Stop the war!
Остановите войну!
for scientists:
default search action
BibTeX records: Eduard H. Hovy
@article{DBLP:journals/corr/abs-2402-18005, author = {Miao Li and Jey Han Lau and Eduard H. Hovy}, title = {Exploring Multi-Document Information Consolidation for Scientific Sentiment Summarization}, journal = {CoRR}, volume = {abs/2402.18005}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2402.18005}, doi = {10.48550/ARXIV.2402.18005}, eprinttype = {arXiv}, eprint = {2402.18005}, timestamp = {Tue, 26 Mar 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2402-18005.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/WenXHH23, author = {Haoyang Wen and Zhenxin Xiao and Eduard H. Hovy and Alexander G. Hauptmann}, editor = {Anna Rogers and Jordan L. Boyd{-}Graber and Naoaki Okazaki}, title = {Towards Open-Domain Twitter User Profile Inference}, booktitle = {Findings of the Association for Computational Linguistics: {ACL} 2023, Toronto, Canada, July 9-14, 2023}, pages = {3172--3188}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.findings-acl.198}, doi = {10.18653/V1/2023.FINDINGS-ACL.198}, timestamp = {Thu, 10 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/WenXHH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/OtaniAKH23, author = {Naoki Otani and Jun Araki and HyeongSik Kim and Eduard H. Hovy}, editor = {Anna Rogers and Jordan L. Boyd{-}Graber and Naoaki Okazaki}, title = {A Textual Dataset for Situated Proactive Response Selection}, booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada, July 9-14, 2023}, pages = {3856--3874}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.acl-long.214}, doi = {10.18653/V1/2023.ACL-LONG.214}, timestamp = {Thu, 10 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/OtaniAKH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/TedeschiBDHHHKK23, author = {Simone Tedeschi and Johan Bos and Thierry Declerck and Jan Hajic and Daniel Hershcovich and Eduard H. Hovy and Alexander Koller and Simon Krek and Steven Schockaert and Rico Sennrich and Ekaterina Shutova and Roberto Navigli}, editor = {Anna Rogers and Jordan L. Boyd{-}Graber and Naoaki Okazaki}, title = {What's the Meaning of Superhuman Performance in Today's NLU?}, booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada, July 9-14, 2023}, pages = {12471--12491}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.acl-long.697}, doi = {10.18653/V1/2023.ACL-LONG.697}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/TedeschiBDHHHKK23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eacl/FengKSGH23, author = {Steven Y. Feng and Vivek Khetan and Bogdan Sacaleanu and Anatole Gershman and Eduard H. Hovy}, editor = {Andreas Vlachos and Isabelle Augenstein}, title = {{CHARD:} Clinical Health-Aware Reasoning Across Dimensions for Text Generation Models}, booktitle = {Proceedings of the 17th Conference of the European Chapter of the Association for Computational Linguistics, {EACL} 2023, Dubrovnik, Croatia, May 2-6, 2023}, pages = {313--327}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.eacl-main.24}, doi = {10.18653/V1/2023.EACL-MAIN.24}, timestamp = {Thu, 05 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eacl/FengKSGH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eacl/KehFGAH23, author = {Sedrick Scott Keh and Steven Y. Feng and Varun Gangal and Malihe Alikhani and Eduard H. Hovy}, editor = {Andreas Vlachos and Isabelle Augenstein}, title = {{PANCETTA:} Phoneme Aware Neural Completion to Elicit Tongue Twisters Automatically}, booktitle = {Proceedings of the 17th Conference of the European Chapter of the Association for Computational Linguistics, {EACL} 2023, Dubrovnik, Croatia, May 2-6, 2023}, pages = {491--504}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.eacl-main.36}, doi = {10.18653/V1/2023.EACL-MAIN.36}, timestamp = {Thu, 05 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eacl/KehFGAH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiHL23, author = {Miao Li and Eduard H. Hovy and Jey Han Lau}, editor = {Houda Bouamor and Juan Pino and Kalika Bali}, title = {Summarizing Multiple Documents with Conversational Structure for Meta-Review Generation}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2023, Singapore, December 6-10, 2023}, pages = {7089--7112}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.findings-emnlp.472}, doi = {10.18653/V1/2023.FINDINGS-EMNLP.472}, timestamp = {Fri, 12 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/LiHL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiHYEL00YTHJ23, author = {Sha Li and Chi Han and Pengfei Yu and Carl Edwards and Manling Li and Xingyao Wang and Yi Ren Fung and Charles Yu and Joel R. Tetreault and Eduard H. Hovy and Heng Ji}, editor = {Houda Bouamor and Juan Pino and Kalika Bali}, title = {Defining a New {NLP} Playground}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2023, Singapore, December 6-10, 2023}, pages = {11932--11951}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.findings-emnlp.799}, doi = {10.18653/V1/2023.FINDINGS-EMNLP.799}, timestamp = {Fri, 12 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/LiHYEL00YTHJ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhangSH23, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, editor = {Houda Bouamor and Juan Pino and Kalika Bali}, title = {Data-efficient Active Learning for Structured Prediction with Partial Annotation and Self-Training}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2023, Singapore, December 6-10, 2023}, pages = {12991--13008}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.findings-emnlp.865}, doi = {10.18653/V1/2023.FINDINGS-EMNLP.865}, timestamp = {Fri, 12 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnlp/RajagopalKSGFH23, author = {Dheeraj Rajagopal and Vivek Khetan and Bogdan Sacaleanu and Anatole Gershman and Andrew E. Fano and Eduard H. Hovy}, editor = {Jong C. Park and Yuki Arase and Baotian Hu and Wei Lu and Derry Wijaya and Ayu Purwarianti and Adila Alfa Krisnadhi}, title = {Template Filling for Controllable Commonsense Reasoning}, booktitle = {Findings of the Association for Computational Linguistics: {IJCNLP-AACL} 2023 - Findings, Nusa Dua, Bali, November 1-4, 2023}, pages = {250--260}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.findings-ijcnlp.23}, doi = {10.18653/V1/2023.FINDINGS-IJCNLP.23}, timestamp = {Fri, 12 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcnlp/RajagopalKSGFH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sustainlp/ZhangSH23, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, editor = {Nafise Sadat Moosavi and Iryna Gurevych and Yufang Hou and Gyuwan Kim and Young Jin Kim and Tal Schuster and Ameeta Agrawal}, title = {On the Interactions of Structural Constraints and Data Resources for Structured Prediction}, booktitle = {Proceedings of The Fourth Workshop on Simple and Efficient Natural Language Processing, SustaiNLP 2023, Toronto, Canada (Hybrid), July 13, 2023}, pages = {147--157}, publisher = {Association for Computational Linguistics}, year = {2023}, url = {https://doi.org/10.18653/v1/2023.sustainlp-1.10}, doi = {10.18653/V1/2023.SUSTAINLP-1.10}, timestamp = {Fri, 12 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sustainlp/ZhangSH23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-01498, author = {Miao Li and Eduard H. Hovy and Jey Han Lau}, title = {Towards Summarizing Multiple Documents with Hierarchical Relationships}, journal = {CoRR}, volume = {abs/2305.01498}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.01498}, doi = {10.48550/ARXIV.2305.01498}, eprinttype = {arXiv}, eprint = {2305.01498}, timestamp = {Fri, 05 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-01498.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-08414, author = {Simone Tedeschi and Johan Bos and Thierry Declerck and Jan Hajic and Daniel Hershcovich and Eduard H. Hovy and Alexander Koller and Simon Krek and Steven Schockaert and Rico Sennrich and Ekaterina Shutova and Roberto Navigli}, title = {What's the Meaning of Superhuman Performance in Today's NLU?}, journal = {CoRR}, volume = {abs/2305.08414}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.08414}, doi = {10.48550/ARXIV.2305.08414}, eprinttype = {arXiv}, eprint = {2305.08414}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-08414.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2305-12634, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, title = {Data-efficient Active Learning for Structured Prediction with Partial Annotation and Self-Training}, journal = {CoRR}, volume = {abs/2305.12634}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2305.12634}, doi = {10.48550/ARXIV.2305.12634}, eprinttype = {arXiv}, eprint = {2305.12634}, timestamp = {Fri, 26 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2305-12634.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2310-05189, author = {Isabelle Augenstein and Timothy Baldwin and Meeyoung Cha and Tanmoy Chakraborty and Giovanni Luca Ciampaglia and David P. A. Corney and Renee DiResta and Emilio Ferrara and Scott Hale and Alon Y. Halevy and Eduard H. Hovy and Heng Ji and Filippo Menczer and Rub{\'{e}}n M{\'{\i}}guez and Preslav Nakov and Dietram Scheufele and Shivam Sharma and Giovanni Zagni}, title = {Factuality Challenges in the Era of Large Language Models}, journal = {CoRR}, volume = {abs/2310.05189}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2310.05189}, doi = {10.48550/ARXIV.2310.05189}, eprinttype = {arXiv}, eprint = {2310.05189}, timestamp = {Fri, 20 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2310-05189.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2310-20633, author = {Sha Li and Chi Han and Pengfei Yu and Carl Edwards and Manling Li and Xingyao Wang and Yi R. Fung and Charles Yu and Joel R. Tetreault and Eduard H. Hovy and Heng Ji}, title = {Defining a New {NLP} Playground}, journal = {CoRR}, volume = {abs/2310.20633}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2310.20633}, doi = {10.48550/ARXIV.2310.20633}, eprinttype = {arXiv}, eprint = {2310.20633}, timestamp = {Fri, 17 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2310-20633.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2312-05603, author = {Shuhe Wang and Beiming Cao and Shengyu Zhang and Xiaoya Li and Jiwei Li and Fei Wu and Guoyin Wang and Eduard H. Hovy}, title = {Sim-GPT: Text Similarity via {GPT} Annotated Data}, journal = {CoRR}, volume = {abs/2312.05603}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2312.05603}, doi = {10.48550/ARXIV.2312.05603}, eprinttype = {arXiv}, eprint = {2312.05603}, timestamp = {Wed, 03 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2312-05603.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/FengLTAMHG22, author = {Steven Y. Feng and Kevin Lu and Zhuofu Tao and Malihe Alikhani and Teruko Mitamura and Eduard H. Hovy and Varun Gangal}, title = {Retrieve, Caption, Generate: Visual Grounding for Enhancing Commonsense in Text Generation Models}, booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI} 2022, Thirty-Fourth Conference on Innovative Applications of Artificial Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22 - March 1, 2022}, pages = {10618--10626}, publisher = {{AAAI} Press}, year = {2022}, url = {https://doi.org/10.1609/aaai.v36i10.21306}, doi = {10.1609/AAAI.V36I10.21306}, timestamp = {Mon, 04 Sep 2023 12:29:24 +0200}, biburl = {https://dblp.org/rec/conf/aaai/FengLTAMHG22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/GangalFAMH22, author = {Varun Gangal and Steven Y. Feng and Malihe Alikhani and Teruko Mitamura and Eduard H. Hovy}, title = {{NAREOR:} The Narrative Reordering Problem}, booktitle = {Thirty-Sixth {AAAI} Conference on Artificial Intelligence, {AAAI} 2022, Thirty-Fourth Conference on Innovative Applications of Artificial Intelligence, {IAAI} 2022, The Twelveth Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2022 Virtual Event, February 22 - March 1, 2022}, pages = {10645--10653}, publisher = {{AAAI} Press}, year = {2022}, url = {https://doi.org/10.1609/aaai.v36i10.21309}, doi = {10.1609/AAAI.V36I10.21309}, timestamp = {Mon, 04 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aaai/GangalFAMH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/KehLGFJAH22, author = {Sedrick Scott Keh and Kevin Lu and Varun Gangal and Steven Y. Feng and Harsh Jhamtani and Malihe Alikhani and Eduard H. Hovy}, editor = {Nicoletta Calzolari and Chu{-}Ren Huang and Hansaem Kim and James Pustejovsky and Leo Wanner and Key{-}Sun Choi and Pum{-}Mo Ryu and