},
year = {2013},
url = {https://doi.org/10.1162/COLI\_a\_00166},
doi = {10.1162/COLI\_A\_00166},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/coling/BhagatH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lre/KozarevaH13,
author = {Zornitsa Kozareva and
Eduard H. Hovy},
title = {Tailoring the automated construction of large-scale taxonomies using
the web},
journal = {Lang. Resour. Evaluation},
volume = {47},
number = {3},
pages = {859--890},
year = {2013},
url = {https://doi.org/10.1007/s10579-013-9229-0},
doi = {10.1007/S10579-013-9229-0},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lre/KozarevaH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/HovyMMU13,
author = {Eduard H. Hovy and
Vita Markman and
Craig Martell and
David C. Uthus},
title = {Preface},
booktitle = {Analyzing Microtext, Papers from the 2013 {AAAI} Spring Symposium,
Palo Alto, California, USA, March 25-27, 2013},
series = {{AAAI} Technical Report},
volume = {{SS-13-01}},
publisher = {{AAAI}},
year = {2013},
url = {http://www.aaai.org/ocs/index.php/SSS/SSS13/paper/view/5961},
timestamp = {Mon, 09 Sep 2013 15:08:42 +0200},
biburl = {https://dblp.org/rec/conf/aaaiss/HovyMMU13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/GoyalJLSSH13a,
author = {Kartik Goyal and
Sujay Kumar Jauhar and
Huiying Li and
Mrinmaya Sachan and
Shashank Srivastava and
Eduard H. Hovy},
editor = {Alexandre Allauzen and
Hugo Larochelle and
Christopher D. Manning and
Richard Socher},
title = {A Structured Distributional Semantic Model : Integrating Structure
with Semantics},
booktitle = {Proceedings of the Workshop on Continuous Vector Space Models and
their Compositionality, CVSM@ACL 2013, Sofia, Bulgaria, August 9,
2013},
pages = {20--29},
publisher = {Association for Computational Linguistics},
year = {2013},
url = {https://aclanthology.org/W13-3203/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/GoyalJLSSH13a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/TratzH13,
author = {Stephen Tratz and
Eduard H. Hovy},
title = {Automatic Interpretation of the English Possessive},
booktitle = {Proceedings of the 51st Annual Meeting of the Association for Computational
Linguistics, {ACL} 2013, 4-9 August 2013, Sofia, Bulgaria, Volume
1: Long Papers},
pages = {372--381},
publisher = {The Association for Computer Linguistics},
year = {2013},
url = {https://aclanthology.org/P13-1037/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/TratzH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/GoyalJLSSH13,
author = {Kartik Goyal and
Sujay Kumar Jauhar and
Huiying Li and
Mrinmaya Sachan and
Shashank Srivastava and
Eduard H. Hovy},
title = {A Structured Distributional Semantic Model for Event Co-reference},
booktitle = {Proceedings of the 51st Annual Meeting of the Association for Computational
Linguistics, {ACL} 2013, 4-9 August 2013, Sofia, Bulgaria, Volume
2: Short Papers},
pages = {467--473},
publisher = {The Association for Computer Linguistics},
year = {2013},
url = {https://aclanthology.org/P13-2083/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/GoyalJLSSH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aldt/ChalupskyDHKMMORWX13,
author = {Hans Chalupsky and
Robert DeMarco and
Eduard H. Hovy and
Paul B. Kantor and
Alisa Matlin and
Priyam Mitra and
Birnur Ozbas and
Fred S. Roberts and
James Wojtowicz and
Minge Xie},
editor = {Patrice Perny and
Marc Pirlot and
Alexis Tsouki{\`{a}}s},
title = {Estimating Violation Risk for Fisheries Regulations},
booktitle = {Algorithmic Decision Theory - Third International Conference, {ADT}
2013, Bruxelles, Belgium, November 12-14, 2013, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8176},
pages = {297--308},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-41575-3\_23},
doi = {10.1007/978-3-642-41575-3\_23},
timestamp = {Mon, 03 Jan 2022 22:21:02 +0100},
biburl = {https://dblp.org/rec/conf/aldt/ChalupskyDHKMMORWX13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/PenasHFRSM13,
author = {Anselmo Pe{\~{n}}as and
Eduard H. Hovy and
Pamela Forner and
{\'{A}}lvaro Rodrigo and
Richard F. E. Sutcliffe and
Roser Morante},
editor = {Pamela Forner and
Henning M{\"{u}}ller and
Roberto Paredes and
Paolo Rosso and
Benno Stein},
title = {{QA4MRE} 2011-2013: Overview of Question Answering for Machine Reading
Evaluation},
booktitle = {Information Access Evaluation. Multilinguality, Multimodality, and
Visualization - 4th International Conference of the {CLEF} Initiative,
{CLEF} 2013, Valencia, Spain, September 23-26, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {8138},
pages = {303--320},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-40802-1\_29},
doi = {10.1007/978-3-642-40802-1\_29},
timestamp = {Wed, 30 Oct 2019 15:47:55 +0100},
biburl = {https://dblp.org/rec/conf/clef/PenasHFRSM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/PenasMHFK13,
author = {Anselmo Pe{\~{n}}as and
Yusuke Miyao and
Eduard H. Hovy and
Pamela Forner and
Noriko Kando},
editor = {Pamela Forner and
Roberto Navigli and
Dan Tufis and
Nicola Ferro},
title = {Overview of {QA4MRE} 2013 Entrance Exams Task},
booktitle = {Working Notes for {CLEF} 2013 Conference , Valencia, Spain, September
23-26, 2013},
series = {{CEUR} Workshop Proceedings},
volume = {1179},
publisher = {CEUR-WS.org},
year = {2013},
url = {https://ceur-ws.org/Vol-1179/CLEF2013wn-QA4MRE-PenasEt2013.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:37 +0100},
biburl = {https://dblp.org/rec/conf/clef/PenasMHFK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/SutcliffePHFRFBO13,
author = {Richard F. E. Sutcliffe and
Anselmo Pe{\~{n}}as and
Eduard H. Hovy and
Pamela Forner and
{\'{A}}lvaro Rodrigo and
Corina Forascu and
Yassine Benajiba and
Petya Osenova},
editor = {Pamela Forner and
Roberto Navigli and
Dan Tufis and
Nicola Ferro},
title = {Overview of {QA4MRE} Main Task at {CLEF} 2013},
booktitle = {Working Notes for {CLEF} 2013 Conference , Valencia, Spain, September
23-26, 2013},
series = {{CEUR} Workshop Proceedings},
volume = {1179},
publisher = {CEUR-WS.org},
year = {2013},
url = {https://ceur-ws.org/Vol-1179/CLEF2013wn-QA4MRE-SutcliffeEt2013.pdf},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/clef/SutcliffePHFRFBO13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/SrivastavaHH13,
author = {Shashank Srivastava and
Dirk Hovy and
Eduard H. Hovy},
title = {A Walk-Based Semantically Enriched Tree Kernel Over Distributed Word
Representations},
booktitle = {Proceedings of the 2013 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2013, 18-21 October 2013, Grand Hyatt
Seattle, Seattle, Washington, USA, {A} meeting of SIGDAT, a Special
Interest Group of the {ACL}},
pages = {1411--1416},
publisher = {{ACL}},
year = {2013},
url = {https://aclanthology.org/D13-1144/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/SrivastavaHH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/JainH13,
author = {Siddharth Jain and
Eduard H. Hovy},
title = {Determining leadership in contentious discussions},
booktitle = {2013 {IEEE} International Conference on Multimedia and Expo Workshops,
San Jose, CA, USA, July 15-19, 2013},
pages = {1--6},
publisher = {{IEEE} Computer Society},
year = {2013},
url = {https://doi.org/10.1109/ICMEW.2013.6618370},
doi = {10.1109/ICMEW.2013.6618370},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icmcs/JainH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/interspeech/HovyAPVLHB13,
author = {Dirk Hovy and
Gopala Krishna Anumanchipalli and
Alok Parlikar and
Caroline Vaughn and
Adam C. Lammert and
Eduard H. Hovy and
Alan W. Black},
editor = {Fr{\'{e}}d{\'{e}}ric Bimbot and
Christophe Cerisara and
C{\'{e}}cile Fougeron and
Guillaume Gravier and
Lori Lamel and
Fran{\c{c}}ois Pellegrino and
Pascal Perrier},
title = {Analysis and modeling of "focus" in context},
booktitle = {{INTERSPEECH} 2013, 14th Annual Conference of the International Speech
Communication Association, Lyon, France, August 25-29, 2013},
pages = {402--406},
publisher = {{ISCA}},
year = {2013},
url = {https://doi.org/10.21437/Interspeech.2013-109},
doi = {10.21437/INTERSPEECH.2013-109},
timestamp = {Fri, 23 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/interspeech/HovyAPVLHB13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/HovyMVAP13,
author = {Eduard H. Hovy and
Teruko Mitamura and
Felisa Verdejo and
Jun Araki and
Andrew Philpot},
editor = {Eduard H. Hovy and
Teruko Mitamura and
Martha Palmer},
title = {Events are Not Simple: Identity, Non-Identity, and Quasi-Identity},
booktitle = {Workshop on Events: Definition, Detection, Coreference, and Representation,
EVENTS@NAACL-HLT 2013, Atlanta, Georgia, USA, June 14, 2013},
pages = {21--28},
publisher = {Association for Computational Linguistics},
year = {2013},
url = {https://aclanthology.org/W13-1203/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/HovyMVAP13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/HovyBVH13,
author = {Dirk Hovy and
Taylor Berg{-}Kirkpatrick and
Ashish Vaswani and
Eduard H. Hovy},
editor = {Lucy Vanderwende and
Hal Daum{\'{e}} III and
Katrin Kirchhoff},
title = {Learning Whom to Trust with {MACE}},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
9-14, 2013, Westin Peachtree Plaza Hotel, Atlanta, Georgia, {USA}},
pages = {1120--1130},
publisher = {The Association for Computational Linguistics},
year = {2013},
url = {https://aclanthology.org/N13-1132/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/HovyBVH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ranlp/Echizen-yaAH13,
author = {Hiroshi Echizen{-}ya and
Kenji Araki and
Eduard H. Hovy},
editor = {Galia Angelova and
Kalina Bontcheva and
Ruslan Mitkov},
title = {Automatic Evaluation Metric for Machine Translation that is Independent
of Sentence Length},
booktitle = {Recent Advances in Natural Language Processing, {RANLP} 2013, 9-11
September, 2013, Hissar, Bulgaria},
pages = {230--236},
publisher = {{RANLP} 2013 Organising Committee / {ACL}},
year = {2013},
url = {https://aclanthology.org/R13-1030/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ranlp/Echizen-yaAH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/SaqchanHH13,
author = {Mrinmaya Sachan and
Dirk Hovy and
Eduard H. Hovy},
editor = {Leslie Carr and
Alberto H. F. Laender and
Bernadette Farias L{\'{o}}scio and
Irwin King and
Marcus Fontoura and
Denny Vrandecic and
Lora Aroyo and
Jos{\'{e}} Palazzo M. de Oliveira and
Fernanda Lima and
Erik Wilde},
title = {Solving electrical networks to incorporate supervision in random walks},
booktitle = {22nd International World Wide Web Conference, {WWW} '13, Rio de Janeiro,
Brazil, May 13-17, 2013, Companion Volume},
pages = {109--110},
publisher = {International World Wide Web Conferences Steering Committee / {ACM}},
year = {2013},
url = {https://doi.org/10.1145/2487788.2487838},
doi = {10.1145/2487788.2487838},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/www/SaqchanHH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/tanlp/OltramariVQH13,
author = {Alessandro Oltramari and
Piek Vossen and
Lu Qin and
Eduard H. Hovy},
editor = {Alessandro Oltramari and
Piek Vossen and
Lu Qin and
Eduard H. Hovy},
title = {Introduction},
booktitle = {New Trends of Research in Ontologies and Lexical Resources, Ideas,
Projects, Systems},
series = {Theory and Applications of Natural Language Processing},
pages = {1--3},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-31782-8\_1},
doi = {10.1007/978-3-642-31782-8\_1},
timestamp = {Wed, 05 Jan 2022 14:22:10 +0100},
biburl = {https://dblp.org/rec/series/tanlp/OltramariVQH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/naacl/2013events,
editor = {Eduard H. Hovy and
Teruko Mitamura and
Martha Palmer},
title = {Workshop on Events: Definition, Detection, Coreference, and Representation,
EVENTS@NAACL-HLT 2013, Atlanta, Georgia, USA, June 14, 2013},
publisher = {Association for Computational Linguistics},
year = {2013},
url = {https://aclanthology.org/volumes/W13-12/},
isbn = {978-1-937284-47-3},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/2013events.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:series/tanlp/OVQH2013,
editor = {Alessandro Oltramari and
Piek Vossen and
Lu Qin and
Eduard H. Hovy},
title = {New Trends of Research in Ontologies and Lexical Resources, Ideas,
Projects, Systems},
series = {Theory and Applications of Natural Language Processing},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-31782-8},
doi = {10.1007/978-3-642-31782-8},
isbn = {978-3-642-31781-1},
timestamp = {Wed, 05 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/series/tanlp/OVQH2013.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scfbm/RamakrishnanPHB12,
author = {Cartic Ramakrishnan and
Abhishek Patnia and
Eduard H. Hovy and
Gully A. P. C. Burns},
title = {Layout-aware text extraction from full-text {PDF} of scientific articles},
journal = {Source Code Biol. Medicine},
volume = {7},
pages = {7},
year = {2012},
url = {https://doi.org/10.1186/1751-0473-7-7},
doi = {10.1186/1751-0473-7-7},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/scfbm/RamakrishnanPHB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/PenasHFRSSFBO12,
author = {Anselmo Pe{\~{n}}as and
Eduard H. Hovy and
Pamela Forner and
{\'{A}}lvaro Rodrigo and
Richard F. E. Sutcliffe and
Caroline Sporleder and
Corina Forascu and
Yassine Benajiba and
Petya Osenova},
editor = {Pamela Forner and
Jussi Karlgren and
Christa Womser{-}Hacker},
title = {Overview of {QA4MRE} at {CLEF} 2012: Question Answering for Machine
Reading Evaluation},
booktitle = {{CLEF} 2012 Evaluation Labs and Workshop, Online Working Notes, Rome,
Italy, September 17-20, 2012},
series = {{CEUR} Workshop Proceedings},
volume = {1178},
publisher = {CEUR-WS.org},
year = {2012},
url = {https://ceur-ws.org/Vol-1178/CLEF2012wn-QA4MRE-PenasEt2012.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:42 +0100},
biburl = {https://dblp.org/rec/conf/clef/PenasHFRSSFBO12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/WangCPLHM12,
author = {Hao Wang and
Congxing Cai and
Andrew Philpot and
Mark Latonero and
Eduard H. Hovy and
Donald Metzler},
editor = {John Carlo Bertot and
Luis F. Luna{-}Reyes and
Sehl Mellouli},
title = {Data integration from open internet sources to combat sex trafficking
of minors},
booktitle = {13th Annual International Conference on Digital Government Research,
dg.o 2012, College Park, MD, USA, June 4-7, 2012},
pages = {246--252},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2307729.2307769},
doi = {10.1145/2307729.2307769},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/WangCPLHM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/PenasHFRSFS12,
author = {Anselmo Pe{\~{n}}as and
Eduard H. Hovy and
Pamela Forner and
{\'{A}}lvaro Rodrigo and
Richard F. E. Sutcliffe and
Corina Forascu and
Caroline Sporleder},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Mehmet Ugur Dogan and
Bente Maegaard and
Joseph Mariani and
Jan Odijk and
Stelios Piperidis},
title = {Evaluating Machine Reading Systems through Comprehension Tests},
booktitle = {Proceedings of the Eighth International Conference on Language Resources
and Evaluation, {LREC} 2012, Istanbul, Turkey, May 23-25, 2012},
pages = {1143--1147},
publisher = {European Language Resources Association {(ELRA)}},
year = {2012},
url = {http://www.lrec-conf.org/proceedings/lrec2012/summaries/315.html},
timestamp = {Mon, 19 Aug 2019 14:40:54 +0200},
biburl = {https://dblp.org/rec/conf/lrec/PenasHFRSFS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/MetzlerCH12,
author = {Donald Metzler and
Congxing Cai and
Eduard H. Hovy},
title = {Structured Event Retrieval over Microblog Archives},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
3-8, 2012, Montr{\'{e}}al, Canada},
pages = {646--655},
publisher = {The Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/N12-1083/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/MetzlerCH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dagstuhl-reports/BuitelaarCCH12,
author = {Paul Buitelaar and
Key{-}Sun Choi and
Philipp Cimiano and
Eduard H. Hovy},
title = {The Multilingual Semantic Web (Dagstuhl Seminar 12362)},
journal = {Dagstuhl Reports},
volume = {2},
number = {9},
pages = {15--94},
year = {2012},
url = {https://doi.org/10.4230/DagRep.2.9.15},
doi = {10.4230/DAGREP.2.9.15},
timestamp = {Wed, 07 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dagstuhl-reports/BuitelaarCCH12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/RussRHBB11,
author = {Thomas A. Russ and
Cartic Ramakrishnan and
Eduard H. Hovy and
Mihail Bota and
Gully A. P. C. Burns},
title = {Knowledge Engineering Tools for Reasoning with Scientific Observations
and Interpretations: a Neural Connectivity Use Case},
journal = {{BMC} Bioinform.},
volume = {12},
pages = {351},
year = {2011},
url = {https://doi.org/10.1186/1471-2105-12-351},
doi = {10.1186/1471-2105-12-351},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/RussRHBB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dagstuhl-manifestos/BourneCDWHHS11,
author = {Philip E. Bourne and
Timothy W. Clark and
Robert Dale and
Anita de Waard and
Ivan Herman and
Eduard H. Hovy and
David M. Shotton},
title = {Improving The Future of Research Communications and e-Scholarship
(Dagstuhl Perspectives Workshop 11331)},
journal = {Dagstuhl Manifestos},
volume = {1},
number = {1},
pages = {41--60},
year = {2011},
url = {https://doi.org/10.4230/DagMan.1.1.41},
doi = {10.4230/DAGMAN.1.1.41},
timestamp = {Wed, 14 Jun 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/dagstuhl-manifestos/BourneCDWHHS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nle/RecasensH11,
author = {Marta Recasens and
Eduard H. Hovy},
title = {{BLANC:} Implementing the Rand index for coreference evaluation},
journal = {Nat. Lang. Eng.},
volume = {17},
number = {4},
pages = {485--510},
year = {2011},
url = {https://doi.org/10.1017/S135132491000029X},
doi = {10.1017/S135132491000029X},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nle/RecasensH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/Mulkar-MehtaHH11,
author = {Rutu Mulkar{-}Mehta and
Jerry R. Hobbs and
Eduard H. Hovy},
title = {Applications and Discovery of Granularity Structures in Natural Language
Discourse},
booktitle = {Logical Formalizations of Commonsense Reasoning, Papers from the 2011
{AAAI} Spring Symposium, Technical Report SS-11-06, Stanford, California,
USA, March 21-23, 2011},
publisher = {{AAAI}},
year = {2011},
url = {http://www.aaai.org/ocs/index.php/SSS/SSS11/paper/view/2394},
timestamp = {Mon, 13 Feb 2012 17:07:39 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/Mulkar-MehtaHH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HovyVTCH11,
author = {Dirk Hovy and
Ashish Vaswani and