Hsin{-}Hsi Chen and Lucia Donatelli and Heng Ji and Sadao Kurohashi and Patrizia Paggio and Nianwen Xue and Seokhwan Kim and Younggyun Hahm and Zhong He and Tony Kyungil Lee and Enrico Santus and Francis Bond and Seung{-}Hoon Na}, title = {{PINEAPPLE:} Personifying INanimate Entities by Acquiring Parallel Personification Data for Learning Enhanced Generation}, booktitle = {Proceedings of the 29th International Conference on Computational Linguistics, {COLING} 2022, Gyeongju, Republic of Korea, October 12-17, 2022}, pages = {6270--6284}, publisher = {International Committee on Computational Linguistics}, year = {2022}, url = {https://aclanthology.org/2022.coling-1.547}, timestamp = {Thu, 13 Oct 2022 17:29:38 +0200}, biburl = {https://dblp.org/rec/conf/coling/KehLGFJAH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/SpiliopoulouPBH22, author = {Evangelia Spiliopoulou and Artidoro Pagnoni and Yonatan Bisk and Eduard H. Hovy}, editor = {Yoav Goldberg and Zornitsa Kozareva and Yue Zhang}, title = {EvEntS ReaLM: Event Reasoning of Entity States via Language Models}, booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates, December 7-11, 2022}, pages = {1982--1997}, publisher = {Association for Computational Linguistics}, year = {2022}, url = {https://doi.org/10.18653/v1/2022.emnlp-main.129}, doi = {10.18653/V1/2022.EMNLP-MAIN.129}, timestamp = {Thu, 10 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/SpiliopoulouPBH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhangSH22, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, editor = {Yoav Goldberg and Zornitsa Kozareva and Yue Zhang}, title = {Transfer Learning from Semantic Role Labeling to Event Argument Extraction with Template-based Slot Querying}, booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates, December 7-11, 2022}, pages = {2627--2647}, publisher = {Association for Computational Linguistics}, year = {2022}, url = {https://doi.org/10.18653/v1/2022.emnlp-main.169}, doi = {10.18653/V1/2022.EMNLP-MAIN.169}, timestamp = {Thu, 10 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ReddyCWFCEPNHSJ22, author = {Revanth Gangi Reddy and Sai Chetan Chinthakindi and Zhenhailong Wang and Yi R. Fung and Kathryn Conger and Ahmed Elsayed and Martha Palmer and Preslav Nakov and Eduard H. Hovy and Kevin Small and Heng Ji}, editor = {Yoav Goldberg and Zornitsa Kozareva and Yue Zhang}, title = {NewsClaims: {A} New Benchmark for Claim Detection from News with Attribute Knowledge}, booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates, December 7-11, 2022}, pages = {6002--6018}, publisher = {Association for Computational Linguistics}, year = {2022}, url = {https://doi.org/10.18653/v1/2022.emnlp-main.403}, doi = {10.18653/V1/2022.EMNLP-MAIN.403}, timestamp = {Thu, 10 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ReddyCWFCEPNHSJ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhangSH22a, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, editor = {Yoav Goldberg and Zornitsa Kozareva and Yue Zhang}, title = {A Survey of Active Learning for Natural Language Processing}, booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates, December 7-11, 2022}, pages = {6166--6190}, publisher = {Association for Computational Linguistics}, year = {2022}, url = {https://doi.org/10.18653/v1/2022.emnlp-main.414}, doi = {10.18653/V1/2022.EMNLP-MAIN.414}, timestamp = {Thu, 10 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH22a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/RajagopalZGJYH22, author = {Dheeraj Rajagopal and Xuchao Zhang and Michael Gamon and Sujay Kumar Jauhar and Diyi Yang and Eduard H. Hovy}, editor = {Nicoletta Calzolari and Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and Philippe Blache and Khalid Choukri and Christopher Cieri and Thierry Declerck and Sara Goggi and Hitoshi Isahara and Bente Maegaard and Joseph Mariani and H{\'{e}}l{\`{e}}ne Mazo and Jan Odijk and Stelios Piperidis}, title = {One Document, Many Revisions: {A} Dataset for Classification and Description of Edit Intents}, booktitle = {Proceedings of the Thirteenth Language Resources and Evaluation Conference, {LREC} 2022, Marseille, France, 20-25 June 2022}, pages = {5517--5524}, publisher = {European Language Resources Association}, year = {2022}, url = {https://aclanthology.org/2022.lrec-1.591}, timestamp = {Mon, 10 Oct 2022 16:57:52 +0200}, biburl = {https://dblp.org/rec/conf/lrec/RajagopalZGJYH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tsd/Echizen-yaAH22, author = {Hiroshi Echizen{-}ya and Kenji Araki and Eduard H. Hovy}, editor = {Petr Sojka and Ales Hor{\'{a}}k and Ivan Kopecek and Karel Pala}, title = {{OPTICS:} Automatic {MT} Evaluation Based on Optimal Transport by Integration of Contextual Representations and Static Word Embeddings}, booktitle = {Text, Speech, and Dialogue - 25th International Conference, {TSD} 2022, Brno, Czech Republic, September 6-9, 2022, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {13502}, pages = {225--237}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-16270-1\_19}, doi = {10.1007/978-3-031-16270-1\_19}, timestamp = {Mon, 28 Aug 2023 21:17:25 +0200}, biburl = {https://dblp.org/rec/conf/tsd/Echizen-yaAH22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2205-12416, author = {Dheeraj Rajagopal and Siamak Shakeri and C{\'{\i}}cero Nogueira dos Santos and Eduard H. Hovy and Chung{-}Ching Chang}, title = {Counterfactual Data Augmentation improves Factuality of Abstractive Summarization}, journal = {CoRR}, volume = {abs/2205.12416}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2205.12416}, doi = {10.48550/ARXIV.2205.12416}, eprinttype = {arXiv}, eprint = {2205.12416}, timestamp = {Mon, 30 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2205-12416.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-06275, author = {Sedrick Scott Keh and Steven Y. Feng and Varun Gangal and Malihe Alikhani and Eduard H. Hovy}, title = {{PANCETTA:} Phoneme Aware Neural Completion to Elicit Tongue Twisters Automatically}, journal = {CoRR}, volume = {abs/2209.06275}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.06275}, doi = {10.48550/ARXIV.2209.06275}, eprinttype = {arXiv}, eprint = {2209.06275}, timestamp = {Tue, 27 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-06275.