Stephen Tratz and
David Chiang and
Eduard H. Hovy},
title = {Models and Training for Unsupervised Preposition Sense Disambiguation},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA} - Short Papers},
pages = {323--328},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-2056/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HovyVTCH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/MetzlerHZ11,
author = {Donald Metzler and
Eduard H. Hovy and
Chunliang Zhang},
title = {An Empirical Evaluation of Data-Driven Paraphrase Generation Techniques},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA} - Short Papers},
pages = {546--551},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-2096/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/MetzlerHZ11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HovyZHP11,
author = {Dirk Hovy and
Chunliang Zhang and
Eduard H. Hovy and
Anselmo Pe{\~{n}}as},
editor = {Dekang Lin and
Yuji Matsumoto and
Rada Mihalcea},
title = {Unsupervised Discovery of Domain-Specific Knowledge from Text},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA}},
pages = {1466--1475},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-1147/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HovyZHP11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/KozarevaH11,
author = {Zornitsa Kozareva and
Eduard H. Hovy},
editor = {Dekang Lin and
Yuji Matsumoto and
Rada Mihalcea},
title = {Insights from Network Structure for Text Mining},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA}},
pages = {1616--1625},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-1162/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/KozarevaH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/PokkunuriRRHB11,
author = {Sandeep Pokkunuri and
Cartic Ramakrishnan and
Ellen Riloff and
Eduard H. Hovy and
Gully Burns},
editor = {Kevin Bretonnel Cohen and
Dina Demner{-}Fushman and
Sophia Ananiadou and
John Pestian and
Jun'ichi Tsujii and
Bonnie L. Webber},
title = {The Role of Information Extraction in the Design of a Document Triage
Application for Biocuration},
booktitle = {Proceedings of the 2011 Workshop on Biomedical Natural Language Processing,
BioNLP@ACL, Portland, Oregon, USA, June 23-24, 2011},
pages = {46--55},
publisher = {Association for Computational Linguistics},
year = {2011},
url = {https://aclanthology.org/W11-0206/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bionlp/PokkunuriRRHB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/PenasHFRSFS11,
author = {Anselmo Pe{\~{n}}as and
Eduard H. Hovy and
Pamela Forner and
{\'{A}}lvaro Rodrigo and
Richard F. E. Sutcliffe and
Corina Forascu and
Caroline Sporleder},
editor = {Vivien Petras and
Pamela Forner and
Paul D. Clough},
title = {Overview of {QA4MRE} at {CLEF} 2011: Question Answering for Machine
Reading Evaluation},
booktitle = {{CLEF} 2011 Labs and Workshop, Notebook Papers, 19-22 September 2011,
Amsterdam, The Netherlands},
series = {{CEUR} Workshop Proceedings},
volume = {1177},
publisher = {CEUR-WS.org},
year = {2011},
url = {https://ceur-ws.org/Vol-1177/CLEF2011wn-QA4MRE-PenasEt2011.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:36 +0100},
biburl = {https://dblp.org/rec/conf/clef/PenasHFRSFS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/comgeo/CaiH11,
author = {Congxing Cai and
Eduard H. Hovy},
editor = {Lindi Liao},
title = {Summarizing textual information about locations},
booktitle = {Proceedings of the 2nd International Conference and Exhibition on
Computing for Geospatial Research {\&} Application, COM.Geo 2011,
Washington, DC, USA, May 23-25, 2011},
series = {{ACM} International Conference Proceeding Series},
pages = {8:1--8:9},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1999320.1999328},
doi = {10.1145/1999320.1999328},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/comgeo/CaiH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/GouwsHM11,
author = {Stephan Gouws and
Eduard H. Hovy and
Donald Metzler},
editor = {Omri Abend and
Anna Korhonen and
Ari Rappoport and
Roi Reichart},
title = {Unsupervised Mining of Lexical Variants from Noisy Text},
booktitle = {Proceedings of the First workshop on Unsupervised Learning in NLP@EMNLP
2011, Edinburgh, Scotland, July 30, 2011},
pages = {82--90},
publisher = {Association for Computational Linguistics},
year = {2011},
url = {https://aclanthology.org/W11-2210/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/GouwsHM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/TratzH11,
author = {Stephen Tratz and
Eduard H. Hovy},
title = {A Fast, Accurate, Non-Projective, Semantically-Enriched Parser},
booktitle = {Proceedings of the 2011 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2011, 27-31 July 2011, John McIntyre
Conference Centre, Edinburgh, UK, {A} meeting of SIGDAT, a Special
Interest Group of the {ACL}},
pages = {1257--1268},
publisher = {{ACL}},
year = {2011},
url = {https://aclanthology.org/D11-1116/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/TratzH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/Mulkar-MehtaWHH11,
author = {Rutu Mulkar{-}Mehta and
Christopher A. Welty and
Jerry R. Hobbs and
Eduard H. Hovy},
editor = {R. Charles Murray and
Philip M. McCarthy},
title = {Using Part-Of Relations for Discovering Causality},
booktitle = {Proceedings of the Twenty-Fourth International Florida Artificial
Intelligence Research Society Conference, May 18-20, 2011, Palm Beach,
Florida, {USA}},
publisher = {{AAAI} Press},
year = {2011},
url = {http://aaai.org/ocs/index.php/FLAIRS/FLAIRS11/paper/view/2511},
timestamp = {Wed, 26 Oct 2022 08:35:19 +0200},
biburl = {https://dblp.org/rec/conf/flairs/Mulkar-MehtaWHH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwcs/Hovy11,
author = {Eduard H. Hovy},
editor = {Johan Bos and
Stephen Pulman},
title = {A New Semantics: Merging Propositional and Distributional Information},
booktitle = {Proceedings of the Ninth International Conference on Computational
Semantics, {IWCS} 2011, January 12-14, 2011, Oxford, {UK}},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/W11-0102/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwcs/Hovy11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwcs/Mulkar-MehtaHH11,
author = {Rutu Mulkar{-}Mehta and
Jerry R. Hobbs and
Eduard H. Hovy},
editor = {Johan Bos and
Stephen Pulman},
title = {Granularity in Natural Language Discourse},
booktitle = {Proceedings of the Ninth International Conference on Computational
Semantics, {IWCS} 2011, January 12-14, 2011, Oxford, {UK}},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/W11-0143/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwcs/Mulkar-MehtaHH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/Mulkar-MehtaGHH11,
author = {Rutu Mulkar{-}Mehta and
Andrew S. Gordon and
Jerry R. Hobbs and
Eduard H. Hovy},
editor = {Mark A. Musen and
{\'{O}}scar Corcho},
title = {Causal markers across domains and genres of discourse},
booktitle = {Proceedings of the 6th International Conference on Knowledge Capture
{(K-CAP} 2011), June 26-29, 2011, Banff, Alberta, Canada},
pages = {183--184},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1999676.1999716},
doi = {10.1145/1999676.1999716},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kcap/Mulkar-MehtaGHH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlslp/Hovy11,
author = {Eduard H. Hovy},
title = {On the role of machine learning in {NLP}},
booktitle = {2011 Symposium on Machine Learning in Speech and Language Processing,
{MLSLP} 2011, Bellevue, WA, USA, June 27, 2011},
publisher = {{ISCA}},
year = {2011},
url = {http://www.isca-speech.org/archive/mlslp\_2011/ml11\_103.html},
timestamp = {Tue, 16 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mlslp/Hovy11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semco/KozarevaH11,
author = {Zornitsa Kozareva and
Eduard H. Hovy},
title = {Learning Temporal Information for States and Events},
booktitle = {Proceedings of the 5th {IEEE} International Conference on Semantic
Computing {(ICSC} 2011), Palo Alto, CA, USA, September 18-21, 2011},
pages = {424--429},
publisher = {{IEEE} Computer Society},
year = {2011},
url = {https://doi.org/10.1109/ICSC.2011.94},
doi = {10.1109/ICSC.2011.94},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/semco/KozarevaH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/tanlp/HovyOR11,
author = {Eduard H. Hovy and
Jon Oberlander and
Norbert Reithinger},
editor = {Antal van den Bosch and
Gosse Bouma},
title = {{IMIX:} Good Questions, Promising Answers},
booktitle = {Interactive Multi-modal Question-Answering},
pages = {271--279},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-17525-1\_12},
doi = {10.1007/978-3-642-17525-1\_12},
timestamp = {Sun, 02 Jun 2019 20:42:26 +0200},
biburl = {https://dblp.org/rec/series/tanlp/HovyOR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/TanZWH11,
author = {Yongmei Tan and
Junyu Zeng and
Xiaojie Wang and
Eduard H. Hovy},
title = {BUPTTeam Participation at {TAC} 2011 Recognizing Textual Entailment},
booktitle = {Proceedings of the Fourth Text Analysis Conference, {TAC} 2011, Gaithersburg,
Maryland, USA, November 14-15, 2011},
publisher = {{NIST}},
year = {2011},
url = {https://tac.nist.gov/publications/2011/participant.papers/BUPTTeam.proceedings.pdf},
timestamp = {Tue, 13 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/tac/TanZWH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dagstuhl-reports/ClarkWHH11,
author = {Tim Clark and
Anita de Waard and
Ivan Herman and
Eduard H. Hovy},
title = {The Future of Research Communication (Dagstuhl Perspectives Workshop
11331)},
journal = {Dagstuhl Reports},
volume = {1},
number = {8},
pages = {29--52},
year = {2011},
url = {https://doi.org/10.4230/DagRep.1.8.29},
doi = {10.4230/DAGREP.1.8.29},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/dagstuhl-reports/ClarkWHH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/YuWCLH10,
author = {Liang{-}Chih Yu and
Chung{-}Hsien Wu and
Ru{-}Yng Chang and
Chao{-}Hong Liu and
Eduard H. Hovy},
title = {Annotation and verification of sense pools in OntoNotes},
journal = {Inf. Process. Manag.},
volume = {46},
number = {4},
pages = {436--447},
year = {2010},
url = {https://doi.org/10.1016/j.ipm.2009.11.002},
doi = {10.1016/J.IPM.2009.11.002},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/YuWCLH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nle/DorrPFGHHHLMMRS10,
author = {Bonnie J. Dorr and
Rebecca J. Passonneau and
David Farwell and
Rebecca Green and
Nizar Habash and
Stephen Helmreich and
Eduard H. Hovy and
Lori S. Levin and
Keith J. Miller and
Teruko Mitamura and
Owen Rambow and
Advaith Siddharthan},
title = {Interlingual annotation of parallel text corpora: a new framework
for annotation and evaluation},
journal = {Nat. Lang. Eng.},
volume = {16},
number = {3},
pages = {197--243},
year = {2010},
url = {https://doi.org/10.1017/S1351324910000070},
doi = {10.1017/S1351324910000070},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nle/DorrPFGHHHLMMRS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/polity/ChunSSH10,
author = {Soon Ae Chun and
Stuart W. Shulman and
Rodrigo Sandoval and
Eduard H. Hovy},
title = {Government 2.0: Making connections between citizens, data and government},
journal = {Inf. Polity},
volume = {15},
number = {1-2},
pages = {1--9},
year = {2010},
url = {https://doi.org/10.3233/IP-2010-0205},
doi = {10.3233/IP-2010-0205},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/polity/ChunSSH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tslp/ZhuWHM10,
author = {Jingbo Zhu and
Huizhen Wang and
Eduard H. Hovy and
Matthew Y. Ma},
title = {Confidence-based stopping criteria for active learning for data annotation},
journal = {{ACM} Trans. Speech Lang. Process.},
volume = {6},
number = {3},
pages = {3:1--3:24},
year = {2010},
url = {https://doi.org/10.1145/1753783.1753784},
doi = {10.1145/1753783.1753784},
timestamp = {Wed, 25 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/tslp/ZhuWHM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ws/HovyS10,
author = {Eduard H. Hovy and
Susie Stephens},
title = {Introduction to the Special Issue},
journal = {J. Web Semant.},
volume = {8},
number = {2-3},
pages = {143--144},
year = {2010},
url = {https://doi.org/10.1016/j.websem.2010.04.003},
doi = {10.1016/J.WEBSEM.2010.04.003},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ws/HovyS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Hovy10,
author = {Eduard H. Hovy},
editor = {Roser Morante and
Caroline Sporleder},
title = {Negation and modality in distributional semantics},
booktitle = {Proceedings of the Workshop on Negation and Speculation in Natural
Language Processing, NeSp-NLP@ACL 2010, Uppsala, Sweden, July 10,
2010},
pages = {50},
publisher = {University of Antwerp},
year = {2010},
url = {https://aclanthology.org/W10-3109/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Hovy10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/TratzH10,
author = {Stephen Tratz and
Eduard H. Hovy},
editor = {Jan Hajic and
Sandra Carberry and
Stephen Clark},
title = {A Taxonomy, Dataset, and Classifier for Automatic Noun Compound Interpretation},
booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association
for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden},
pages = {678--687},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/P10-1070/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/TratzH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RecasensH10,
author = {Marta Recasens and
Eduard H. Hovy},
editor = {Jan Hajic and
Sandra Carberry and
Stephen Clark},
title = {Coreference Resolution across Corpora: Languages, Coding Schemes,
and Preprocessing Information},
booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association
for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden},
pages = {1423--1432},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/P10-1144/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RecasensH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/KozarevaH10,
author = {Zornitsa Kozareva and
Eduard H. Hovy},
editor = {Jan Hajic and
Sandra Carberry and
Stephen Clark},
title = {Learning Arguments and Supertypes of Semantic Relations Using Recursive
Patterns},
booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association
for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden},
pages = {1482--1491},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/P10-1150/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/KozarevaH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/RodrigoPHP10,
author = {{\'{A}}lvaro Rodrigo and
Anselmo Pe{\~{n}}as and
Eduard H. Hovy and
Emanuele Pianta},
editor = {Martin Braschler and
Donna Harman and
Emanuele Pianta},
title = {Question Answering for Machine Reading Evaluation},
booktitle = {{CLEF} 2010 LABs and Workshops, Notebook Papers, 22-23 September 2010,
Padua, Italy},
series = {{CEUR} Workshop Proceedings},
volume = {1176},
publisher = {CEUR-WS.org},
year = {2010},
url = {https://ceur-ws.org/Vol-1176/CLEF2010wn-MLQA10-RodrigoEt2010.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:37 +0100},
biburl = {https://dblp.org/rec/conf/clef/RodrigoPHP10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/HovyTH10,
author = {Dirk Hovy and
Stephen Tratz and
Eduard H. Hovy},
editor = {Chu{-}Ren Huang and
Dan Jurafsky},
title = {What's in a Preposition? Dimensions of Sense Disambiguation for an
Interesting Word Class},
booktitle = {{COLING} 2010, 23rd International Conference on Computational Linguistics,
Posters Volume, 23-27 August 2010, Beijing, China},
pages = {454--462},
publisher = {Chinese Information Processing Society of China},
year = {2010},
url = {https://aclanthology.org/C10-2052/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/HovyTH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/PenasH10,
author = {Anselmo Pe{\~{n}}as and
Eduard H. Hovy},
editor = {Chu{-}Ren Huang and
Dan Jurafsky},
title = {Filling Knowledge Gaps in Text for Machine Reading},
booktitle = {{COLING} 2010, 23rd International Conference on Computational Linguistics,
Posters Volume, 23-27 August 2010, Beijing, China},
pages = {979--987},
publisher = {Chinese Information Processing Society of China},
year = {2010},
url = {https://aclanthology.org/C10-2113/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/PenasH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KozarevaH10,
author = {Zornitsa Kozareva and
Eduard H. Hovy},
title = {A Semi-Supervised Method to Learn and Construct Taxonomies Using the
Web},
booktitle = {Proceedings of the 2010 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2010, 9-11 October 2010, {MIT} Stata
Center, Massachusetts, USA, {A} meeting of SIGDAT, a Special Interest
Group of the {ACL}},
pages = {1110--1118},
publisher = {{ACL}},
year = {2010},
url = {https://aclanthology.org/D10-1108/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/KozarevaH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/RecasensHM10,
author = {Marta Recasens and
Eduard H. Hovy and
Maria Ant{\`{o}}nia Mart{\'{\i}}},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Bente Maegaard and
Joseph Mariani and
Jan Odijk and
Stelios Piperidis and
Mike Rosner and
Daniel Tapias},
title = {A Typology of Near-Identity Relations for Coreference {(NIDENT)}},
booktitle = {Proceedings of the International Conference on Language Resources
and Evaluation, {LREC} 2010, 17-23 May 2010, Valletta, Malta},
publisher = {European Language Resources Association},
year = {2010},
url = {http://www.lrec-conf.org/proceedings/lrec2010/summaries/160.html},
timestamp = {Mon, 19 Aug 2019 15:22:48 +0200},
biburl = {https://dblp.org/rec/conf/lrec/RecasensHM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/CaiH10,
author = {Congxing Cai and
Eduard H. Hovy},
editor = {Carolyn Penstein Ros{\'{e}}},
title = {Summarizing Textual Information about Locations In a Geo-Spatial Information
Display System},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
2, 2010, Los Angeles, California, {USA} - Demonstration Session},
pages = {5--8},
publisher = {The Association for Computational Linguistics},
year = {2010},
url = {https://aclanthology.org/N10-2002/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/CaiH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/KozarevaH10,
author = {Zornitsa Kozareva and
Eduard H. Hovy},
title = {Not All Seeds Are Equal: Measuring the Quality of Text Mining Seeds},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
2-4, 2010, Los Angeles, California, {USA}},
pages = {618--626},
publisher = {The Association for Computational Linguistics},
year = {2010},
url = {https://aclanthology.org/N10-1087/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/KozarevaH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semeval/TratzH10,
author = {Stephen Tratz and
Eduard H. Hovy},
editor = {Katrin Erk and
Carlo Strapparava},
title = {{ISI:} Automatic Classification of Relations Between Nominals Using
a Maximum Entropy Classifier},
booktitle = {Proceedings of the 5th International Workshop on Semantic Evaluation,
SemEval@ACL 2010, Uppsala University, Uppsala, Sweden, July 15-16,
2010},
pages = {222--225},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/S10-1049/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/semeval/TratzH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaifs/MarcoWH09,
author = {Chrysanne Di Marco and
David Wiljer and
Eduard H. Hovy},
title = {Self-Managed Access to Personalized Healthcare through Automated Generation
of Tailored Health Educational Materials from Electronic Health Records},
booktitle = {Virtual Healthcare Interaction, Papers from the 2009 {AAAI} Fall Symposium,
Arlington, Virginia, USA, November 5-7, 2009},
series = {{AAAI} Technical Report},
volume = {{FS-09-07}},
publisher = {{AAAI}},
year = {2009},
url = {http://aaai.org/ocs/index.php/FSS/FSS09/paper/view/959},
timestamp = {Wed, 29 Mar 2017 16:45:25 +0200},
biburl = {https://dblp.org/rec/conf/aaaifs/MarcoWH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/KozarevaHR09,
author = {Zornitsa Kozareva and
Eduard H. Hovy and
Ellen Riloff},
title = {Learning and Evaluating the Content and Structure of a Term Taxonomy},
booktitle = {Learning by Reading and Learning to Read, Papers from the 2009 {AAAI}
Spring Symposium, Technical Report SS-09-07, Stanford, California,
USA, March 23-25, 2009},
pages = {50--57},
publisher = {{AAAI}},
year = {2009},
url = {http://www.aaai.org/Library/Symposia/Spring/2009/ss09-07-009.php},
timestamp = {Sat, 18 Feb 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/KozarevaHR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/daarc/RecasensH09,
author = {Marta Recasens and
Eduard H. Hovy},
editor = {Sobha Lalitha Devi and
Ant{\'{o}}nio Horta Branco and
Ruslan Mitkov},
title = {A Deeper Look into Features for Coreference Resolution},
booktitle = {Anaphora Processing and Applications, 7th Discourse Anaphora and Anaphor
Resolution Colloquium, {DAARC} 2009, Goa, India, November 5-6, 2009,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5847},
pages = {29--42},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-04975-0\_3},
doi = {10.1007/978-3-642-04975-0\_3},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/daarc/RecasensH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/HovyKR09,
author = {Eduard H. Hovy and
Zornitsa Kozareva and
Ellen Riloff},
title = {Toward Completeness in Concept Extraction and Classification},
booktitle = {Proceedings of the 2009 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2009, 6-7 August 2009, Singapore, {A}
meeting of SIGDAT, a Special Interest Group of the {ACL}},
pages = {948--957},
publisher = {{ACL}},
year = {2009},
url = {https://aclanthology.org/D09-1099/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/HovyKR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/BhagatHP09,
author = {Rahul Bhagat and
Eduard H. Hovy and
Siddharth Patwardhan},
editor = {Yolanda Gil and
Natasha Fridman Noy},
title = {Acquiring paraphrases from text corpora},
booktitle = {Proceedings of the 5th International Conference on Knowledge Capture
{(K-CAP} 2009), September 1-4, 2009, Redondo Beach, California, {USA}},
pages = {161--168},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1597735.1597764},
doi = {10.1145/1597735.1597764},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kcap/BhagatHP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nldb/Hovy09,
author = {Eduard H. Hovy},
editor = {Helmut Horacek and
Elisabeth M{\'{e}}tais and
Rafael Mu{\~{n}}oz and
Magdalena Wolska},
title = {Turning the Web into a Database: Extracting Data and Structure},
booktitle = {Natural Language Processing and Information Systems, 14th International
Conference on Applications of Natural Language to Information Systems,
{NLDB} 2009, Saarbr{\"{u}}cken, Germany, June 24-26, 2009. Revised
Papers},
series = {Lecture Notes in Computer Science},
volume = {5723},
pages = {1--7},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-12550-8\_1},
doi = {10.1007/978-3-642-12550-8\_1},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/nldb/Hovy09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/TratzH09,
author = {Stephen Tratz and
Eduard H. Hovy},
title = {BEwT-E for {TAC} 2009's {AESOP} Task},
booktitle = {Proceedings of the Second Text Analysis Conference, {TAC} 2009, Gaithersburg,
Maryland, USA, November 16-17, 2009},
publisher = {{NIST}},
year = {2009},
url = {https://tac.nist.gov/publications/2009/participant.papers/ISI.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 13:25:17 +0200},
biburl = {https://dblp.org/rec/conf/tac/TratzH09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijclclp/YuWYH08,
author = {Liang{-}Chih Yu and
Chung{-}Hsien Wu and
Jui{-}Feng Yeh and
Eduard H. Hovy},
title = {Corpus Cleanup of Mistaken Agreement Using Word Sense Disambiguation},
journal = {Int. J. Comput. Linguistics Chin. Lang. Process.},
volume = {13},
number = {4},
year = {2008},
url = {http://www.aclclp.org.tw/clclp/v13n4/v13n4a2.pdf},
timestamp = {Thu, 18 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijclclp/YuWYH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/KozarevaRH08,
author = {Zornitsa Kozareva and
Ellen Riloff and
Eduard H. Hovy},
editor = {Kathleen R. McKeown and
Johanna D. Moore and
Simone Teufel and
James Allan and
Sadaoki Furui},
title = {Semantic Class Learning from the Web with Hyponym Pattern Linkage
Graphs},
booktitle = {{ACL} 2008, Proceedings of the 46th Annual Meeting of the Association
for Computational Linguistics, June 15-20, 2008, Columbus, Ohio, {USA}},
pages = {1048--1056},
publisher = {The Association for Computer Linguistics},
year = {2008},
url = {https://aclanthology.org/P08-1119/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/KozarevaRH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/FengBH08,
author = {Donghui Feng and
Gully Burns and
Eduard H. Hovy},
editor = {Dina Demner{-}Fushman and
Sophia Ananiadou and
Kevin Bretonnel Cohen and
John Pestian and
Jun'ichi Tsujii and
Bonnie L. Webber},
title = {Adaptive Information Extraction for Complex Biomedical Tasks},
booktitle = {Proceedings of the Workshop on Current Trends in Biomedical Natural
Language Processing, BioNLP 2008, Columbus, Ohio, USA, June 19, 2008},
pages = {120--121},
publisher = {Association for Computational Linguistics},
year = {2008},
url = {https://aclanthology.org/W08-0628/},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bionlp/FengBH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/YuWH08,
author = {Liang{-}Chih Yu and
Chung{-}Hsien Wu and
Eduard H. Hovy},
editor = {Donia Scott and
Hans Uszkoreit},
title = {OntoNotes: Corpus Cleanup of Mistaken Agreement Using Word Sense Disambiguation},
booktitle = {{COLING} 2008, 22nd International Conference on Computational Linguistics,
Proceedings of the Conference, 18-22 August 2008, Manchester, {UK}},
pages = {1057--1064},
year = {2008},
url = {https://aclanthology.org/C08-1133/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/YuWH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/ZhuWH08,
author = {Jingbo Zhu and
Huizhen Wang and
Eduard H. Hovy},
editor = {Donia Scott and
Hans Uszkoreit},
title = {Multi-Criteria-Based Strategy to Stop Active Learning for Data Annotation},
booktitle = {{COLING} 2008, 22nd International Conference on Computational Linguistics,
Proceedings of the Conference, 18-22 August 2008, Manchester, {UK}},
pages = {1129--1136},
year = {2008},
url = {https://aclanthology.org/C08-1142/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/ZhuWH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hicss/ShulmanKHH08,
author = {Stuart W. Shulman and
Namhee Kwon and
Eduard H. Hovy and
Emily Huisman},
title = {Tools for Rules: Technology Transfer and Electronic Rulemaking},
booktitle = {41st Hawaii International International Conference on Systems Science
{(HICSS-41} 2008), Proceedings, 7-10 January 2008, Waikoloa, Big Island,
HI, {USA}},
pages = {200},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HICSS.2008.454},
doi = {10.1109/HICSS.2008.454},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hicss/ShulmanKHH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/ZhuWH08,
author = {Jingbo Zhu and
Huizhen Wang and
Eduard H. Hovy},
title = {Learning a Stopping Criterion for Active Learning for Word Sense Disambiguation
and Text Classification},
booktitle = {Third International Joint Conference on Natural Language Processing,
{IJCNLP} 2008, Hyderabad, India, January 7-12, 2008},
pages = {366--372},
publisher = {The Association for Computer Linguistics},
year = {2008},
url = {https://aclanthology.org/I08-1048/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/ZhuWH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/FengBZH08,
author = {Donghui Feng and
Gully Burns and
Jingbo Zhu and
Eduard H. Hovy},
title = {Towards Automated Semantic Analysis on Biomedical Research Articles},
booktitle = {Third International Joint Conference on Natural Language Processing,
{IJCNLP} 2008, Hyderabad, India, January 7-12, 2008},
pages = {871--876},
publisher = {The Association for Computer Linguistics},
year = {2008},
url = {https://aclanthology.org/I08-2124/},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcnlp/FengBZH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/HartholtRTHR08,
author = {Arno Hartholt and
Thomas A. Russ and
David R. Traum and
Eduard H. Hovy and
Susan Robinson},
title = {A Common Ground for Virtual Humans: Using an Ontology in a Natural
Language Oriented Virtual Human Architecture},
booktitle = {Proceedings of the International Conference on Language Resources
and Evaluation, {LREC} 2008, 26 May - 1 June 2008, Marrakech, Morocco},
publisher = {European Language Resources Association},
year = {2008},
url = {http://www.lrec-conf.org/proceedings/lrec2008/summaries/811.html},
timestamp = {Mon, 19 Aug 2019 15:22:28 +0200},
biburl = {https://dblp.org/rec/conf/lrec/HartholtRTHR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sofsem/ShinHM08,
author = {Hyun Woong Shin and
Eduard H. Hovy and
Dennis McLeod},
editor = {Viliam Geffert and
Juhani Karhum{\"{a}}ki and
Alberto Bertoni and
Bart Preneel and
Pavol N{\'{a}}vrat and
M{\'{a}}ria Bielikov{\'{a}}},
title = {The Dynamic Web Presentations with a Generality Model on the News
Domain},
booktitle = {{SOFSEM} 2008: Theory and Practice of Computer Science, 34th Conference
on Current Trends in Theory and Practice of Computer Science, Nov{\'{y}}
Smokovec, Slovakia, January 19-25, 2008, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4910},
pages = {755--765},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-77566-9\_65},
doi = {10.1007/978-3-540-77566-9\_65},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/sofsem/ShinHM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/08/Hovy08,
author = {Eduard H. Hovy},
editor = {Hsinchun Chen and
Lawrence Brandt and
Valerie Gregg and
Roland Traunm{\"{u}}ller and
Sharon S. Dawes and
Eduard H. Hovy and
Ann Macintosh and
Catherine A. Larson},
title = {An Outline for the Foundations of Digital Government Research},
booktitle = {Digital Government: E-Government Research, Case Studies, and Implementation},
series = {Integrated Series In Information Systems},
volume = {17},
pages = {43--59},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-0-387-71611-4\_3},
doi = {10.1007/978-0-387-71611-4\_3},
timestamp = {Tue, 23 Jul 2019 18:38:58 +0200},
biburl = {https://dblp.org/rec/books/sp/08/Hovy08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/08/Hovy08a,
author = {Eduard H. Hovy},
editor = {Hsinchun Chen and
Lawrence Brandt and
Valerie Gregg and
Roland Traunm{\"{u}}ller and
Sharon S. Dawes and
Eduard H. Hovy and
Ann Macintosh and
Catherine A. Larson},
title = {Data and Knowledge Integration for e-Government},
booktitle = {Digital Government: E-Government Research, Case Studies, and Implementation},
series = {Integrated Series In Information Systems},
volume = {17},
pages = {219--231},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-0-387-71611-4\_12},
doi = {10.1007/978-0-387-71611-4\_12},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/08/Hovy08a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/BurnsFH08,
author = {Gully Burns and
Donghui Feng and
Eduard H. Hovy},
editor = {Arpad Kelemen and
Ajith Abraham and
Yulan Liang},
title = {Intelligent Approaches to Mining the Primary Research Literature:
Techniques, Systems, and Examples},
booktitle = {Computational Intelligence in Medical Informatics},
series = {Studies in Computational Intelligence},
volume = {85},
pages = {17--50},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-75767-2\_2},
doi = {10.1007/978-3-540-75767-2\_2},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/series/sci/BurnsFH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/08/CBGTDHM2008,
editor = {Hsinchun Chen and
Lawrence Brandt and
Valerie Gregg and
Roland Traunm{\"{u}}ller and
Sharon S. Dawes and
Eduard H. Hovy and
Ann Macintosh and
Catherine A. Larson},
title = {Digital Government: E-Government Research, Case Studies, and Implementation},
series = {Integrated Series In Information Systems},
volume = {17},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-0-387-71611-4},
doi = {10.1007/978-0-387-71611-4},
isbn = {978-0-387-71610-7},
timestamp = {Tue, 23 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/08/CBGTDHM2008.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tac/TratzH08,
author = {Stephen Tratz and
Eduard H. Hovy},
title = {Summarization Evaluation Using Transformed Basic Elements},
booktitle = {Proceedings of the First Text Analysis Conference, {TAC} 2008, Gaithersburg,
Maryland, USA, November 17-19, 2008},
publisher = {{NIST}},
year = {2008},
url = {https://tac.nist.gov/publications/2008/additional.papers/ISI.proceedings.pdf},
timestamp = {Tue, 20 Aug 2019 13:25:18 +0200},
biburl = {https://dblp.org/rec/conf/tac/TratzH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsc/PradhanHMPRW07,
author = {Sameer S. Pradhan and
Eduard H. Hovy and
Mitchell P. Marcus and
Martha Palmer and
Lance A. Ramshaw and
Ralph M. Weischedel},
title = {Ontonotes: a Unified Relational Semantic Representation},
journal = {Int. J. Semantic Comput.},
volume = {1},
number = {4},
pages = {405--419},
year = {2007},
url = {https://doi.org/10.1142/S1793351X07000251},
doi = {10.1142/S1793351X07000251},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ijsc/PradhanHMPRW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEscc/BurnsFIH07,
author = {Gully Burns and
Donghui Feng and
Tommy Ingulfsen and
Eduard H. Hovy},
title = {Infrastructure for Annotation-Driven Information Extraction from the
Primary Scientific Literature: Principles and Practice},
booktitle = {2007 {IEEE} International Conference on Services Computing - Workshops
{(SCW} 2007), 9-13 July 2007, Salt Lake City, Utah, {USA}},
pages = {122--129},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/SERVICES.2007.34},
doi = {10.1109/SERVICES.2007.34},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/IEEEscc/BurnsFIH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/BarkerACFFGHHIKMPPTY07,
author = {Ken Barker and
Bhalchandra Agashe and
Shaw Yi Chaw and
James Fan and
Noah S. Friedland and
Michael Robert Glass and
Jerry R. Hobbs and
Eduard H. Hovy and
David J. Israel and
Doo Soon Kim and
Rutu Mulkar{-}Mehta and
Sourabh Patwardhan and
Bruce W. Porter and
Dan Tecuci and
Peter Z. Yeh},
title = {Learning by Reading: {A} Prototype System, Performance Baseline and
Lessons Learned},
booktitle = {Proceedings of the Twenty-Second {AAAI} Conference on Artificial Intelligence,
July 22-26, 2007, Vancouver, British Columbia, Canada},
pages = {280--286},
publisher = {{AAAI} Press},
year = {2007},
url = {http://www.aaai.org/Library/AAAI/2007/aaai07-043.php},
timestamp = {Tue, 05 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/BarkerACFFGHHIKMPPTY07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/MulkarHH07,
author = {Rutu Mulkar and
Jerry R. Hobbs and
Eduard H. Hovy},
title = {Learning from Reading Syntactically Complex Biology Texts},
booktitle = {Logical Formalizations of Commonsense Reasoning, Papers from the 2007
{AAAI} Spring Symposium, Technical Report SS-07-05, Stanford, California,
USA, March 26-28, 2007},
pages = {132--137},
publisher = {{AAAI}},
year = {2007},
url = {http://www.aaai.org/Library/Symposia/Spring/2007/ss07-05-023.php},
timestamp = {Fri, 17 Feb 2012 14:14:44 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/MulkarHH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/YuWLHL07,
author = {Liang{-}Chih Yu and
Chung{-}Hsien Wu and
Chin{-}Yew Lin and
Eduard H. Hovy and
Chia{-}Ling Lin},
editor = {John Carroll and
Antal van den Bosch and
Annie Zaenen},
title = {Topic Analysis for Psychiatric Document Retrieval},
booktitle = {{ACL} 2007, Proceedings of the 45th Annual Meeting of the Association
for Computational Linguistics, June 23-30, 2007, Prague, Czech Republic},
publisher = {The Association for Computational Linguistics},
year = {2007},
url = {https://aclanthology.org/P07-1129/},
timestamp = {Wed, 29 Mar 2023 13:06:50 +0200},
biburl = {https://dblp.org/rec/conf/acl/YuWLHL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/KwonZHS07,
author = {Namhee Kwon and
Liang Zhou and
Eduard H. Hovy and
Stuart W. Shulman},
editor = {Judith Bayard Cushing and
Theresa A. Pardo},
title = {Identifying and classifying subjective claims},
booktitle = {Proceedings of the 8th Annual International Conference on Digital
Government Research, Bridging Disciplines {\&} Domains, {DG.O}
2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007},
series = {{ACM} International Conference Proceeding Series},
volume = {228},
pages = {76--81},
publisher = {Digital Government Research Center},
year = {2007},
url = {http://dl.acm.org/citation.cfm?id=1248473},
timestamp = {Fri, 20 Nov 2015 13:56:20 +0100},
biburl = {https://dblp.org/rec/conf/dgo/KwonZHS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/PantelPH07,
author = {Patrick Pantel and
Andrew Philpot and
Eduard H. Hovy},
editor = {Judith Bayard Cushing and
Theresa A. Pardo},
title = {Data integration in the wild: from instances to concept catalogs},
booktitle = {Proceedings of the 8th Annual International Conference on Digital
Government Research, Bridging Disciplines {\&} Domains, {DG.O}
2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007},