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-07752, author = {Sedrick Scott Keh and Kevin Lu and Varun Gangal and Steven Y. Feng and Harsh Jhamtani and Malihe Alikhani and Eduard H. Hovy}, title = {{PINEAPPLE:} Personifying INanimate Entities by Acquiring Parallel Personification data for Learning Enhanced generation}, journal = {CoRR}, volume = {abs/2209.07752}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.07752}, doi = {10.48550/ARXIV.2209.07752}, eprinttype = {arXiv}, eprint = {2209.07752}, timestamp = {Tue, 27 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-07752.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-04191, author = {Steven Y. Feng and Vivek Khetan and Bogdan Sacaleanu and Anatole Gershman and Eduard H. Hovy}, title = {{CHARD:} Clinical Health-Aware Reasoning Across Dimensions for Text Generation Models}, journal = {CoRR}, volume = {abs/2210.04191}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.04191}, doi = {10.48550/ARXIV.2210.04191}, eprinttype = {arXiv}, eprint = {2210.04191}, timestamp = {Wed, 12 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-04191.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2210-10109, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, title = {A Survey of Active Learning for Natural Language Processing}, journal = {CoRR}, volume = {abs/2210.10109}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2210.10109}, doi = {10.48550/ARXIV.2210.10109}, eprinttype = {arXiv}, eprint = {2210.10109}, timestamp = {Mon, 24 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2210-10109.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-05392, author = {Evangelia Spiliopoulou and Artidoro Pagnoni and Yonatan Bisk and Eduard H. Hovy}, title = {EvEntS ReaLM: Event Reasoning of Entity States via Language Models}, journal = {CoRR}, volume = {abs/2211.05392}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.05392}, doi = {10.48550/ARXIV.2211.05392}, eprinttype = {arXiv}, eprint = {2211.05392}, timestamp = {Tue, 15 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-05392.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tacl/JoBRH21, author = {Yohan Jo and Seojin Bang and Chris Reed and Eduard H. Hovy}, title = {Classifying Argumentative Relations Using Logical Mechanisms and Argumentation Schemes}, journal = {Trans. Assoc. Comput. Linguistics}, volume = {9}, pages = {721--739}, year = {2021}, url = {https://doi.org/10.1162/tacl\_a\_00394}, doi = {10.1162/TACL\_A\_00394}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tacl/JoBRH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tacl/ElazarKRRHSG21, author = {Yanai Elazar and Nora Kassner and Shauli Ravfogel and Abhilasha Ravichander and Eduard H. Hovy and Hinrich Sch{\"{u}}tze and Yoav Goldberg}, title = {Measuring and Improving Consistency in Pretrained Language Models}, journal = {Trans. Assoc. Comput. Linguistics}, volume = {9}, pages = {1012--1031}, year = {2021}, url = {https://doi.org/10.1162/tacl\_a\_00410}, doi = {10.1162/TACL\_A\_00410}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tacl/ElazarKRRHSG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tacl/ElazarKRRHSG21a, author = {Yanai Elazar and Nora Kassner and Shauli Ravfogel and Abhilasha Ravichander and Eduard H. Hovy and Hinrich Sch{\"{u}}tze and Yoav Goldberg}, title = {Erratum: Measuring and Improving Consistency in Pretrained Language Models}, journal = {Trans. Assoc. Comput. Linguistics}, volume = {9}, pages = {1407}, year = {2021}, url = {https://doi.org/10.1162/tacl\_x\_00455}, doi = {10.1162/TACL\_X\_00455}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tacl/ElazarKRRHSG21a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/FengGWCVMH21, author = {Steven Y. Feng and Varun Gangal and Jason Wei and Sarath Chandar and Soroush Vosoughi and Teruko Mitamura and Eduard H. Hovy}, editor = {Chengqing Zong and Fei Xia and Wenjie Li and Roberto Navigli}, title = {A Survey of Data Augmentation Approaches for {NLP}}, booktitle = {Findings of the Association for Computational Linguistics: {ACL/IJCNLP} 2021, Online Event, August 1-6, 2021}, series = {Findings of {ACL}}, volume = {{ACL/IJCNLP} 2021}, pages = {968--988}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.findings-acl.84}, doi = {10.18653/V1/2021.FINDINGS-ACL.84}, timestamp = {Fri, 27 Aug 2021 08:39:19 +0200}, biburl = {https://dblp.org/rec/conf/acl/FengGWCVMH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/BhardwajMPH20, author = {Rishabh Bhardwaj and Navonil Majumder and Soujanya Poria and Eduard H. Hovy}, editor = {Chengqing Zong and Fei Xia and Wenjie Li and Roberto Navigli}, title = {More Identifiable yet Equally Performant Transformers for Text Classification}, booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational Linguistics and the 11th International Joint Conference on Natural Language Processing, {ACL/IJCNLP} 2021, (Volume 1: Long Papers), Virtual Event, August 1-6, 2021}, pages = {1172--1182}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.acl-long.94}, doi = {10.18653/V1/2021.ACL-LONG.94}, timestamp = {Mon, 09 Aug 2021 16:25:37 +0200}, biburl = {https://dblp.org/rec/conf/acl/BhardwajMPH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/KangH20a, author = {Dongyeop Kang and Eduard H. Hovy}, editor = {Chengqing Zong and Fei Xia and Wenjie Li and Roberto Navigli}, title = {Style is {NOT} a single variable: Case Studies for Cross-Stylistic Language Understanding}, booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational Linguistics and the 11th International Joint Conference on Natural Language Processing, {ACL/IJCNLP} 2021, (Volume 1: Long Papers), Virtual Event, August 1-6, 2021}, pages = {2376--2387}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.acl-long.185}, doi = {10.18653/V1/2021.ACL-LONG.185}, timestamp = {Mon, 09 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/KangH20a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/GangalJHB21, author = {Varun Gangal and Harsh Jhamtani and Eduard H. Hovy and Taylor Berg{-}Kirkpatrick}, editor = {Chengqing Zong and Fei Xia and Wenjie Li and Roberto Navigli}, title = {Improving Automated Evaluation of Open Domain Dialog via Diverse Reference Augmentation}, booktitle = {Findings of the Association