series = {{ACM} International Conference Proceeding Series},
volume = {228},
pages = {264--265},
publisher = {Digital Government Research Center},
year = {2007},
url = {http://dl.acm.org/citation.cfm?id=1248511},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/PantelPH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/Hovy07,
author = {Eduard H. Hovy},
editor = {Judith Bayard Cushing and
Theresa A. Pardo},
title = {Government perspective: panel: international developments in digital
government},
booktitle = {Proceedings of the 8th Annual International Conference on Digital
Government Research, Bridging Disciplines {\&} Domains, {DG.O}
2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007},
series = {{ACM} International Conference Proceeding Series},
volume = {228},
pages = {336},
publisher = {Digital Government Research Center},
year = {2007},
url = {http://dl.acm.org/citation.cfm?id=1248544},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/Hovy07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/Hovy07a,
author = {Eduard H. Hovy},
editor = {Judith Bayard Cushing and
Theresa A. Pardo},
title = {Research perspective: panel: international developments in digital
government},
booktitle = {Proceedings of the 8th Annual International Conference on Digital
Government Research, Bridging Disciplines {\&} Domains, {DG.O}
2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007},
series = {{ACM} International Conference Proceeding Series},
volume = {228},
pages = {337--338},
publisher = {Digital Government Research Center},
year = {2007},
url = {http://dl.acm.org/citation.cfm?id=1248545},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/Hovy07a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/BhagatPH07,
author = {Rahul Bhagat and
Patrick Pantel and
Eduard H. Hovy},
editor = {Jason Eisner},
title = {{LEDIR:} An Unsupervised Algorithm for Learning Directionality of
Inference Rules},
booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical
Methods in Natural Language Processing and Computational Natural Language
Learning, June 28-30, 2007, Prague, Czech Republic},
pages = {161--170},
publisher = {{ACL}},
year = {2007},
url = {https://aclanthology.org/D07-1017/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/BhagatPH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhuH07,
author = {Jingbo Zhu and
Eduard H. Hovy},
editor = {Jason Eisner},
title = {Active Learning for Word Sense Disambiguation with Methods for Addressing
the Class Imbalance Problem},
booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical
Methods in Natural Language Processing and Computational Natural Language
Learning, June 28-30, 2007, Prague, Czech Republic},
pages = {783--790},
publisher = {{ACL}},
year = {2007},
url = {https://aclanthology.org/D07-1082/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhuH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/FengBH07,
author = {Donghui Feng and
Gully Burns and
Eduard H. Hovy},
editor = {Jason Eisner},
title = {Extracting Data Records from Unstructured Biomedical Full Text},
booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical
Methods in Natural Language Processing and Computational Natural Language
Learning, June 28-30, 2007, Prague, Czech Republic},
pages = {837--846},
publisher = {{ACL}},
year = {2007},
url = {https://aclanthology.org/D07-1088/},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/FengBH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KimH07,
author = {Soo{-}Min Kim and
Eduard H. Hovy},
editor = {Jason Eisner},
title = {Crystal: Analyzing Predictive Opinions on the Web},
booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical
Methods in Natural Language Processing and Computational Natural Language
Learning, June 28-30, 2007, Prague, Czech Republic},
pages = {1056--1064},
publisher = {{ACL}},
year = {2007},
url = {https://aclanthology.org/D07-1113/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/KimH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/BhagatH07,
author = {Rahul Bhagat and
Eduard H. Hovy},
editor = {Manuela M. Veloso},
title = {Phonetic Models for Generating Spelling Variants},
booktitle = {{IJCAI} 2007, Proceedings of the 20th International Joint Conference
on Artificial Intelligence, Hyderabad, India, January 6-12, 2007},
pages = {1570--1575},
year = {2007},
url = {http://ijcai.org/Proceedings/07/Papers/253.pdf},
timestamp = {Tue, 20 Aug 2019 16:17:11 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/BhagatH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/KwonH07,
author = {Namhee Kwon and
Eduard H. Hovy},
editor = {Derek H. Sleeman and
Ken Barker},
title = {Information acquisition using multiple classifications},
booktitle = {Proceedings of the 4th International Conference on Knowledge Capture
{(K-CAP} 2007), October 28-31, 2007, Whistler, BC, Canada},
pages = {111--118},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1298406.1298427},
doi = {10.1145/1298406.1298427},
timestamp = {Mon, 24 Aug 2020 15:16:10 +0200},
biburl = {https://dblp.org/rec/conf/kcap/KwonH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/ZhouKH07,
author = {Liang Zhou and
Namhee Kwon and
Eduard H. Hovy},
editor = {Candace L. Sidner and
Tanja Schultz and
Matthew Stone and
ChengXiang Zhai},
title = {A Semi-Automatic Evaluation Scheme: Automated Nuggetization for Manual
Annotation},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, April
22-27, 2007, Rochester, New York, {USA}},
pages = {217--220},
publisher = {The Association for Computational Linguistics},
year = {2007},
url = {https://aclanthology.org/N07-2055/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/ZhouKH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/PantelBCCH07,
author = {Patrick Pantel and
Rahul Bhagat and
Bonaventura Coppola and
Timothy Chklovski and
Eduard H. Hovy},
editor = {Candace L. Sidner and
Tanja Schultz and
Matthew Stone and
ChengXiang Zhai},
title = {{ISP:} Learning Inferential Selectional Preferences},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, April
22-27, 2007, Rochester, New York, {USA}},
pages = {564--571},
publisher = {The Association for Computational Linguistics},
year = {2007},
url = {https://aclanthology.org/N07-1071/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/PantelBCCH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semco/PradhanHMPRW07,
author = {Sameer S. Pradhan and
Eduard H. Hovy and
Mitchell P. Marcus and
Martha Palmer and
Lance A. Ramshaw and
Ralph M. Weischedel},
title = {OntoNotes: {A} Unified Relational Semantic Representation},
booktitle = {Proceedings of the First {IEEE} International Conference on Semantic
Computing {(ICSC} 2007), September 17-19, 2007, Irvine, California,
{USA}},
pages = {517--526},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/ICSC.2007.83},
doi = {10.1109/ICSC.2007.83},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/semco/PradhanHMPRW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/SwartoutGHHMRT06,
author = {William R. Swartout and
Jonathan Gratch and
Randall W. Hill Jr. and
Eduard H. Hovy and
Stacy Marsella and
Jeff Rickel and
David R. Traum},
title = {Toward Virtual Humans},
journal = {{AI} Mag.},
volume = {27},
number = {2},
pages = {96--108},
year = {2006},
url = {https://doi.org/10.1609/aimag.v27i2.1883},
doi = {10.1609/AIMAG.V27I2.1883},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/SwartoutGHHMRT06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/FengRH06,
author = {Donghui Feng and
Deepak Ravichandran and
Eduard H. Hovy},
title = {Mining and Re-ranking for Answering Biographical Queries on the Web},
booktitle = {Proceedings, The Twenty-First National Conference on Artificial Intelligence
and the Eighteenth Innovative Applications of Artificial Intelligence
Conference, July 16-20, 2006, Boston, Massachusetts, {USA}},
pages = {1283--1288},
publisher = {{AAAI} Press},
year = {2006},
url = {http://www.aaai.org/Library/AAAI/2006/aaai06-201.php},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaai/FengRH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/FengKSH06,
author = {Donghui Feng and
Jihie Kim and
Erin Shaw and
Eduard H. Hovy},
title = {Towards Modeling Threaded Discussions using Induced Ontology Knowledge},
booktitle = {Proceedings, The Twenty-First National Conference on Artificial Intelligence
and the Eighteenth Innovative Applications of Artificial Intelligence
Conference, July 16-20, 2006, Boston, Massachusetts, {USA}},
pages = {1289--1294},
publisher = {{AAAI} Press},
year = {2006},
url = {http://www.aaai.org/Library/AAAI/2006/aaai06-202.php},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaai/FengKSH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/MarcoCBCCHLM06,
author = {Chrysanne Di Marco and
Donald D. Cowan and
Peter Bray and
H. Dominic Covvey and
Vic Di Ciccio and
Eduard H. Hovy and
Joan Lipa and
Douglas W. Mulholland},
title = {A Physician's Authoring Tool for Generation of Personalized Health
Education in Reconstructive Surgery},
booktitle = {Argumentation for Consumers of Healthcare, Papers from the 2006 {AAAI}
Spring Symposium, Technical Report SS-06-01, Stanford, California,
USA, March 27-29, 2006},
pages = {39--46},
publisher = {{AAAI}},
year = {2006},
url = {http://www.aaai.org/Library/Symposia/Spring/2006/ss06-01-007.php},
timestamp = {Sat, 18 Feb 2012 12:28:06 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/MarcoCBCCHLM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/ZhouH06,
author = {Liang Zhou and
Eduard H. Hovy},
title = {On the Summarization of Dynamically Introduced Information: Online
Discussions and Blogs},
booktitle = {Computational Approaches to Analyzing Weblogs, Papers from the 2006
{AAAI} Spring Symposium, Technical Report SS-06-03, Stanford, California,
USA, March 27-29, 2006},
pages = {237},
publisher = {{AAAI}},
year = {2006},
url = {http://www.aaai.org/Library/Symposia/Spring/2006/ss06-03-048.php},
timestamp = {Sat, 18 Feb 2012 12:29:12 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/ZhouH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/KimH06,
author = {Soo{-}Min Kim and
Eduard H. Hovy},
editor = {Nicoletta Calzolari and
Claire Cardie and
Pierre Isabelle},
title = {Automatic Identification of Pro and Con Reasons in Online Reviews},
booktitle = {{ACL} 2006, 21st International Conference on Computational Linguistics
and 44th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the Conference, Sydney, Australia, 17-21 July 2006},
publisher = {The Association for Computer Linguistics},
year = {2006},
url = {https://aclanthology.org/P06-2063/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/KimH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amia/MarcoBCCCHLY06,
author = {Chrysanne Di Marco and
Peter Bray and
H. Dominic Covvey and
Donald D. Cowan and
Vic Di Ciccio and
Eduard H. Hovy and
Joan Lipa and
C. Yang},
title = {Authoring and Generation of Individualized Patient Education Materials},
booktitle = {{AMIA} 2006, American Medical Informatics Association Annual Symposium,
Washington, DC, USA, November 11-15, 2006},
publisher = {{AMIA}},
year = {2006},
url = {https://knowledge.amia.org/amia-55142-a2006a-1.620145/t-001-1.623243/f-001-1.623244/a-039-1.623631/a-040-1.623628},
timestamp = {Wed, 17 Apr 2024 11:48:16 +0200},
biburl = {https://dblp.org/rec/conf/amia/MarcoBCCCHLY06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cicling/KwonH06,
author = {Namhee Kwon and
Eduard H. Hovy},
editor = {Alexander F. Gelbukh},
title = {Integrating Semantic Frames from Multiple Sources},
booktitle = {Computational Linguistics and Intelligent Text Processing, 7th International
Conference, CICLing 2006, Mexico City, Mexico, February 19-25, 2006,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3878},
pages = {1--12},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11671299\_1},
doi = {10.1007/11671299\_1},
timestamp = {Tue, 14 May 2019 10:00:46 +0200},
biburl = {https://dblp.org/rec/conf/cicling/KwonH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/KwonSH06,
author = {Namhee Kwon and
Stuart W. Shulman and
Eduard H. Hovy},
editor = {Jos{\'{e}} A. B. Fortes and
Ann Macintosh},
title = {Multidimensional text analysis for eRulemaking},
booktitle = {Proceedings of the 7th Annual International Conference on Digital
Government Research, {DG.O} 2006, San Diego, California, USA, May
21-24, 2006},
series = {{ACM} International Conference Proceeding Series},
volume = {151},
pages = {157--166},
publisher = {Digital Government Research Center},
year = {2006},
url = {https://doi.org/10.1145/1146598.1146649},
doi = {10.1145/1146598.1146649},
timestamp = {Tue, 06 Nov 2018 11:06:50 +0100},
biburl = {https://dblp.org/rec/conf/dgo/KwonSH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/ShulmanHCZ06,
author = {Stuart W. Shulman and
Eduard H. Hovy and
Jamie Callan and
Stephen Zavestoski},
editor = {Jos{\'{e}} A. B. Fortes and
Ann Macintosh},
title = {Progress in language processing technology for electronic rulemaking},
booktitle = {Proceedings of the 7th Annual International Conference on Digital
Government Research, {DG.O} 2006, San Diego, California, USA, May
21-24, 2006},
series = {{ACM} International Conference Proceeding Series},
volume = {151},
pages = {249--250},
publisher = {Digital Government Research Center},
year = {2006},
url = {https://doi.org/10.1145/1146598.1146664},
doi = {10.1145/1146598.1146664},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/ShulmanHCZ06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/CushingWBDBFSSFHHJLSBGS06,
author = {Judith Bayard Cushing and
Tyrone Wilson and
Alan Borning and
Lois M. L. Delcambre and
Geoffrey C. Bowker and
Mike Frame and
John L. Schnase and
William Sonntag and
J{\'{a}}nos F{\"{u}}l{\"{o}}p and
Carol A. Hert and
Eduard H. Hovy and
Julia Jones and
Eric Landis and
Charles M. Schweik and
Lawrence Brandt and
Valerie Gregg and
Sylvia Spengler},
editor = {Jos{\'{e}} A. B. Fortes and
Ann Macintosh},
title = {Eco-informatics and natural resource management},
booktitle = {Proceedings of the 7th Annual International Conference on Digital
Government Research, {DG.O} 2006, San Diego, California, USA, May
21-24, 2006},
series = {{ACM} International Conference Proceeding Series},
volume = {151},
pages = {381--382},
publisher = {Digital Government Research Center},
year = {2006},
url = {https://doi.org/10.1145/1146598.1146712},
doi = {10.1145/1146598.1146712},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dgo/CushingWBDBFSSFHHJLSBGS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/HovyPP06,
author = {Eduard H. Hovy and
Andrew Philpot and
Patrick Pantel},
editor = {Jos{\'{e}} A. B. Fortes and
Ann Macintosh},
title = {Entity consolidation and alignment in semi-structured data sources},
booktitle = {Proceedings of the 7th Annual International Conference on Digital
Government Research, {DG.O} 2006, San Diego, California, USA, May
21-24, 2006},
series = {{ACM} International Conference Proceeding Series},
volume = {151},
pages = {400--401},
publisher = {Digital Government Research Center},
year = {2006},
url = {https://doi.org/10.1145/1146598.1146721},
doi = {10.1145/1146598.1146721},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/HovyPP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/PantelPH06,
author = {Patrick Pantel and
Andrew Philpot and
Eduard H. Hovy},
editor = {Jos{\'{e}} A. B. Fortes and
Ann Macintosh},
title = {Matching and integration across heterogeneous data sources},
booktitle = {Proceedings of the 7th Annual International Conference on Digital
Government Research, {DG.O} 2006, San Diego, California, USA, May
21-24, 2006},
series = {{ACM} International Conference Proceeding Series},
volume = {151},
pages = {438--439},
publisher = {Digital Government Research Center},
year = {2006},
url = {https://doi.org/10.1145/1146598.1146738},
doi = {10.1145/1146598.1146738},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/PantelPH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhouLH06,
author = {Liang Zhou and
Chin{-}Yew Lin and
Eduard H. Hovy},
editor = {Dan Jurafsky and
{\'{E}}ric Gaussier},
title = {Re-evaluating Machine Translation Results with Paraphrase Support},
booktitle = {{EMNLP} 2006, Proceedings of the 2006 Conference on Empirical Methods
in Natural Language Processing, 22-23 July 2006, Sydney, Australia},
pages = {77--84},
publisher = {{ACL}},
year = {2006},
url = {https://aclanthology.org/W06-1610/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhouLH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/Hovy06,
author = {Eduard H. Hovy},
editor = {York Sure and
John Domingue},
title = {Toward Large-Scale Shallow Semantics for Higher-Quality {NLP}},
booktitle = {The Semantic Web: Research and Applications, 3rd European Semantic
Web Conference, {ESWC} 2006, Budva, Montenegro, June 11-14, 2006,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4011},
pages = {2},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11762256\_2},
doi = {10.1007/11762256\_2},
timestamp = {Fri, 25 Dec 2020 01:15:10 +0100},
biburl = {https://dblp.org/rec/conf/esws/Hovy06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/ShinHMP06,
author = {Hyun Woong Shin and
Eduard H. Hovy and
Dennis McLeod and
Larry Pryor},
editor = {Roger S. Barga and
Xiaofang Zhou},
title = {Measuring Generality of Documents},
booktitle = {Proceedings of the 22nd International Conference on Data Engineering
Workshops, {ICDE} 2006, 3-7 April 2006, Atlanta, GA, {USA}},
pages = {62},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/ICDEW.2006.77},
doi = {10.1109/ICDEW.2006.77},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icde/ShinHMP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/FleischmanH06,
author = {Michael Fleischman and
Eduard H. Hovy},
editor = {C{\'{e}}cile Paris and
Candace L. Sidner},
title = {Taking advantage of the situation: non-linguistic context for natural
language interfaces to interactive virtual environments},
booktitle = {Proceedings of the 11th International Conference on Intelligent User
Interfaces, {IUI} 2006, Sydney, Australia, January 29 - February 1,
2006},
pages = {47--54},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1111449.1111467},
doi = {10.1145/1111449.1111467},
timestamp = {Tue, 06 Nov 2018 11:07:41 +0100},
biburl = {https://dblp.org/rec/conf/iui/FleischmanH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/FengSKH06,
author = {Donghui Feng and
Erin Shaw and
Jihie Kim and
Eduard H. Hovy},
editor = {C{\'{e}}cile Paris and
Candace L. Sidner},
title = {An intelligent discussion-bot for answering student queries in threaded
discussions},
booktitle = {Proceedings of the 11th International Conference on Intelligent User
Interfaces, {IUI} 2006, Sydney, Australia, January 29 - February 1,
2006},
pages = {171--177},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1111449.1111488},
doi = {10.1145/1111449.1111488},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iui/FengSKH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/RambowDFGHHHLMM06,
author = {Owen Rambow and
Bonnie J. Dorr and
David Farwell and
Rebecca Green and
Nizar Habash and
Stephen Helmreich and
Eduard H. Hovy and
Lori S. Levin and
Keith J. Miller and
Teruko Mitamura and
Florence Reeder and
Advaith Siddharthan},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Aldo Gangemi and
Bente Maegaard and
Joseph Mariani and
Jan Odijk and
Daniel Tapias},
title = {Parallel Syntactic Annotation of Multiple Languages},
booktitle = {Proceedings of the Fifth International Conference on Language Resources
and Evaluation, {LREC} 2006, Genoa, Italy, May 22-28, 2006},
pages = {559--564},
publisher = {European Language Resources Association {(ELRA)}},
year = {2006},
url = {http://www.lrec-conf.org/proceedings/lrec2006/summaries/645.html},
timestamp = {Mon, 19 Aug 2019 15:23:22 +0200},
biburl = {https://dblp.org/rec/conf/lrec/RambowDFGHHHLMM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/ZhouLH06,
author = {Liang Zhou and
Chin{-}Yew Lin and
Eduard H. Hovy},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Aldo Gangemi and
Bente Maegaard and
Joseph Mariani and
Jan Odijk and
Daniel Tapias},
title = {Summarizing Answers for Complicated Questions},
booktitle = {Proceedings of the Fifth International Conference on Language Resources
and Evaluation, {LREC} 2006, Genoa, Italy, May 22-28, 2006},
pages = {737--740},
publisher = {European Language Resources Association {(ELRA)}},
year = {2006},
url = {http://www.lrec-conf.org/proceedings/lrec2006/summaries/443.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/ZhouLH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/HovyLZF06,
author = {Eduard H. Hovy and
Chin{-}Yew Lin and
Liang Zhou and
Junichi Fukumoto},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Aldo Gangemi and
Bente Maegaard and
Joseph Mariani and
Jan Odijk and
Daniel Tapias},
title = {Automated Summarization Evaluation with Basic Elements},
booktitle = {Proceedings of the Fifth International Conference on Language Resources
and Evaluation, {LREC} 2006, Genoa, Italy, May 22-28, 2006},
pages = {899--902},
publisher = {European Language Resources Association {(ELRA)}},
year = {2006},
url = {http://www.lrec-conf.org/proceedings/lrec2006/summaries/438.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/HovyLZF06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/FengSKH06,
author = {Donghui Feng and
Erin Shaw and
Jihie Kim and
Eduard H. Hovy},
editor = {Robert C. Moore and
Jeff A. Bilmes and
Jennifer Chu{-}Carroll and
Mark Sanderson},
title = {Learning to Detect Conversation Focus of Threaded Discussions},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
4-9, 2006, New York, New York, {USA}},
publisher = {The Association for Computational Linguistics},
year = {2006},
url = {https://aclanthology.org/N06-1027/},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/naacl/FengSKH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/HovyMPRW06,
author = {Eduard H. Hovy and
Mitchell P. Marcus and
Martha Palmer and
Lance A. Ramshaw and
Ralph M. Weischedel},
editor = {Robert C. Moore and
Jeff A. Bilmes and
Jennifer Chu{-}Carroll and
Mark Sanderson},
title = {OntoNotes: The 90{\%} Solution},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
4-9, 2006, New York, New York, {USA}},
publisher = {The Association for Computational Linguistics},
year = {2006},
url = {https://aclanthology.org/N06-2015/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/HovyMPRW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/KimH06,
author = {Soo{-}Min Kim and
Eduard H. Hovy},
editor = {Robert C. Moore and
Jeff A. Bilmes and
Jennifer Chu{-}Carroll and
Mark Sanderson},
title = {Identifying and Analyzing Judgment Opinions},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
4-9, 2006, New York, New York, {USA}},
publisher = {The Association for Computational Linguistics},
year = {2006},
url = {https://aclanthology.org/N06-1026/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/KimH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/ZhouLMH06,
author = {Liang Zhou and
Chin{-}Yew Lin and
Dragos Stefan Munteanu and
Eduard H. Hovy},
editor = {Robert C. Moore and
Jeff A. Bilmes and
Jennifer Chu{-}Carroll and
Mark Sanderson},
title = {ParaEval: Using Paraphrases to Evaluate Summaries Automatically},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
4-9, 2006, New York, New York, {USA}},
publisher = {The Association for Computational Linguistics},
year = {2006},
url = {https://aclanthology.org/N06-1057/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/ZhouLMH06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tsd/Hovy06,
author = {Eduard H. Hovy},
editor = {Petr Sojka and
Ivan Kopecek and
Karel Pala},
title = {Learning by Reading: An Experiment in Text Analysis},
booktitle = {Text, Speech and Dialogue, 9th International Conference, {TSD} 2006,
Brno, Czech Republic, September 11-15, 2006, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4188},
pages = {3--12},
publisher = {Springer},
year = {2006},
url = {https://doi.org/10.1007/11846406\_1},
doi = {10.1007/11846406\_1},
timestamp = {Tue, 14 May 2019 10:00:45 +0200},
biburl = {https://dblp.org/rec/conf/tsd/Hovy06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/PantelPH05,
author = {Patrick Pantel and
Andrew Philpot and
Eduard H. Hovy},
title = {Data Alignment and Integration},
journal = {Computer},
volume = {38},
number = {12},
pages = {43--50},
year = {2005},
url = {https://doi.org/10.1109/MC.2005.406},
doi = {10.1109/MC.2005.406},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/computer/PantelPH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jiis/KhanMH05,
author = {Latifur Khan and
Dennis McLeod and
Eduard H. Hovy},
title = {A Framework for Effective Annotation of Information from Closed Captions
Using Ontologies},
journal = {J. Intell. Inf. Syst.},
volume = {25},
number = {2},
pages = {181--205},
year = {2005},
url = {https://doi.org/10.1007/s10844-005-0188-9},
doi = {10.1007/S10844-005-0188-9},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jiis/KhanMH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhouH05,
author = {Liang Zhou and
Eduard H. Hovy},
editor = {Kevin Knight and
Hwee Tou Ng and
Kemal Oflazer},
title = {Digesting Virtual "Geek" Culture: The Summarization of Technical
Internet Relay Chats},
booktitle = {{ACL} 2005, 43rd Annual Meeting of the Association for Computational
Linguistics, Proceedings of the Conference, 25-30 June 2005, University
of Michigan, {USA}},
pages = {298--305},
publisher = {The Association for Computer Linguistics},
year = {2005},
url = {https://aclanthology.org/P05-1037/},
doi = {10.3115/1219840.1219877},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhouH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RavichandranPH05,
author = {Deepak Ravichandran and
Patrick Pantel and
Eduard H. Hovy},
editor = {Kevin Knight and
Hwee Tou Ng and
Kemal Oflazer},
title = {Randomized Algorithms and {NLP:} Using Locality Sensitive Hash Functions
for High Speed Noun Clustering},
booktitle = {{ACL} 2005, 43rd Annual Meeting of the Association for Computational
Linguistics, Proceedings of the Conference, 25-30 June 2005, University
of Michigan, {USA}},
pages = {622--629},
publisher = {The Association for Computer Linguistics},
year = {2005},
url = {https://aclanthology.org/P05-1077/},
doi = {10.3115/1219840.1219917},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RavichandranPH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clin/Hovy05,
author = {Eduard H. Hovy},
editor = {Khalil Sima'an and
Maarten de Rijke and
Remko Scha and
Rob van Son},
title = {Toward Large-Scale Shallow Semantics for Higher-Quality {NLP}},
booktitle = {Computational Linguistics in the Netherlands 2005, Proceedings 16th
Meeting of Computational Linguistics in the Netherlands, December
16, 2005, University of Amsterdam},
publisher = {Grafisch Centrum Amsterdam},
year = {2005},
timestamp = {Thu, 12 Mar 2020 11:35:19 +0100},
biburl = {https://dblp.org/rec/conf/clin/Hovy05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/ShulmanHCZ05,
author = {Stuart W. Shulman and
Eduard H. Hovy and
Jamie Callan and
Stephen Zavestoski},
editor = {Lois M. L. Delcambre and
Genevieve Giuliano},
title = {Language processing technologies for electronic rulemaking: a project
highlight},
booktitle = {Proceedings of the 2005 National Conference on Digital Government
Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005},
series = {{ACM} International Conference Proceeding Series},
volume = {89},
pages = {87--88},
publisher = {Digital Government Research Center},
year = {2005},
url = {http://dl.acm.org/citation.cfm?id=1065248},
timestamp = {Fri, 20 Nov 2015 13:56:21 +0100},
biburl = {https://dblp.org/rec/conf/dgo/ShulmanHCZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/PantelPH05,
author = {Patrick Pantel and
Andrew Philpot and
Eduard H. Hovy},
editor = {Lois M. L. Delcambre and
Genevieve Giuliano},
title = {Aligning database columns using mutual information},
booktitle = {Proceedings of the 2005 National Conference on Digital Government
Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005},
series = {{ACM} International Conference Proceeding Series},
volume = {89},
pages = {205--210},
publisher = {Digital Government Research Center},
year = {2005},
url = {http://dl.acm.org/citation.cfm?id=1065285},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/PantelPH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/CushingWBDBFSSFHHJLSBGS05,
author = {Judith Bayard Cushing and
Tyrone Wilson and
Alan Borning and
Lois M. L. Delcambre and
Geoffrey C. Bowker and
Mike Frame and
John L. Schnase and
William Sonntag and
J{\'{a}}nos F{\"{u}}l{\"{o}}p and
Carol A. Hert and
Eduard H. Hovy and
Julia Jones and
Eric Landis and
Charles M. Schweik and
Lawrence Brandt and
Valerie Gregg and
Sylvia Spengler},
editor = {Lois M. L. Delcambre and
Genevieve Giuliano},
title = {Eco-informatics and natural resource management},
booktitle = {Proceedings of the 2005 National Conference on Digital Government
Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005},
series = {{ACM} International Conference Proceeding Series},
volume = {89},
pages = {211--212},
publisher = {Digital Government Research Center},
year = {2005},
url = {http://dl.acm.org/citation.cfm?id=1065286},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/CushingWBDBFSSFHHJLSBGS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/PhilpotPH05,
author = {Andrew Philpot and
Patrick Pantel and
Eduard H. Hovy},
editor = {Lois M. L. Delcambre and
Genevieve Giuliano},
title = {Significance information for translation: air quality data integration},
booktitle = {Proceedings of the 2005 National Conference on Digital Government
Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005},
series = {{ACM} International Conference Proceeding Series},
volume = {89},
pages = {233--234},
publisher = {Digital Government Research Center},
year = {2005},
url = {http://dl.acm.org/citation.cfm?id=1065297},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/PhilpotPH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccs/Hovy05,
author = {Eduard H. Hovy},
editor = {Frithjof Dau and
Marie{-}Laure Mugnier and
Gerd Stumme},
title = {Methodologies for the Reliable Construction of Ontological Knowledge},
booktitle = {Conceptual Structures: Common Semantics for Sharing Knowledge, 13th
International Conference on Conceptual Structures, {ICCS} 2005, Kassel,
Germany, July 17-22, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3596},
pages = {91--106},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11524564\_6},
doi = {10.1007/11524564\_6},
timestamp = {Tue, 14 May 2019 10:00:37 +0200},
biburl = {https://dblp.org/rec/conf/iccs/Hovy05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/KimH05,
author = {Soo{-}Min Kim and
Eduard H. Hovy},
title = {Automatic Detection of Opinion Bearing Words and Sentences},
booktitle = {Natural Language Processing - {IJCNLP} 2005, Second International
Joint Conference, Jeju Island, Republic of Korea, October 11-13, 2005
- Companion Volume to the Proceedings of Conference including Posters/Demos
and tutorial abstracts},
publisher = {Asian Federation of Natural Language Processing},
year = {2005},
url = {https://aclanthology.org/I05-2011/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/KimH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/PhilpotHP05,
author = {Andrew Philpot and
Eduard H. Hovy and
Patrick Pantel},
title = {The Omega Ontology},
booktitle = {Proceedings of OntoLex@IJCNLP 2005 - Ontologies and Lexical Resources,
Jeju Island, Korea, October 15, 2005},
publisher = {Asian Federation of Natural Language Processing},
year = {2005},
url = {https://aclanthology.org/I05-7009/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/PhilpotHP05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwpt/BhagatLH05,
author = {Rahul Bhagat and
Anton Leuski and
Eduard H. Hovy},
editor = {Harry Bunt and
Robert Malouf and
Alon Lavie},
title = {Statistical Shallow Semantic Parsing despite Little Training Data},
booktitle = {Proceedings of the Ninth International Workshop on Parsing Technology,
{IWPT} 2005, Vancouver, Canada, October 9-10, 2005},
pages = {186--187},
publisher = {Association for Computational Linguistics},
year = {2005},
url = {https://aclanthology.org/W05-1520/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iwpt/BhagatLH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/ZhouSLH05,
author = {Liang Zhou and
Erin Shaw and
Chin{-}Yew Lin and
Eduard H. Hovy},
title = {Classummary: Introducing Discussion Summarization to Online Classrooms},
booktitle = {{HLT/EMNLP} 2005, Human Language Technology Conference and Conference
on Empirical Methods in Natural Language Processing, Proceedings of
the Conference, 6-8 October 2005, Vancouver, British Columbia, Canada},
pages = {4--5},
publisher = {The Association for Computational Linguistics},
year = {2005},
url = {https://aclanthology.org/H05-2003/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/ZhouSLH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/FengH05,
author = {Donghui Feng and
Eduard H. Hovy},
title = {Handling Biographical Questions with Implicature},
booktitle = {{HLT/EMNLP} 2005, Human Language Technology Conference and Conference
on Empirical Methods in Natural Language Processing, Proceedings of
the Conference, 6-8 October 2005, Vancouver, British Columbia, Canada},
pages = {596--603},
publisher = {The Association for Computational Linguistics},
year = {2005},
url = {https://aclanthology.org/H05-1075/},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/naacl/FengH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nlucs/FengH05,
author = {Donghui Feng and
Eduard H. Hovy},
editor = {Bernadette Sharp},
title = {{MRE:} {A} Study on Evolutionary Language Understanding},
booktitle = {Natural Language Understanding and Cognitive Science, Proceedings
of the 2nd International Workshop on Natural Language Understanding
and Cognitive Science, {NLUCS} 2005, In conjunction with {ICEIS} 2005,
Miami, FL, USA, May 2005},
pages = {45--54},
publisher = {{INSTICC} Press},
year = {2005},
timestamp = {Wed, 08 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nlucs/FengH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdial/TraumSGMKHNFMBR05,
author = {David R. Traum and
William R. Swartout and
Jonathan Gratch and
Stacy Marsella and
Patrick G. Kenny and
Eduard H. Hovy and
Shri Narayanan and
Ed Fast and
Bilyana Martinovski and
Rahul Baghat and
Susan Robinson and
Andrew Marshall and
Dagen Wang and
Sudeep Gandhe and
Anton Leuski},
editor = {Laila Dybkj{\ae}r and
Wolfgang Minker},
title = {Dealing with Doctors: {A} Virtual Human for Non-team Interaction},
booktitle = {Proceedings of the 6th SIGdial Workshop on Discourse and Dialogue,
SIGdial 2005, Lisbon, Portugal, 2-3 September 2005},
pages = {232--236},
publisher = {Special Interest Group on Discourse and Dialogue (SIGdial)},
year = {2005},
url = {https://aclanthology.org/2005.sigdial-1.25/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigdial/TraumSGMKHNFMBR05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssdbm/PantelPH05,
author = {Patrick Pantel and
Andrew Philpot and
Eduard H. Hovy},
editor = {James Frew},
title = {An Information Theoretic Model for Database Alignment},
booktitle = {17th International Conference on Scientific and Statistical Database
Management, {SSDBM} 2005, 27-29 June 2005, University of California,
Santa Barbara, CA, USA, Proceedings},
pages = {14--23},
year = {2005},
timestamp = {Tue, 18 Sep 2012 21:15:21 +0200},
biburl = {https://dblp.org/rec/conf/ssdbm/PantelPH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/ox/05/FilatovaH05,
author = {Elena Filatova and
Eduard H. Hovy},
editor = {Inderjeet Mani and
James Pustejovsky and
Robert J. Gaizauskas},
title = {Assigning Time-Stamps to Event-Clauses},
booktitle = {The Language of Time - {A} Reader},
pages = {523--532},
publisher = {Oxford University Press},
year = {2005},
timestamp = {Thu, 07 May 2020 14:58:21 +0200},
biburl = {https://dblp.org/rec/books/ox/05/FilatovaH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cs-0501078,
author = {Liang Zhou and
Miruna Ticrea and
Eduard H. Hovy},
title = {Multi-document Biography Summarization},
journal = {CoRR},
volume = {abs/cs/0501078},
year = {2005},
url = {http://arxiv.org/abs/cs/0501078},
eprinttype = {arXiv},
eprint = {cs/0501078},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-cs-0501078.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/vldb/KhanMH04,
author = {Latifur Khan and
Dennis McLeod and
Eduard H. Hovy},
title = {Retrieval effectiveness of an ontology-based model for information
selection},
journal = {{VLDB} J.},
volume = {13},
number = {1},
pages = {71--85},
year = {2004},
url = {https://doi.org/10.1007/s00778-003-0105-1},
doi = {10.1007/S00778-003-0105-1},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/vldb/KhanMH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaifs/SwartoutGHHMRT04,
author = {William R. Swartout and
Jonathan Gratch and
Randall W. Hill Jr. and
Eduard H. Hovy and
Stacy Marsella and
Jeff Rickel and
David R. Traum},
title = {Towards Virtual Humans},
booktitle = {Achieving Human-Level Intelligence through Integrated Systems and
Research, Papers from the 2004 {AAAI} Fall Symposium. Arlington, VA,
USA, October 22-24, 2004},
volume = {{FS-04-01}},