for Computational Linguistics: {ACL/IJCNLP} 2021, Online Event, August 1-6, 2021}, series = {Findings of {ACL}}, volume = {{ACL/IJCNLP} 2021}, pages = {4079--4090}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.findings-acl.357}, doi = {10.18653/V1/2021.FINDINGS-ACL.357}, timestamp = {Mon, 09 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/GangalJHB21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/MadaanRTYH21, author = {Aman Madaan and Dheeraj Rajagopal and Niket Tandon and Yiming Yang and Eduard H. Hovy}, editor = {Chengqing Zong and Fei Xia and Wenjie Li and Roberto Navigli}, title = {Could you give me a hint ? Generating inference graphs for defeasible reasoning}, booktitle = {Findings of the Association for Computational Linguistics: {ACL/IJCNLP} 2021, Online Event, August 1-6, 2021}, series = {Findings of {ACL}}, volume = {{ACL/IJCNLP} 2021}, pages = {5138--5147}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.findings-acl.456}, doi = {10.18653/V1/2021.FINDINGS-ACL.456}, timestamp = {Mon, 09 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/MadaanRTYH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/LiCFMWH20, author = {Ruifan Li and Hao Chen and Fangxiang Feng and Zhanyu Ma and Xiaojie Wang and Eduard H. Hovy}, editor = {Chengqing Zong and Fei Xia and Wenjie Li and Roberto Navigli}, title = {Dual Graph Convolutional Networks for Aspect-based Sentiment Analysis}, booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational Linguistics and the 11th International Joint Conference on Natural Language Processing, {ACL/IJCNLP} 2021, (Volume 1: Long Papers), Virtual Event, August 1-6, 2021}, pages = {6319--6329}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.acl-long.494}, doi = {10.18653/V1/2021.ACL-LONG.494}, timestamp = {Mon, 16 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/LiCFMWH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl-spnlp/ZhangSH21, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, editor = {Zornitsa Kozareva and Sujith Ravi and Andreas Vlachos and Priyanka Agrawal and Andr{\'{e}} F. T. Martins}, title = {Comparing Span Extraction Methods for Semantic Role Labeling}, booktitle = {Proceedings of the 5th Workshop on Structured Prediction for NLP, SPNLP@ACL-IJCNLP 2021, Online, August 6, 2021}, pages = {67--77}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.spnlp-1.8}, doi = {10.18653/V1/2021.SPNLP-1.8}, timestamp = {Mon, 01 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl-spnlp/ZhangSH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eacl/RavichanderDRMH21, author = {Abhilasha Ravichander and Siddharth Dalmia and Maria Ryskina and Florian Metze and Eduard H. Hovy and Alan W. Black}, editor = {Paola Merlo and J{\"{o}}rg Tiedemann and Reut Tsarfaty}, title = {NoiseQA: Challenge Set Evaluation for User-Centric Question Answering}, booktitle = {Proceedings of the 16th Conference of the European Chapter of the Association for Computational Linguistics: Main Volume, {EACL} 2021, Online, April 19 - 23, 2021}, pages = {2976--2992}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.eacl-main.259}, doi = {10.18653/V1/2021.EACL-MAIN.259}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eacl/RavichanderDRMH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eacl/RavichanderBH21, author = {Abhilasha Ravichander and Yonatan Belinkov and Eduard H. Hovy}, editor = {Paola Merlo and J{\"{o}}rg Tiedemann and Reut Tsarfaty}, title = {Probing the Probing Paradigm: Does Probing Accuracy Entail Task Relevance?}, booktitle = {Proceedings of the 16th Conference of the European Chapter of the Association for Computational Linguistics: Main Volume, {EACL} 2021, Online, April 19 - 23, 2021}, pages = {3363--3377}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.eacl-main.295}, doi = {10.18653/V1/2021.EACL-MAIN.295}, timestamp = {Thu, 20 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eacl/RavichanderBH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/RajagopalBHT21, author = {Dheeraj Rajagopal and Vidhisha Balachandran and Eduard H. Hovy and Yulia Tsvetkov}, editor = {Marie{-}Francine Moens and Xuanjing Huang and Lucia Specia and Scott Wen{-}tau Yih}, title = {{SELFEXPLAIN:} {A} Self-Explaining Architecture for Neural Text Classifiers}, booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican Republic, 7-11 November, 2021}, pages = {836--850}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.emnlp-main.64}, doi = {10.18653/V1/2021.EMNLP-MAIN.64}, timestamp = {Fri, 16 Feb 2024 08:27:36 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/RajagopalBHT21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/JoYBORH21, author = {Yohan Jo and Haneul Yoo and JinYeong Bak and Alice Oh and Chris Reed and Eduard H. Hovy}, editor = {Marie{-}Francine Moens and Xuanjing Huang and Lucia Specia and Scott Wen{-}tau Yih}, title = {Knowledge-Enhanced Evidence Retrieval for Counterargument Generation}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2021, Virtual Event / Punta Cana, Dominican Republic, 16-20 November, 2021}, pages = {3074--3094}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.findings-emnlp.264}, doi = {10.18653/V1/2021.FINDINGS-EMNLP.264}, timestamp = {Fri, 16 Feb 2024 08:27:36 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/JoYBORH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhangSH21, author = {Zhisong Zhang and Emma Strubell and Eduard H. Hovy}, editor = {Marie{-}Francine Moens and Xuanjing Huang and Lucia Specia and Scott Wen{-}tau Yih}, title = {On the Benefit of Syntactic Supervision for Cross-lingual Transfer in Semantic Role Labeling}, booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican Republic, 7-11 November, 2021}, pages = {6229--6246}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.emnlp-main.503}, doi = {10.18653/V1/2021.EMNLP-MAIN.503}, timestamp = {Thu, 20 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/ZhangSH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/MadaanTRCYH21, author = {Aman Madaan and Niket Tandon and Dheeraj Rajagopal and Peter Clark and Yiming Yang and Eduard H. Hovy}, editor = {Marie{-}Francine Moens and Xuanjing Huang and Lucia Specia and Scott Wen{-}tau Yih}, title = {Think about it! Improving defeasible reasoning