pages = {70--77},
publisher = {{AAAI} Press},
year = {2004},
url = {https://www.aaai.org/Library/Symposia/Fall/2004/fs04-01-012.php},
timestamp = {Fri, 04 Sep 2020 13:38:34 +0200},
biburl = {https://dblp.org/rec/conf/aaaifs/SwartoutGHHMRT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/ReederDFHHHLMMRS04,
author = {Florence Reeder and
Bonnie J. Dorr and
David Farwell and
Nizar Habash and
Stephen Helmreich and
Eduard H. Hovy and
Lori S. Levin and
Teruko Mitamura and
Keith J. Miller and
Owen Rambow and
Advaith Siddharthan},
editor = {Robert E. Frederking and
Kathryn Taylor},
title = {Interlingual Annotation for {MT} Development},
booktitle = {Machine Translation: From Real Users to Research, 6th Conference of
the Association for Machine Translation in the Americas, {AMTA} 2004,
Washington, DC, USA, September 28-October 2, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3265},
pages = {236--245},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30194-3\_26},
doi = {10.1007/978-3-540-30194-3\_26},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/ReederDFHHHLMMRS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/KimH04,
author = {Soo{-}Min Kim and
Eduard H. Hovy},
title = {Determining the Sentiment of Opinions},
booktitle = {{COLING} 2004, 20th International Conference on Computational Linguistics,
Proceedings of the Conference, 23-27 August 2004, Geneva, Switzerland},
year = {2004},
url = {https://aclanthology.org/C04-1200/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/KimH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/KwonFH04,
author = {Namhee Kwon and
Michael Fleischman and
Eduard H. Hovy},
title = {FrameNet-based Semantic Parsing using Maximum Entropy Models},
booktitle = {{COLING} 2004, 20th International Conference on Computational Linguistics,
Proceedings of the Conference, 23-27 August 2004, Geneva, Switzerland},
year = {2004},
url = {https://aclanthology.org/C04-1179/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/KwonFH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/PantelRH04,
author = {Patrick Pantel and
Deepak Ravichandran and
Eduard H. Hovy},
title = {Towards Terascale Semantic Acquisition},
booktitle = {{COLING} 2004, 20th International Conference on Computational Linguistics,
Proceedings of the Conference, 23-27 August 2004, Geneva, Switzerland},
year = {2004},
url = {https://aclanthology.org/C04-1111/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/PantelRH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/HovyF04,
author = {Eduard H. Hovy and
Stefan Falke},
editor = {Sharon S. Dawes and
Eduard H. Hovy and
Lois M. L. Delcambre},
title = {Automating the Integration of Heterogeneous Databases},
booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government
Research, {DG.O} 2004, Seattle, WA, USA, 2004},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2004},
url = {http://dl.acm.org/citation.cfm?id=1124199},
timestamp = {Sat, 07 Jul 2018 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/dgo/HovyF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/HovyPD04,
author = {Eduard H. Hovy and
Andrew Philpot and
Lei Ding},
editor = {Sharon S. Dawes and
Eduard H. Hovy and
Lois M. L. Delcambre},
title = {{DGRC} AskCal: {A} Multilingual Question Answering Agent for Heterogeneous
Energy Databases},
booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government
Research, {DG.O} 2004, Seattle, WA, USA, 2004},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2004},
url = {http://dl.acm.org/citation.cfm?id=1124216},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/HovyPD04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/HovyPD04a,
author = {Eduard H. Hovy and
Andrew Philpot and
Lei Ding},
editor = {Sharon S. Dawes and
Eduard H. Hovy and
Lois M. L. Delcambre},
title = {Multilingual {DGRC} AskCal: Querying Energy Time Series in English,
Spanish, and Mandarin Chinese},
booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government
Research, {DG.O} 2004, Seattle, WA, USA, 2004},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2004},
url = {http://dl.acm.org/citation.cfm?id=1124280},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/HovyPD04a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/PhilpotHF04,
author = {Andrew Philpot and
Eduard H. Hovy and
Stefan Falke},
editor = {Sharon S. Dawes and
Eduard H. Hovy and
Lois M. L. Delcambre},
title = {{EPA-AIR} SIfT: Air Quality Data Integration from Heterogeneous Sources},
booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government
Research, {DG.O} 2004, Seattle, WA, USA, 2004},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2004},
url = {http://dl.acm.org/citation.cfm?id=1124229},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/PhilpotHF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/ShulmanHZC04,
author = {Stuart W. Shulman and
Eduard H. Hovy and
Stephen Zavestoski and
Jamie Callan},
editor = {Sharon S. Dawes and
Eduard H. Hovy and
Lois M. L. Delcambre},
title = {{SGER} Collaborative: {A} Testbed for eRulemaking Data},
booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government
Research, {DG.O} 2004, Seattle, WA, USA, 2004},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2004},
url = {http://dl.acm.org/citation.cfm?id=1124305},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/ShulmanHZC04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhouTH04,
author = {Liang Zhou and
Miruna Ticrea and
Eduard H. Hovy},
title = {Multi-Document Biography Summarization},
booktitle = {Proceedings of the 2004 Conference on Empirical Methods in Natural
Language Processing , {EMNLP} 2004, {A} meeting of SIGDAT, a Special
Interest Group of the ACL, held in conjunction with {ACL} 2004, 25-26
July 2004, Barcelona, Spain},
pages = {434--441},
publisher = {{ACL}},
year = {2004},
url = {https://aclanthology.org/W04-3256/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhouTH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/HelmreichFDHLMR04,
author = {Stephen Helmreich and
David Farwell and
Bonnie J. Dorr and
Nizar Habash and
Lori S. Levin and
Teruko Mitamura and
Florence Reeder and
Keith J. Miller and
Eduard H. Hovy and
Owen Rambow and
Advaith Siddharthan},
title = {Interlingual Annotation of Multilingual Text Corpora},
booktitle = {Proceedings of the Workshop Frontiers in Corpus Annotation@HLT-NAACL
2004, Boston, MA, USA, May 6, 2004},
year = {2004},
url = {https://aclanthology.org/W04-2709/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/HelmreichFDHLMR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semeval/KwonFH04,
author = {Namhee Kwon and
Michael Fleischman and
Eduard H. Hovy},
title = {Senseval automatic labeling of semantic roles using Maximum Entropy
models},
booktitle = {Proceedings of the Third International Workshop on the Evaluation
of Systems for the Semantic Analysis of Text, SENSEVAL@ACL 2004, Barcelona,
Spain, July 25-26, 2004},
publisher = {Association for Computational Linguistics},
year = {2004},
url = {https://aclanthology.org/W04-0832/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/semeval/KwonFH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/KimRH04,
author = {Soo{-}Min Kim and
Deepak Ravichandran and
Eduard H. Hovy},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {{ISI} Novelty Track System for {TREC} 2004},
booktitle = {Proceedings of the Thirteenth Text REtrieval Conference, {TREC} 2004,
Gaithersburg, Maryland, USA, November 16-19, 2004},
series = {{NIST} Special Publication},
volume = {500-261},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2004},
url = {http://trec.nist.gov/pubs/trec13/papers/usc-isi.novelty.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/KimRH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dgo/2004,
editor = {Sharon S. Dawes and
Eduard H. Hovy and
Lois M. L. Delcambre},
title = {Proceedings of the 2004 Annual National Conference on Digital Government
Research, {DG.O} 2004, Seattle, WA, USA, 2004},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2004},
url = {http://dl.acm.org/citation.cfm?id=1124191},
timestamp = {Sat, 07 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dgo/2004.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/Hovy03,
author = {Eduard H. Hovy},
title = {Using an ontology to simplify data access},
journal = {Commun. {ACM}},
volume = {46},
number = {1},
pages = {47--49},
year = {2003},
url = {https://doi.org/10.1145/602421.602447},
doi = {10.1145/602421.602447},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/Hovy03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/talip/LeuskiLZGOH03,
author = {Anton Leuski and
Chin{-}Yew Lin and
Liang Zhou and
Ulrich Germann and
Franz Josef Och and
Eduard H. Hovy},
title = {Cross-lingual C*ST*RD: English access to Hindi information},
journal = {{ACM} Trans. Asian Lang. Inf. Process.},
volume = {2},
number = {3},
pages = {245--269},
year = {2003},
url = {https://doi.org/10.1145/979872.979877},
doi = {10.1145/979872.979877},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/talip/LeuskiLZGOH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/FleischmanHE03,
author = {Michael Fleischman and
Eduard H. Hovy and
Abdessamad Echihabi},
editor = {Erhard W. Hinrichs and
Dan Roth},
title = {Offline Strategies for Online Question Answering: Answering Questions
Before They Are Asked},
booktitle = {Proceedings of the 41st Annual Meeting of the Association for Computational
Linguistics, 7-12 July 2003, Sapporo Convention Center, Sapporo, Japan},
pages = {1--7},
publisher = {{ACL}},
year = {2003},
url = {https://aclanthology.org/P03-1001/},
doi = {10.3115/1075096.1075097},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/FleischmanHE03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LeuskiLH03,
author = {Anton Leuski and
Chin{-}Yew Lin and
Eduard H. Hovy},
editor = {Kotaro Funakoshi and
Sandra K{\"{u}}bler and
Jahna Otterbacher},
title = {iNeATS: Interactive Multi-Document Summarization},
booktitle = {{ACL} 2003, 41st Annual Meeting of the Association for Computational
Linguistics, Companion Volume to the Proceedings, 7-12 July 2003,
Sapporo Convention Center, Sapporo, Japan},
pages = {125--128},
publisher = {The Association for Computer Linguistics},
year = {2003},
url = {https://aclanthology.org/P03-2021/},
doi = {10.3115/1075178.1075197},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LeuskiLH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/HovyPKGD03,
author = {Eduard H. Hovy and
Andrew Philpot and
Judith Klavans and
Ulrich Germann and
Peter T. Davis},
editor = {Yigal Arens and
Eduard H. Hovy and
Peggy Agouris},
title = {Extending Metadata Definitions by Automatically Extracting and Organizing
Glossary Definitions},
booktitle = {Proceedings of the 2003 Annual National Conference on Digital Government
Research, {DG.O} 2003, Boston, MA, USA, 2003},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2003},
url = {http://dl.acm.org/citation.cfm?id=1123248},
timestamp = {Sat, 07 Jul 2018 14:14:28 +0200},
biburl = {https://dblp.org/rec/conf/dgo/HovyPKGD03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/FleischmanKH03,
author = {Michael Fleischman and
Namhee Kwon and
Eduard H. Hovy},
title = {Maximum Entropy Models for FrameNet Classification},
booktitle = {Proceedings of the Conference on Empirical Methods in Natural Language
Processing, {EMNLP} 2003, Sapporo, Japan, July 11-12, 2003},
year = {2003},
url = {https://aclanthology.org/W03-1007/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/FleischmanKH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iui/FleischmanH03,
author = {Michael Fleischman and
Eduard H. Hovy},
editor = {David B. Leake and
W. Lewis Johnson and
Elisabeth Andr{\'{e}}},
title = {Recommendations without user preferences: a natural language processing
approach},
booktitle = {Proceedings of the 8th International Conference on Intelligent User
Interfaces, {IUI} 2003, Miami, FL, USA, January 12-15, 2003},
pages = {242--244},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/604045.604087},
doi = {10.1145/604045.604087},
timestamp = {Sat, 30 Sep 2023 09:51:13 +0200},
biburl = {https://dblp.org/rec/conf/iui/FleischmanH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mtsummit/DienHH03,
author = {Dinh Dien and
Kiem Hoang and
Eduard H. Hovy},
title = {{BTL:} a hybrid model for English-Vietnamese machine translation},
booktitle = {Proceedings of Machine Translation Summit {IX:} Papers, MTSummit 2003,
New Orleans, USA, September 18-22, 2003},
year = {2003},
url = {https://aclanthology.org/2003.mtsummit-papers.12},
timestamp = {Mon, 20 Sep 2021 17:44:13 +0200},
biburl = {https://dblp.org/rec/conf/mtsummit/DienHH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mtsummit/KingPH03,
author = {Margaret King and
Andrei Popescu{-}Belis and
Eduard H. Hovy},
title = {{FEMTI:} creating and using a framework for {MT} evaluation},
booktitle = {Proceedings of Machine Translation Summit {IX:} Papers, MTSummit 2003,
New Orleans, USA, September 18-22, 2003},
year = {2003},
url = {https://aclanthology.org/2003.mtsummit-papers.30},
timestamp = {Mon, 20 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mtsummit/KingPH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/FleischmanH03,
author = {Michael Fleischman and
Eduard H. Hovy},
editor = {Marti A. Hearst and
Mari Ostendorf},
title = {A Maximum Entropy Approach to FrameNet Tagging},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association for Computational Linguistics, {HLT-NAACL} 2003,
Edmonton, Canada, May 27 - June 1, 2003},
publisher = {The Association for Computational Linguistics},
year = {2003},
url = {https://aclanthology.org/N03-2008/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/FleischmanH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/LinH03,
author = {Chin{-}Yew Lin and
Eduard H. Hovy},
editor = {Marti A. Hearst and
Mari Ostendorf},
title = {Automatic Evaluation of Summaries Using N-gram Co-occurrence Statistics},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association for Computational Linguistics, {HLT-NAACL} 2003,
Edmonton, Canada, May 27 - June 1, 2003},
publisher = {The Association for Computational Linguistics},
year = {2003},
url = {https://aclanthology.org/N03-1020/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/LinH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/ZhouH03,
author = {Liang Zhou and
Eduard H. Hovy},
editor = {Marti A. Hearst and
Mari Ostendorf},
title = {A Web-Trained Extraction Summarization System},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association for Computational Linguistics, {HLT-NAACL} 2003,
Edmonton, Canada, May 27 - June 1, 2003},
publisher = {The Association for Computational Linguistics},
year = {2003},
url = {https://aclanthology.org/N03-1037/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/ZhouH03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/EchihabiHHMMR03,
author = {Abdessamad Echihabi and
Ulf Hermjakob and
Eduard H. Hovy and
Daniel Marcu and
Eric Melz and
Deepak Ravichandran},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {Multiple-Engine Question Answering in TextMap},
booktitle = {Proceedings of The Twelfth Text REtrieval Conference, {TREC} 2003,
Gaithersburg, Maryland, USA, November 18-21, 2003},
series = {{NIST} Special Publication},
volume = {500-255},
pages = {772--781},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2003},
url = {http://trec.nist.gov/pubs/trec12/papers/usc-isi.qa.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/EchihabiHHMMR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/dgo/2003,
editor = {Yigal Arens and
Eduard H. Hovy and
Peggy Agouris},
title = {Proceedings of the 2003 Annual National Conference on Digital Government
Research, {DG.O} 2003, Boston, MA, USA, 2003},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2003},
url = {http://dl.acm.org/citation.cfm?id=1123196},
timestamp = {Sat, 07 Jul 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/dgo/2003.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/RadevHM02,
author = {Dragomir R. Radev and
Eduard H. Hovy and
Kathleen R. McKeown},
title = {Introduction to the Special Issue on Summarization},
journal = {Comput. Linguistics},
volume = {28},
number = {4},
pages = {399--408},
year = {2002},
url = {https://doi.org/10.1162/089120102762671927},
doi = {10.1162/089120102762671927},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/coling/RadevHM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mt/HovyKP02,
author = {Eduard H. Hovy and
Margaret King and
Andrei Popescu{-}Belis},
title = {Principles of Context-Based Machine Translation Evaluation},
journal = {Mach. Transl.},
volume = {17},
number = {1},
pages = {43--75},
year = {2002},
url = {https://doi.org/10.1023/A:1025510524115},
doi = {10.1023/A:1025510524115},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/mt/HovyKP02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RavichandranH02,
author = {Deepak Ravichandran and
Eduard H. Hovy},
title = {Learning surface text patterns for a Question Answering System},
booktitle = {Proceedings of the 40th Annual Meeting of the Association for Computational
Linguistics, July 6-12, 2002, Philadelphia, PA, {USA}},
pages = {41--47},
publisher = {{ACL}},
year = {2002},
url = {https://aclanthology.org/P02-1006/},
doi = {10.3115/1073083.1073092},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RavichandranH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LinH02,
author = {Chin{-}Yew Lin and
Eduard H. Hovy},
title = {From Single to Multi-document Summarization},
booktitle = {Proceedings of the 40th Annual Meeting of the Association for Computational
Linguistics, July 6-12, 2002, Philadelphia, PA, {USA}},
pages = {457--464},
publisher = {{ACL}},
year = {2002},
url = {https://aclanthology.org/P02-1058/},
doi = {10.3115/1073083.1073160},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LinH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/FleischmanH02,
author = {Michael Fleischman and
Eduard H. Hovy},
title = {Fine Grained Classification of Named Entities},
booktitle = {19th International Conference on Computational Linguistics, {COLING}
2002, Howard International House and Academia Sinica, Taipei, Taiwan,
August 24 - September 1, 2002},
year = {2002},
url = {https://aclanthology.org/C02-1130/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/FleischmanH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/HovyHLR02,
author = {Eduard H. Hovy and
Ulf Hermjakob and
Chin{-}Yew Lin and
Deepak Ravichandran},
title = {Using Knowledge to Facilitate Factoid Answer Pinpointing},
booktitle = {19th International Conference on Computational Linguistics, {COLING}
2002, Howard International House and Academia Sinica, Taipei, Taiwan,