by first modeling the question scenario}, booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican Republic, 7-11 November, 2021}, pages = {6291--6310}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.emnlp-main.508}, doi = {10.18653/V1/2021.EMNLP-MAIN.508}, timestamp = {Thu, 20 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/MadaanTRCYH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/JhamtaniGHB21, author = {Harsh Jhamtani and Varun Gangal and Eduard H. Hovy and Taylor Berg{-}Kirkpatrick}, editor = {Marie{-}Francine Moens and Xuanjing Huang and Lucia Specia and Scott Wen{-}tau Yih}, title = {Investigating Robustness of Dialog Models to Popular Figurative Language Constructs}, booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2021, Virtual Event / Punta Cana, Dominican Republic, 7-11 November, 2021}, pages = {7476--7485}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.emnlp-main.592}, doi = {10.18653/V1/2021.EMNLP-MAIN.592}, timestamp = {Thu, 20 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/JhamtaniGHB21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/KaushikSHL21, author = {Divyansh Kaushik and Amrith Setlur and Eduard H. Hovy and Zachary Chase Lipton}, title = {Explaining the Efficacy of Counterfactually Augmented Data}, booktitle = {9th International Conference on Learning Representations, {ICLR} 2021, Virtual Event, Austria, May 3-7, 2021}, publisher = {OpenReview.net}, year = {2021}, url = {https://openreview.net/forum?id=HHiiQKWsOcV}, timestamp = {Wed, 23 Jun 2021 17:36:39 +0200}, biburl = {https://dblp.org/rec/conf/iclr/KaushikSHL21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/MaKZH21, author = {Xuezhe Ma and Xiang Kong and Shanghang Zhang and Eduard H. Hovy}, title = {Decoupling Global and Local Representations via Invertible Generative Flows}, booktitle = {9th International Conference on Learning Representations, {ICLR} 2021, Virtual Event, Austria, May 3-7, 2021}, publisher = {OpenReview.net}, year = {2021}, url = {https://openreview.net/forum?id=iWLByfvUhN}, timestamp = {Wed, 23 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/MaKZH21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/inlg/FengHNHG21, author = {Steven Y. Feng and Jessica Huynh and Chaitanya Prasad Narisetty and Eduard H. Hovy and Varun Gangal}, editor = {Anya Belz and Angela Fan and Ehud Reiter and Yaji Sripada}, title = {{SAPPHIRE:} Approaches for Enhanced Concept-to-Text Generation}, booktitle = {Proceedings of the 14th International Conference on Natural Language Generation, {INLG} 2021, Aberdeen, Scotland, UK, 20-24 September, 2021}, pages = {212--225}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.inlg-1.21}, doi = {10.18653/V1/2021.INLG-1.21}, timestamp = {Fri, 12 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/inlg/FengHNHG21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/LyuLPHPSM21, author = {Yiwei Lyu and Paul Pu Liang and Hai Pham and Eduard H. Hovy and Barnab{\'{a}}s P{\'{o}}czos and Ruslan Salakhutdinov and Louis{-}Philippe Morency}, editor = {Kristina Toutanova and Anna Rumshisky and Luke Zettlemoyer and Dilek Hakkani{-}T{\"{u}}r and Iz Beltagy and Steven Bethard and Ryan Cotterell and Tanmoy Chakraborty and Yichao Zhou}, title = {StylePTB: {A} Compositional Benchmark for Fine-grained Controllable Text Style Transfer}, booktitle = {Proceedings of the 2021 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, {NAACL-HLT} 2021, Online, June 6-11, 2021}, pages = {2116--2138}, publisher = {Association for Computational Linguistics}, year = {2021}, url = {https://doi.org/10.18653/v1/2021.naacl-main.171}, doi = {10.18653/V1/2021.NAACL-MAIN.171}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/LyuLPHPSM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2102-01017, author = {Yanai Elazar and Nora Kassner and Shauli Ravfogel and Abhilasha Ravichander and Eduard H. Hovy and Hinrich Sch{\"{u}}tze and Yoav Goldberg}, title = {Measuring and Improving Consistency in Pretrained Language Models}, journal = {CoRR}, volume = {abs/2102.01017}, year = {2021}, url = {https://arxiv.org/abs/2102.01017}, eprinttype = {arXiv}, eprint = {2102.01017}, timestamp = {Tue, 09 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2102-01017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2102-08345, author = {Abhilasha Ravichander and Siddharth Dalmia and Maria Ryskina and Florian Metze and Eduard H. Hovy and Alan W. Black}, title = {NoiseQA: Challenge Set Evaluation for User-Centric Question Answering}, journal = {CoRR}, volume = {abs/2102.08345}, year = {2021}, url = {https://arxiv.org/abs/2102.08345}, eprinttype = {arXiv}, eprint = {2102.08345}, timestamp = {Fri, 19 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2102-08345.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2103-12279, author = {Dheeraj Rajagopal and Vidhisha Balachandran and Eduard H. Hovy and Yulia Tsvetkov}, title = {SelfExplain: {A} Self-Explaining Architecture for Neural Text Classifiers}, journal = {CoRR}, volume = {abs/2103.12279}, year = {2021}, url = {https://arxiv.org/abs/2103.12279}, eprinttype = {arXiv}, eprint = {2103.12279}, timestamp = {Tue, 06 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2103-12279.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2104-00814, author = {Dheeraj Rajagopal and Aman Madaan and Niket Tandon and Yiming Yang and Shrimai Prabhumoye and Abhilasha Ravichander and Peter Clark and Eduard H. Hovy}, title = {{CURIE:} An Iterative Querying Approach for Reasoning About Situations}, journal = {CoRR}, volume = {abs/2104.00814}, year = {2021}, url = {https://arxiv.org/abs/2104.00814}, eprinttype = {arXiv}, eprint = {2104.00814}, timestamp = {Mon, 12 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2104-00814.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2104-05196, author = {Yiwei Lyu and Paul Pu Liang and Hai Pham and Eduard H. Hovy and Barnab{\'{a}}s P{\'{o}}czos and Ruslan Salakhutdinov and Louis{-}Philippe Morency}, title = {StylePTB: {A} Compositional Benchmark for Fine-grained Controllable Text Style Transfer}, journal = {CoRR}, volume = {abs/2104.05196}, year = {2021}, url = {https://arxiv.org/abs/2104.05196}, eprinttype = {arXiv}, eprint = {2104.05196}, timestamp = {Mon, 19 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2104-05196.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2104-06669, author = {Varun Gangal and Steven Y. Feng and Eduard H. Hovy and Teruko Mitamura}, title = {{NAREOR:} The Narrative Reordering Problem}, journal = {CoRR}, volume = {abs/2104.06669}, year = {2021}, url = {https://arxiv.org/abs/2104.06669}, eprinttype = {arXiv}, eprint = {2104.06669}, timestamp = {Mon, 19 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2104-06669.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2104-08765, author = {Aman Madaan and Niket Tandon and Dheeraj Rajagopal and Yiming Yang and Peter Clark and Keisuke Sakaguchi and Eduard H. Hovy}, title = {Improving Neural Model Performance through Natural Language Feedback on Their Explanations}, journal = {CoRR}, volume = {abs/2104.08765}, year = {2021}, url = {https://arxiv.org/abs/2104.08765}, eprinttype = {arXiv}, eprint = {2104.08765}, timestamp = {Mon, 26 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2104-08765.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2105-03075, author = {Steven Y. Feng and Varun Gangal and Jason Wei and Sarath Chandar and Soroush Vosoughi and Teruko Mitamura and Eduard H. Hovy}, title = {A Survey of Data Augmentation Approaches for {NLP}}, journal = {CoRR}, volume = {abs/2105.03075}, year = {2021}, url = {https://arxiv.org/abs/2105.03075}, eprinttype = {arXiv}, eprint = {2105.03075}, timestamp = {Fri, 14 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2105-03075.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2105-05418, author = {Aman Madaan and Dheeraj Rajagopal and Niket Tandon and Yiming Yang and Eduard H. Hovy}, title = {Could you give me a hint? Generating inference graphs for defeasible reasoning}, journal = {CoRR}, volume = {abs/2105.05418}, year = {2021}, url = {https://arxiv.org/abs/2105.05418}, eprinttype = {arXiv}, eprint = {2105.05418}, timestamp = {Tue, 18 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2105-05418.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2105-07571, author = {Yohan Jo and Seojin Bang and Chris Reed and Eduard H. Hovy}, title = {Classifying Argumentative Relations Using Logical Mechanisms and Argumentation Schemes}, journal = {CoRR}, volume = {abs/2105.07571}, year = {2021}, url = {https://arxiv.org/abs/2105.07571}, eprinttype = {arXiv}, eprint = {2105.07571}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2105-07571.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2106-01269, author = {Rishabh Bhardwaj and Navonil Majumder and Soujanya Poria and Eduard H. Hovy}, title = {More Identifiable yet Equally Performant Transformers for Text Classification}, journal = {CoRR}, volume = {abs/2106.01269}, year = {2021}, url = {https://arxiv.org/abs/2106.01269}, eprinttype = {arXiv}, eprint = {2106.01269}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-01269.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2106-02833, author = {Varun Gangal and Harsh Jhamtani and Eduard H. Hovy and Taylor Berg{-}Kirkpatrick}, title = {Improving Automated Evaluation of Open Domain Dialog via Diverse Reference Augmentation}, journal = {CoRR}, volume = {abs/2106.02833}, year = {2021}, url = {https://arxiv.org/abs/2106.02833}, eprinttype = {arXiv}, eprint = {2106.02833}, timestamp = {Thu, 10 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-02833.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2106-12698, author = {Maria Ryskina and Eduard H. Hovy and Taylor Berg{-}Kirkpatrick and Matthew R. Gormley}, title = {Comparative Error Analysis in Neural and Finite-state Models for Unsupervised Character-level Transduction}, journal = {CoRR}, volume = {abs/2106.12698}, year = {2021}, url = {https://arxiv.org/abs/2106.12698}, eprinttype = {arXiv}, eprint = {2106.12698}, timestamp = {Wed, 30 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-12698.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2108-06643, author = {Steven Y. Feng and Jessica Huynh and Chaitanya Narisetty and Eduard H. Hovy and Varun Gangal}, title = {{SAPPHIRE:} Approaches for Enhanced Concept-to-Text Generation}, journal = {CoRR}, volume = {abs/2108.06643}, year = {2021}, url = {https://arxiv.org/abs/2108.06643}, eprinttype = {arXiv}, eprint = {2108.06643}, timestamp = {Wed, 18 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2108-06643.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2109-03892, author = {Steven Y. Feng and Kevin Lu and Zhuofu Tao and Malihe Alikhani and Teruko Mitamura and Eduard H. Hovy and Varun Gangal}, title = {Retrieve, Caption, Generate: Visual Grounding for Enhancing Commonsense in Text Generation Models}, journal = {CoRR}, volume = {abs/2109.03892}, year = {2021}, url = {https://arxiv.org/abs/2109.03892}, eprinttype = {arXiv}, eprint = {2109.03892}, timestamp = {Mon, 20 Sep 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2109-03892.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2109-09057, author = {Yohan Jo and Haneul Yoo and JinYeong Bak and Alice Oh and Chris Reed and Eduard H. Hovy}, title = {Knowledge-Enhanced Evidence Retrieval for Counterargument Generation}, journal = {CoRR}, volume = {abs/2109.09057}, year = {2021}, url = {https://arxiv.org/abs/2109.09057}, eprinttype = {arXiv}, eprint = {2109.09057}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2109-09057.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2110-00687, author = {Harsh Jhamtani and Varun Gangal and Eduard H. Hovy and Taylor Berg{-}Kirkpatrick}, title = {Investigating Robustness of Dialog Models to Popular Figurative Language Constructs}, journal = {CoRR}, volume = {abs/2110.00687}, year = {2021}, url = {https://arxiv.org/abs/2110.00687}, eprinttype = {arXiv}, eprint = {2110.00687}, timestamp = {Fri, 08 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2110-00687.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2110-10470, author = {Xiaofei Sun and Diyi Yang and Xiaoya Li and Tianwei Zhang and Yuxian Meng and Han Qiu and Guoyin Wang and Eduard H. Hovy and Jiwei Li}, title = {Interpreting Deep Learning Models in Natural Language Processing: {A} Review}, journal = {CoRR}, volume = {abs/2110.10470}, year = {2021}, url = {https://arxiv.org/abs/2110.10470}, eprinttype = {arXiv}, eprint = {2110.10470}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2110-10470.