August 24 - September 1, 2002},
year = {2002},
url = {https://aclanthology.org/C02-1042/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/HovyHLR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/AmbiteABDHKPPRSSTZ02,
author = {Jos{\'{e}} Luis Ambite and
Yigal Arens and
Walter Bourne and
Peter T. Davis and
Eduard H. Hovy and
Judith L. Klavans and
Andrew Philpot and
Samuel D. Popper and
Kenneth A. Ross and
Ju{-}Ling Shih and
Peter Sommer and
Surabhan Temiyabutr and
Laura Zadoff},
title = {A Portal for Access to Complex Distributed Information about Energy},
booktitle = {Proceedings of the 2002 Annual National Conference on Digital Government
Research, {DG.O} 2002, Los Angeles, CA, USA, 2002},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2002},
url = {http://dl.acm.org/citation.cfm?id=1123161},
timestamp = {Sat, 07 Jul 2018 14:13:59 +0200},
biburl = {https://dblp.org/rec/conf/dgo/AmbiteABDHKPPRSSTZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/PhilpotAH02,
author = {Andrew Philpot and
Jos{\'{e}} Luis Ambite and
Eduard H. Hovy},
title = {{DGRC} AskCal: Natural Language Question Answering for Energy Time
Series},
booktitle = {Proceedings of the 2002 Annual National Conference on Digital Government
Research, {DG.O} 2002, Los Angeles, CA, USA, 2002},
series = {{ACM} International Conference Proceeding Series},
publisher = {Digital Government Research Center},
year = {2002},
url = {http://dl.acm.org/citation.cfm?id=1123122},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/PhilpotAH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/FleischmanH02,
author = {Michael Fleischman and
Eduard H. Hovy},
title = {Towards Emotional Variation in Speech-Based Natural Language Processing},
booktitle = {Proceedings of the International Natural Language Generation Conference,
Harriman, New York, USA, July 2002},
pages = {57--64},
publisher = {Association for Computational Linguistics},
year = {2002},
url = {https://aclanthology.org/W02-2108/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/FleischmanH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/HovyKP02,
author = {Eduard H. Hovy and
Margaret King and
Andrei Popescu{-}Belis},
title = {Computer-Aided Specification of Quality Models for Machine Translation
Evaluation},
booktitle = {Proceedings of the Third International Conference on Language Resources
and Evaluation, {LREC} 2002, May 29-31, 2002, Las Palmas, Canary Islands,
Spain},
publisher = {European Language Resources Association},
year = {2002},
url = {http://www.lrec-conf.org/proceedings/lrec2002/sumarios/5.htm},
timestamp = {Mon, 19 Aug 2019 15:23:48 +0200},
biburl = {https://dblp.org/rec/conf/lrec/HovyKP02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pricai/Hovy02,
author = {Eduard H. Hovy},
editor = {Mitsuru Ishizuka and
Abdul Sattar},
title = {Learning, Collecting, and Using Ontological Knowledge for {NLP}},
booktitle = {{PRICAI} 2002: Trends in Artificial Intelligence, 7th Pacific Rim
International Conference on Artificial Intelligence, Tokyo, Japan,
August 18-22, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2417},
pages = {6},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-45683-X\_2},
doi = {10.1007/3-540-45683-X\_2},
timestamp = {Tue, 14 May 2019 10:00:46 +0200},
biburl = {https://dblp.org/rec/conf/pricai/Hovy02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/ads/AmbiteABFGHHKPRRSSSSSTWZ02,
author = {Jos{\'{e}} Luis Ambite and
Yigal Arens and
Walter Bourne and
Steven Feiner and
Luis Gravano and
Vasileios Hatzivassiloglou and
Eduard H. Hovy and
Judith Klavans and
Andrew Philpot and
Usha Ramachandran and
Kenneth A. Ross and
Jay Sandhaus and
Deniz Sari{\"{o}}z and
Rolfe R. Schmidt and
Cyrus Shahabi and
Anurag Singla and
Surabhan Temiyabutr and
Brian Whitman and
Kazi A. Zaman},
editor = {William J. McIver Jr. and
Ahmed K. Elmagarmid},
title = {Data Integration and Access - The Digital Government Research Center's
Energy Data Collection {(EDC)} Project},
booktitle = {Advances in Digital Government - Technology, Human Factors, and Policy},
series = {Advances in Database Systems},
volume = {26},
pages = {85--106},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/0-306-47374-7\_5},
doi = {10.1007/0-306-47374-7\_5},
timestamp = {Tue, 16 May 2017 14:24:24 +0200},
biburl = {https://dblp.org/rec/series/ads/AmbiteABFGHHKPRRSSSSSTWZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/AmbiteAHPGHK01,
author = {Jos{\'{e}} Luis Ambite and
Yigal Arens and
Eduard H. Hovy and
Andrew Philpot and
Luis Gravano and
Vasileios Hatzivassiloglou and
Judith Klavans},
title = {Simplifying Data Access: The Energy Data Collection Project},
journal = {Computer},
volume = {34},
number = {2},
pages = {47--54},
year = {2001},
url = {https://doi.org/10.1109/2.901167},
doi = {10.1109/2.901167},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/computer/AmbiteAHPGHK01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lre/FrederkingHI01,
author = {Robert E. Frederking and
Eduard H. Hovy and
Nancy Ide},
title = {Introduction to the Special Issue on Multi-Lingual Information Management},
journal = {Comput. Humanit.},
volume = {35},
number = {4},
pages = {369--370},
year = {2001},
url = {https://doi.org/10.1023/A:1011854206510},
doi = {10.1023/A:1011854206510},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lre/FrederkingHI01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/HovyGHLR01,
author = {Eduard H. Hovy and
Laurie Gerber and
Ulf Hermjakob and
Chin{-}Yew Lin and
Deepak Ravichandran},
title = {Toward Semantics-Based Answer Pinpointing},
booktitle = {Proceedings of the First International Conference on Human Language
Technology Research, {HLT} 2001, San Diego, California, USA, March
18-21, 2001},
publisher = {Morgan Kaufmann},
year = {2001},
url = {https://aclanthology.org/H01-1069/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/HovyGHLR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/HovyHL01,
author = {Eduard H. Hovy and
Ulf Hermjakob and
Chin{-}Yew Lin},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {The Use of External Knowledge of Factoid {QA}},
booktitle = {Proceedings of The Tenth Text REtrieval Conference, {TREC} 2001, Gaithersburg,
Maryland, USA, November 13-16, 2001},
series = {{NIST} Special Publication},
volume = {500-250},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2001},
url = {http://trec.nist.gov/pubs/trec10/papers/TREC10-webclopedia.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/HovyHL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ijcai/2001ol,
editor = {Alexander Maedche and
Steffen Staab and
Claire Nedellec and
Eduard H. Hovy},
title = {IJCAI'2001 Workshop on Ontology Learning, Proceedings of the Second
Workshop on Ontology Learning OL'2001, Seattle, USA, August 4, 2001
(Held in conjunction with the 17th International Conference on Artificial
Intelligence IJCAI'2001)},
series = {{CEUR} Workshop Proceedings},
volume = {38},
publisher = {CEUR-WS.org},
year = {2001},
url = {https://ceur-ws.org/Vol-38},
urn = {urn:nbn:de:0074-38-3},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ijcai/2001ol.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-CL-0109031,
author = {Eneko Agirre and
Olatz Ansa and
Eduard H. Hovy and
David Mart{\'{\i}}nez},
title = {Enriching WordNet concepts with topic signatures},
journal = {CoRR},
volume = {cs.CL/0109031},
year = {2001},
url = {https://arxiv.org/abs/cs/0109031},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-CL-0109031.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/LinH00,
author = {Chin{-}Yew Lin and
Eduard H. Hovy},
title = {The Automated Acquisition of Topic Signatures for Text Summarization},
booktitle = {{COLING} 2000, 18th International Conference on Computational Linguistics,
Proceedings of the Conference, 2 Volumes, July 31 - August 4, 2000,
Universit{\"{a}}t des Saarlandes, Saarbr{\"{u}}cken, Germany},
pages = {495--501},
publisher = {Morgan Kaufmann},
year = {2000},
url = {https://aclanthology.org/C00-1072/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/LinH00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/AmbiteAGHHKPRSSW00,
author = {Jos{\'{e}} Luis Ambite and
Yigal Arens and
Luis Gravano and
Vasileios Hatzivassiloglou and
Eduard H. Hovy and
Judith L. Klavans and
Andrew Philpot and
Usha Ramachandran and
Jay Sandhaus and
Anurag Singla and
Brian Whitman},
title = {Simplifying data access: the energy data collection {(EDC)} project},
booktitle = {Proceedings of the 2000 National Conference on Digital Government
Research, {DG.O} 2000, Los Angeles, CA, USA, May 15-17, 2000},
series = {{ACM} International Conference Proceeding Series},
volume = {128},
publisher = {Digital Government Research Center},
year = {2000},
url = {http://dl.acm.org/citation.cfm?id=1123091},
timestamp = {Sat, 07 Jul 2018 14:17:09 +0200},
biburl = {https://dblp.org/rec/conf/dgo/AmbiteAGHHKPRSSW00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dgo/HovyK00,
author = {Eduard H. Hovy and
Judith L. Klavans},
title = {The energy data collection project},
booktitle = {Proceedings of the 2000 National Conference on Digital Government
Research, {DG.O} 2000, Los Angeles, CA, USA, May 15-17, 2000},
series = {{ACM} International Conference Proceeding Series},
volume = {128},
publisher = {Digital Government Research Center},
year = {2000},
url = {http://dl.acm.org/citation.cfm?id=1123080},
timestamp = {Fri, 20 Nov 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/dgo/HovyK00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecai/AgirreAHM00,
author = {Eneko Agirre and
Olatz Ansa and
Eduard H. Hovy and
David Mart{\'{\i}}nez},
editor = {Steffen Staab and
Alexander Maedche and
Claire Nedellec and
Peter M. Wiemer{-}Hastings},
title = {Enriching very large ontologies using the {WWW}},
booktitle = {ECAI'2000 Workshop on Ontology Learning, Proceedings of the First
Workshop on Ontology Learning OL'2000, Berlin, Germany, August 25,
2000. Held in conjunction with the 14th European Conference on Artificial
Intelligence ECAI'2000, Berlin, Germany},
series = {{CEUR} Workshop Proceedings},
volume = {31},
publisher = {CEUR-WS.org},
year = {2000},
url = {https://ceur-ws.org/Vol-31/EAgirre\_14.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:14 +0100},
biburl = {https://dblp.org/rec/conf/ecai/AgirreAHM00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/HovyGHJL00,
author = {Eduard H. Hovy and
Laurie Gerber and
Ulf Hermjakob and
Michael Junk and
Chin{-}Yew Lin},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {Question Answering in Webclopedia},
booktitle = {Proceedings of The Ninth Text REtrieval Conference, {TREC} 2000, Gaithersburg,
Maryland, USA, November 13-16, 2000},
series = {{NIST} Special Publication},
volume = {500-249},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2000},
url = {http://trec.nist.gov/pubs/trec9/papers/webclopedia.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/HovyGHJL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-CL-0010026,
author = {Eneko Agirre and
Olatz Ansa and
Eduard H. Hovy and
David Mart{\'{\i}}nez},
title = {Enriching very large ontologies using the {WWW}},
journal = {CoRR},
volume = {cs.CL/0010026},
year = {2000},
url = {https://arxiv.org/abs/cs/0010026},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-CL-0010026.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/GreenCKSCRHHHFOS99,
author = {Nancy L. Green and
Jennifer Chu{-}Carroll and
David Kortenkamp and
Alan C. Schultz and
Michael H. Coen and
Dragomir R. Radev and
Eduard H. Hovy and
Peter Haddawy and
Steve Hanks and
Eugene C. Freuder and
Charlie Ortiz and
Sandip Sen},
title = {The {AAAI} Spring Symposia},
journal = {{AI} Mag.},
volume = {20},
number = {3},
pages = {83--86},
year = {1999},
url = {https://doi.org/10.1609/aimag.v20i3.1469},
doi = {10.1609/AIMAG.V20I3.1469},
timestamp = {Mon, 22 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aim/GreenCKSCRHHHFOS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mtsummit/KingHTWZ99,
author = {Margaret King and
Eduard H. Hovy and
Benjamin K. Tsou and
John White and
Yusoff Zaharin},
title = {{MT} evaluation},
booktitle = {Proceedings of Machine Translation Summit VII, MTSummit 1999, Singapore,
September 13-17, 1999},
pages = {197--207},
year = {1999},
url = {https://aclanthology.org/1999.mtsummit-1.31},
timestamp = {Mon, 20 Sep 2021 17:44:14 +0200},
biburl = {https://dblp.org/rec/conf/mtsummit/KingHTWZ99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/GerberH98,
author = {Laurie Gerber and
Eduard H. Hovy},
editor = {David Farwell and
Laurie Gerber and
Eduard H. Hovy},
title = {Improving Translation Quality by Manipulating Sentence Length},
booktitle = {Machine Translation and the Information Soup, Third Conference of
the Association for Machine Translation in the Americas, {AMTA} '98,
Langhorne, PA, USA, October 28-31, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1529},
pages = {448--460},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/3-540-49478-2\_40},
doi = {10.1007/3-540-49478-2\_40},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/amta/GerberH98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/Hovy98,
author = {Eduard H. Hovy},
title = {Combining and standardizing large- scale, practical ontologies for
machine tranlation and other uses},
booktitle = {Proceedings of the First International Conference on Language Resources
and Evaluation, {LREC} 1998, May 28-30, 1998, Granada, Spain},
pages = {535--542},
publisher = {European Language Resources Association},
year = {1998},
timestamp = {Fri, 25 Jun 2021 14:29:28 +0200},
biburl = {https://dblp.org/rec/conf/lrec/Hovy98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tipster/HovyL98,
author = {Eduard H. Hovy and
Chin{-}Yew Lin},
title = {Automated Text Summarization and the {SUMMARIST} System},
booktitle = {{TIPSTER} {TEXT} {PROGRAM} {PHASE} {III:} Proceedings of a Workshop
held at Baltimore, MD, USA, October 13-15, 1998},
pages = {197--214},
publisher = {Morgan Kaufmann},
year = {1998},
url = {https://aclanthology.org/X98-1026/},
doi = {10.3115/1119089.1119121},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/tipster/HovyL98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/amta/1998,
editor = {David Farwell and
Laurie Gerber and
Eduard H. Hovy},
title = {Machine Translation and the Information Soup, Third Conference of
the Association for Machine Translation in the Americas, {AMTA} '98,
Langhorne, PA, USA, October 28-31, 1998, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1529},
publisher = {Springer},
year = {1998},
url = {https://doi.org/10.1007/3-540-49478-2},
doi = {10.1007/3-540-49478-2},
isbn = {3-540-65259-0},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/1998.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anlp/LinH97,
author = {Chin{-}Yew Lin and
Eduard H. Hovy},
title = {Identifying Topics by Position},
booktitle = {5th Applied Natural Language Processing Conference, {ANLP} 1997, Marriott
Hotel, Washington, USA, March 31 - April 3, 1997},
pages = {283--290},
publisher = {{ACL}},
year = {1997},
url = {https://aclanthology.org/A97-1042/},
doi = {10.3115/974557.974599},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anlp/LinH97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/HovyCGLMNW96,
author = {Eduard H. Hovy and
Kenneth Church and
Denis Gachot and
Marge Leon and
Alan K. Melby and
Sergei Nirenburg and
Yorick Wilks},
title = {Panel: The limits of automation: optimists vs skeptics},
booktitle = {Conference of the Association for Machine Translation in the Americas,
{AMTA} 1996, Montreal, Canada, October 2-5, 1996},
year = {1996},
url = {https://aclanthology.org/1996.amta-1.24/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/HovyCGLMNW96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/KnightACHLWY96,
author = {Kevin Knight and
Yaser Al{-}Onaizan and
Ishwar Chander and
Eduard H. Hovy and
Irene Langkilde and
Richard Whitney and
Kenji Yamada},
title = {{JAPANGLOSS:} using statistics to fill knowledge gaps},
booktitle = {Conference of the Association for Machine Translation in the Americas,
{AMTA} 1996, Montreal, Canada, October 2-5, 1996},
year = {1996},
url = {https://aclanthology.org/1996.amta-1.31/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/KnightACHLWY96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/DalianisH96,
author = {Hercules Dalianis and
Eduard H. Hovy},
title = {On Lexical Aggregation and Ordering},
booktitle = {Eighth International Natural Language Generation Workshop, {INLG}
1996, Herstmonceux Castle, Sussex, UK, June 12-15, 1996 - Posters
and Demonstrations},
year = {1996},
url = {https://aclanthology.org/W96-0508/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/DalianisH96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/WannerH96,
author = {Leo Wanner and
Eduard H. Hovy},
title = {The HealthDoc Sentence Planner},
booktitle = {Eighth International Natural Language Generation Workshop, {INLG}
1996, Herstmonceux Castle, Sussex, UK, June 12-15, 1996},
year = {1996},
url = {https://aclanthology.org/W96-0401/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/WannerH96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/SmedtHMM95,
author = {Koenraad De Smedt and
Eduard H. Hovy and
David D. McDonald and
Marie Meteer},
title = {The Seventh International Workshop on Natural Language Generation},
journal = {{AI} Mag.},
volume = {16},
number = {3},
pages = {67--68},
year = {1995},
url = {https://doi.org/10.1609/aimag.v16i3.1150},
doi = {10.1609/AIMAG.V16I3.1150},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/SmedtHMM95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/air/ArensH95,
author = {Yigal Arens and
Eduard H. Hovy},
title = {The Design of a Model-Based Multimedia Interaction Manager},
journal = {Artif. Intell. Rev.},
volume = {9},
number = {2-3},
pages = {167--188},
year = {1995},
url = {https://doi.org/10.1007/BF00849178},
doi = {10.1007/BF00849178},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/air/ArensH95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/KnightCHHHILWY95,
author = {Kevin Knight and
Ishwar Chander and
Matthew Haines and
Vasileios Hatzivassiloglou and
Eduard H. Hovy and
Masayo Iida and
Steve K. Luk and
Richard Whitney and
Kenji Yamada},
title = {Filling Knowledge Gaps in a Broad-Coverage Machine Translation System},
booktitle = {Proceedings of the Fourteenth International Joint Conference on Artificial
Intelligence, {IJCAI} 95, Montr{\'{e}}al Qu{\'{e}}bec, Canada,
August 20-25 1995, 2 Volumes},
pages = {1390--1397},
publisher = {Morgan Kaufmann},
year = {1995},
url = {http://ijcai.org/Proceedings/95-2/Papers/048.pdf},
timestamp = {Tue, 20 Aug 2019 16:17:30 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/KnightCHHHILWY95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-cmp-lg-9506009,
author = {Kevin Knight and
Ishwar Chander and
Matthew Haines and
Vasileios Hatzivassiloglou and
Eduard H. Hovy and
Masayo Iida and
Steve K. Luk and
Richard Whitney and
Kenji Yamada},
title = {Filling Knowledge Gaps in a Broad-Coverage Machine Translation System},
journal = {CoRR},
volume = {abs/cmp-lg/9506009},
year = {1995},
url = {http://arxiv.org/abs/cmp-lg/9506009},
eprinttype = {arXiv},
eprint = {cmp-lg/9506009},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-cmp-lg-9506009.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/CarbonellFFHHKL94,
author = {Jaime G. Carbonell and
David Farwell and
Robert E. Frederking and
Stephen Helmreich and
Eduard H. Hovy and
Kevin Knight and
Lori S. Levin and
Sergei Nirenburg},
title = {{PANGLOSS}},
booktitle = {Proceedings of the First Conference of the Association for Machine
Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA,
October 5-8, 1994},
year = {1994},
url = {https://aclanthology.org/1994.amta-1.41/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/CarbonellFFHHKL94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/ChurchDHNST94,
author = {Kenneth Church and
Bonnie J. Dorr and
Eduard H. Hovy and
Sergei Nirenburg and
Bernard Scott and
Virginia Teller},
title = {Is {MT} Research Doing Any Good?},
booktitle = {Proceedings of the First Conference of the Association for Machine
Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA,
October 5-8, 1994},
year = {1994},
url = {https://aclanthology.org/1994.amta-1.27/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/ChurchDHNST94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/FrederkingNFHHK94,
author = {Robert E. Frederking and
Sergei Nirenburg and
David Farwell and
Stephen Helmreich and
Eduard H. Hovy and
Kevin Knight and
Stephen Beale and
Constantino Domashnev and
Donalee Attardo and
Dean Grannes and
Ralf D. Brown},
title = {Integrating Translations from Multiple Sources within the {PANGLOSS}
Mark {III} Machine Translation System},
booktitle = {Proceedings of the First Conference of the Association for Machine
Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA,
October 5-8, 1994},
year = {1994},
url = {https://aclanthology.org/1994.amta-1.10/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/FrederkingNFHHK94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/KnightCHHHILOWY94,
author = {Kevin Knight and
Ishwar Chander and
Matthew Haines and
Vasileios Hatzivassiloglou and
Eduard H. Hovy and
Masayo Iida and
Steve K. Luk and
Akitoshi Okumura and
Richard Whitney and
Kenji Yamada},
title = {Integrating Knowledge Bases and Statistics in {MT}},
booktitle = {Proceedings of the First Conference of the Association for Machine
Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA,
October 5-8, 1994},
year = {1994},
url = {https://aclanthology.org/1994.amta-1.18/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/KnightCHHHILOWY94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amta/OkumuraH94,
author = {Akitoshi Okumura and
Eduard H. Hovy},
title = {Lexicon-to-Ontology Concept Association Using a Bilingual Dictionary},
booktitle = {Proceedings of the First Conference of the Association for Machine
Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA,
October 5-8, 1994},
year = {1994},
url = {https://aclanthology.org/1994.amta-1.23/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amta/OkumuraH94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/LavidH94,
author = {Julia Lavid and
Eduard H. Hovy},
title = {Toward a Multidimensional Framework to Guide the Automated Generation
of Text Types},
booktitle = {Proceedings of the Seventh International Workshop on Natural Language
Generation, {INLG} 1994, Kennebunkport, Maine, USA, June 21-24, 1994},
year = {1994},
url = {https://aclanthology.org/W94-0328/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/LavidH94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Hovy94,
author = {Eduard H. Hovy},
title = {Session 4: Machine Translation},
booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro,
New Jerey, USA, March 8-11, 1994},
publisher = {Morgan Kaufmann},
year = {1994},
url = {https://aclanthology.org/H94-1023/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Hovy94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Hovy94a,
author = {Eduard H. Hovy},
title = {{PANGLOSS:} Knowledge-Based Machine Translation},
booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro,
New Jerey, USA, March 8-11, 1994},
publisher = {Morgan Kaufmann},
year = {1994},
url = {https://aclanthology.org/H94-1121/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Hovy94a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/OkumuraH94,
author = {Akitoshi Okumura and
Eduard H. Hovy},
title = {Building Japanese-English Dictionary based on Ontology for Machine
Translation},
booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro,
New Jerey, USA, March 8-11, 1994},
publisher = {Morgan Kaufmann},
year = {1994},
url = {https://aclanthology.org/H94-1025/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/OkumuraH94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/KnightCHHHILOWY94,
author = {Kevin Knight and
Ishwar Chander and
Matthew Haines and
Vasileios Hatzivassiloglou and
Eduard H. Hovy and
Masayo Iida and
Steve K. Luk and
Akitoshi Okumura and
Richard Whitney and
Kenji Yamada},
title = {Integrating Knowledge Bases and Statistics in {MT}},
journal = {CoRR},
volume = {abs/cmp-lg/9409001},
year = {1994},
url = {http://arxiv.org/abs/cmp-lg/9409001},
eprinttype = {arXiv},
eprint = {cmp-lg/9409001},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/KnightCHHHILOWY94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/Hovy93,
author = {Eduard H. Hovy},
title = {Automated Discourse Generation Using Discourse Structure Relations},
journal = {Artif. Intell.},
volume = {63},
number = {1-2},
pages = {341--385},
year = {1993},
url = {https://doi.org/10.1016/0004-3702(93)90021-3},
doi = {10.1016/0004-3702(93)90021-3},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ai/Hovy93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mt/ChurchH93,
author = {Kenneth Ward Church and
Eduard H. Hovy},
title = {Good applications for crummy machine translation},
journal = {Mach. Transl.},
volume = {8},
number = {4},
pages = {239--258},
year = {1993},
url = {https://doi.org/10.1007/BF00981759},
doi = {10.1007/BF00981759},
timestamp = {Tue, 24 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/mt/ChurchH93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ewnlg/DalianisH93,
author = {Hercules Dalianis and
Eduard H. Hovy},
editor = {Giovanni Adorni and
Michael Zock},
title = {Aggregation in Natural Language Generation},
booktitle = {Trends in Natural Language Generation, An Artificial Intelligence
Perspective, Fourth European Workshop, {EWNLG} '93, Pisa, Italy, April
28-30, 1993, Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {1036},
pages = {88--105},
publisher = {Springer},
year = {1993},
url = {https://doi.org/10.1007/3-540-60800-1\_25},
doi = {10.1007/3-540-60800-1\_25},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/ewnlg/DalianisH93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/ArensHM93,
author = {Yigal Arens and
Eduard H. Hovy and
Susanne van Mulken},
editor = {Ruzena Bajcsy},
title = {Structure and Rules in Automated Multimedia Presentation Planning},
booktitle = {Proceedings of the 13th International Joint Conference on Artificial
Intelligence. Chamb{\'{e}}ry, France, August 28 - September 3,
1993},
pages = {1253--1261},
publisher = {Morgan Kaufmann},
year = {1993},
timestamp = {Tue, 20 Aug 2019 16:18:33 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/ArensHM93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Hovy93,
author = {Eduard H. Hovy},
title = {The {PENMAN} Project on Knowledge-Based Machine Translation},
booktitle = {Human Language Technology: Proceedings of a Workshop Held at Plainsboro,
New Jersey, USA, March 21-24, 1993},
publisher = {Morgan Kaufmann},
year = {1993},
url = {https://aclanthology.org/H93-1115/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Hovy93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/expert/Hovy92,
author = {Eduard H. Hovy},
title = {A New Level of Language Generation Technology: Capabilities and Possibilities},
journal = {{IEEE} Expert},
volume = {7},
number = {2},
pages = {12--17},
year = {1992},
url = {https://doi.org/10.1109/64.129278},
doi = {10.1109/64.129278},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/expert/Hovy92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Hovy92,
author = {Eduard H. Hovy},
title = {In-Depth Knowledge-Based Machine Translation},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman,
New York, USA, February 23-26, 1992},
publisher = {Morgan Kaufmann},
year = {1992},
url = {https://aclanthology.org/H92-1124/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Hovy92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/HovyN92,
author = {Eduard H. Hovy and
Sergei Nirenburg},
title = {Approximating an Interlingua in a Principled Way},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman,
New York, USA, February 23-26, 1992},
publisher = {Morgan Kaufmann},
year = {1992},
url = {https://aclanthology.org/H92-1052/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/HovyN92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nlg/HovyLMMP92,
author = {Eduard H. Hovy and
Julia Lavid and
Elisabeth Maier and
Vibhu O. Mittal and
C{\'{e}}cile Paris},
editor = {Robert Dale and
Eduard H. Hovy and
Dietmar F. R{\"{o}}sner and
Oliviero Stock},
title = {Employing Knowledge Resources in a New Text Planner Architecture},
booktitle = {Aspects of Automated Natural Language Generation, 6th International
Workshop on Natural Language Generation, Trento, Italy, April 5-7,
1992, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {587},
pages = {57--72},
publisher = {Springer},
year = {1992},
url = {https://doi.org/10.1007/3-540-55399-1\_5},
doi = {10.1007/3-540-55399-1\_5},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/nlg/HovyLMMP92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nlg/HovyKMNR92,
author = {Eduard H. Hovy and
Richard I. Kittredge and
Christian Matthiessen and
Sergei Nirenburg and
Dietmar F. R{\"{o}}sner},
editor = {Robert Dale and
Eduard H. Hovy and
Dietmar F. R{\"{o}}sner and
Oliviero Stock},
title = {Multilinguality and Generation},
booktitle = {Aspects of Automated Natural Language Generation, 6th International
Workshop on Natural Language Generation, Trento, Italy, April 5-7,
1992, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {587},
pages = {293--308},
publisher = {Springer},
year = {1992},
url = {https://doi.org/10.1007/3-540-55399-1\_24},
doi = {10.1007/3-540-55399-1\_24},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nlg/HovyKMNR92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nlg/1992,
editor = {Robert Dale and
Eduard H. Hovy and
Dietmar F. R{\"{o}}sner and
Oliviero Stock},
title = {Aspects of Automated Natural Language Generation, 6th International
Workshop on Natural Language Generation, Trento, Italy, April 5-7,
1992, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {587},
publisher = {Springer},
year = {1992},
url = {https://doi.org/10.1007/3-540-55399-1},
doi = {10.1007/3-540-55399-1},
isbn = {3-540-55399-1},
timestamp = {Tue, 14 May 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/nlg/1992.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/HovyA91,
author = {Eduard H. Hovy and
Yigal Arens},
editor = {Thomas L. Dean and
Kathleen R. McKeown},
title = {Automatic Generation of Formatted Text},
booktitle = {Proceedings of the 9th National Conference on Artificial Intelligence,
Anaheim, CA, USA, July 14-19, 1991, Volume 1},
pages = {92--97},
publisher = {{AAAI} Press / The {MIT} Press},
year = {1991},
url = {http://www.aaai.org/Library/AAAI/1991/aaai91-015.php},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/HovyA91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ArensHV91,
author = {Yigal Arens and
Eduard H. Hovy and
Mira Vossers},
editor = {Mark T. Maybury},
title = {On the Knowledge Underlying Multimedia Presentations},
booktitle = {Intelligent Multimedia Interfaces, the book is an outgrowth of the
{AAAI} Workshop on Intelligent Multimedia Interfaces, Anaheim, CA,
USA, August, 1991},
pages = {280--306},
publisher = {{AAAI} Press / The {MIT} Press},
year = {1991},
timestamp = {Fri, 23 Dec 2011 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaai/ArensHV91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Hovy91,
author = {Eduard H. Hovy},
title = {The Penman Natural Language Project Systemics-Based Machine Translation},
booktitle = {Speech and Natural Language, Proceedings of a Workshop held at Pacific
Grove, California, USA, February 19-22. 1991},
publisher = {Morgan Kaufmann},
year = {1991},
url = {https://aclanthology.org/H91-1106/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Hovy91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ai/Hovy90,
author = {Eduard H. Hovy},
title = {Pragmatics and Natural Language Generation},
journal = {Artif. Intell.},
volume = {43},
number = {2},
pages = {153--197},
year = {1990},
url = {https://doi.org/10.1016/0004-3702(90)90084-D},
doi = {10.1016/0004-3702(90)90084-D},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ai/Hovy90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/Hovy90,
author = {Eduard H. Hovy},
title = {Parsimonious and Profligate Approaches to the Question of Discourse
Structure Relations},
booktitle = {Proceedings of the Fifth International Workshop on Natural Language
Generation, {INLG} 1990, Dawson, Pennsylvania, USA, June 3-6, 1990},
publisher = {{ACL}},
year = {1990},
url = {https://aclanthology.org/W90-0117/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/Hovy90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/KasperH90,
author = {Robert T. Kasper and
Eduard H. Hovy},
title = {Performing Integrated Syntactic and Semantic Parsing Using Classification},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Hidden
Valley, Pennsylvania, USA, June 24-27, 1990},
publisher = {Morgan Kaufmann},
year = {1990},
url = {https://aclanthology.org/H90-1011/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/KasperH90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/WilksCFHN90,
author = {Yorick Wilks and
Jaime G. Carbonell and
David Farwell and
Eduard H. Hovy and
Sergei Nirenburg},
title = {Machine Translation Again?},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Hidden
Valley, Pennsylvania, USA, June 24-27, 1990},
publisher = {Morgan Kaufmann},
year = {1990},
url = {https://aclanthology.org/H90-1072/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/WilksCFHN90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/HovyMY89,
author = {Eduard H. Hovy and
David D. McDonald and
Sheryl R. Young},
title = {Current Issues in Natural Language Generation: An Overview of the
{AAAI} Workshop on Text Planning and Realization},
journal = {{AI} Mag.},
volume = {10},
number = {3},
pages = {27--29},
year = {1989},
url = {https://doi.org/10.1609/aimag.v10i3.760},
doi = {10.1609/AIMAG.V10I3.760},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/HovyMY89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Hovy89,
author = {Eduard H. Hovy},
title = {New Possibilities in Machine Translation},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Cape
Cod, Massachusetts, USA, {HLT} 1989, October 15-18, 1989},
publisher = {{ACL}},
year = {1989},
url = {https://aclanthology.org/H89-2015/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Hovy89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Hovy89a,
author = {Eduard H. Hovy},
title = {The Current Status of the Penman Language Generation System},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Cape
Cod, Massachusetts, USA, {HLT} 1989, October 15-18, 1989},
publisher = {{ACL}},
year = {1989},
url = {https://aclanthology.org/H89-2065/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Hovy89a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/MannH89,
author = {William C. Mann and
Eduard H. Hovy},
title = {The Penman Language Generation Project},
booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Philadelphia,
USA, {HLT} 1989, February 21-23, 1989},
publisher = {{ACL}},
year = {1989},
url = {https://aclanthology.org/H89-1021/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/MannH89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Hovy88,
author = {Eduard H. Hovy},
editor = {Jerry R. Hobbs},
title = {Planning Coherent Multisentential Text},
booktitle = {26th Annual Meeting of the Association for Computational Linguistics,
7-10 June 1988, State Univerity of New York at Buffalo, Buffalo, New
York, USA, Proceedings},
pages = {163--169},
publisher = {{ACL}},
year = {1988},
url = {https://aclanthology.org/P88-1020/},
doi = {10.3115/982023.982043},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Hovy88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Hovy88a,
author = {Eduard H. Hovy},
editor = {Jerry R. Hobbs},
title = {Two Types of Planning in Language Generation},
booktitle = {26th Annual Meeting of the Association for Computational Linguistics,
7-10 June 1988, State Univerity of New York at Buffalo, Buffalo, New
York, USA, Proceedings},
pages = {179--186},
publisher = {{ACL}},
year = {1988},
url = {https://aclanthology.org/P88-1022/},
doi = {10.3115/982023.982045},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Hovy88a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/Hovy87,
author = {Eduard H. Hovy},
editor = {Kenneth D. Forbus and
Howard E. Shrobe},
title = {Interpretation in Generation},
booktitle = {Proceedings of the 6th National Conference on Artificial Intelligence.
Seattle, WA, USA, July 1987},
pages = {545--549},
publisher = {Morgan Kaufmann},
year = {1987},
url = {http://www.aaai.org/Library/AAAI/1987/aaai87-097.php},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/Hovy87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/Hovy85,
author = {Eduard H. Hovy},
editor = {Aravind K. Joshi},
title = {Integrating Text Planning and Production in Generation},
booktitle = {Proceedings of the 9th International Joint Conference on Artificial
Intelligence. Los Angeles, CA, USA, August 1985},
pages = {848--851},
publisher = {Morgan Kaufmann},
year = {1985},
url = {http://ijcai.org/Proceedings/85-2/Papers/032.pdf},
timestamp = {Tue, 20 Aug 2019 16:19:04 +0200},
biburl = {https://dblp.org/rec/conf/ijcai/Hovy85.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-04-25 05:40 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