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2110-12349, author = {Aman Madaan and Niket Tandon and Dheeraj Rajagopal and Peter Clark and Yiming Yang and Eduard H. Hovy}, title = {Think about it! Improving defeasible reasoning by first modeling the question scenario}, journal = {CoRR}, volume = {abs/2110.12349}, year = {2021}, url = {https://arxiv.org/abs/2110.12349}, eprinttype = {arXiv}, eprint = {2110.12349}, timestamp = {Thu, 28 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2110-12349.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-00539, author = {Dheeraj Rajagopal and Vivek Khetan and Bogdan Sacaleanu and Anatole Gershman and Andrew E. Fano and Eduard H. Hovy}, title = {Cross-Domain Reasoning via Template Filling}, journal = {CoRR}, volume = {abs/2111.00539}, year = {2021}, url = {https://arxiv.org/abs/2111.00539}, eprinttype = {arXiv}, eprint = {2111.00539}, timestamp = {Fri, 05 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-00539.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2112-02721, author = {Kaustubh D. Dhole and Varun Gangal and Sebastian Gehrmann and Aadesh Gupta and Zhenhao Li and Saad Mahamood and Abinaya Mahendiran and Simon Mille and Ashish Srivastava and Samson Tan and Tongshuang Wu and Jascha Sohl{-}Dickstein and Jinho D. Choi and Eduard H. Hovy and Ondrej Dusek and Sebastian Ruder and Sajant Anand and Nagender Aneja and Rabin Banjade and Lisa Barthe and Hanna Behnke and Ian Berlot{-}Attwell and Connor Boyle and Caroline Brun and Marco Antonio Sobrevilla Cabezudo and Samuel Cahyawijaya and Emile Chapuis and Wanxiang Che and Mukund Choudhary and Christian Clauss and Pierre Colombo and Filip Cornell and Gautier Dagan and Mayukh Das and Tanay Dixit and Thomas Dopierre and Paul{-}Alexis Dray and Suchitra Dubey and Tatiana Ekeinhor and Marco Di Giovanni and Rishabh Gupta and Rishabh Gupta and Louanes Hamla and Sang Han and Fabrice Harel{-}Canada and Antoine Honore and Ishan Jindal and Przemyslaw K. Joniak and Denis Kleyko and Venelin Kovatchev and et al.}, title = {NL-Augmenter: {A} Framework for Task-Sensitive Natural Language Augmentation}, journal = {CoRR}, volume = {abs/2112.02721}, year = {2021}, url = {https://arxiv.org/abs/2112.02721}, eprinttype = {arXiv}, eprint = {2112.02721}, timestamp = {Wed, 08 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2112-02721.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tacl/ShibuyaH20, author = {Takashi Shibuya and Eduard H. Hovy}, title = {Nested Named Entity Recognition via Second-best Sequence Learning and Decoding}, journal = {Trans. Assoc. Comput. Linguistics}, volume = {8}, pages = {605--620}, year = {2020}, url = {https://doi.org/10.1162/tacl\_a\_00334}, doi = {10.1162/TACL\_A\_00334}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tacl/ShibuyaH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ws/IlievskiHVSX20, author = {Filip Ilievski and Eduard H. Hovy and Piek Vossen and Stefan Schlobach and Qizhe Xie}, title = {The role of knowledge in determining identity of long-tail entities}, journal = {J. Web Semant.}, volume = {61-62}, pages = {100565}, year = {2020}, url = {https://doi.org/10.1016/j.websem.2020.100565}, doi = {10.1016/J.WEBSEM.2020.100565}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ws/IlievskiHVSX20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/ZongRH20, author = {Shi Zong and Alan Ritter and Eduard H. Hovy}, editor = {Dan Jurafsky and Joyce Chai and Natalie Schluter and Joel R. Tetreault}, title = {Measuring Forecasting Skill from Text}, booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational Linguistics, {ACL} 2020, Online, July 5-10, 2020}, pages = {5317--5331}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.acl-main.473}, doi = {10.18653/V1/2020.ACL-MAIN.473}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/ZongRH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/KongGH20, author = {Xiang Kong and Varun Gangal and Eduard H. Hovy}, editor = {Dan Jurafsky and Joyce Chai and Natalie Schluter and Joel R. Tetreault}, title = {{SCDE:} Sentence Cloze Dataset with High Quality Distractors From Examinations}, booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational Linguistics, {ACL} 2020, Online, July 5-10, 2020}, pages = {5668--5683}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.acl-main.502}, doi = {10.18653/V1/2020.ACL-MAIN.502}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/KongGH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/ZhangKLMH20, author = {Zhisong Zhang and Xiang Kong and Zhengzhong Liu and Xuezhe Ma and Eduard H. Hovy}, editor = {Dan Jurafsky and Joyce Chai and Natalie Schluter and Joel R. Tetreault}, title = {A Two-Step Approach for Implicit Event Argument Detection}, booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational Linguistics, {ACL} 2020, Online, July 5-10, 2020}, pages = {7479--7485}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.acl-main.667}, doi = {10.18653/V1/2020.ACL-MAIN.667}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/ZhangKLMH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/blackboxnlp/GangalH20, author = {Varun Gangal and Eduard H. Hovy}, editor = {Afra Alishahi and Yonatan Belinkov and Grzegorz Chrupala and Dieuwke Hupkes and Yuval Pinter and Hassan Sajjad}, title = {BERTering {RAMS:} What and How Much does {BERT} Already Know About Event Arguments? - {A} Study on the {RAMS} Dataset}, booktitle = {Proceedings of the Third BlackboxNLP Workshop on Analyzing and Interpreting Neural Networks for NLP, BlackboxNLP@EMNLP 2020, Online, November 2020}, pages = {1--10}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.blackboxnlp-1.1}, doi = {10.18653/V1/2020.BLACKBOXNLP-1.1}, timestamp = {Fri, 15 Sep 2023 14:10:05 +0200}, biburl = {https://dblp.org/rec/conf/blackboxnlp/GangalH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/blackboxnlp/RungeH20, author = {Andrew Runge and Eduard H. Hovy}, editor = {Afra Alishahi and Yonatan Belinkov and Grzegorz Chrupala and Dieuwke Hupkes and Yuval Pinter and Hassan Sajjad}, title = {Exploring Neural Entity Representations for Semantic Information}, booktitle = {Proceedings of the Third BlackboxNLP Workshop on Analyzing and Interpreting Neural Networks for NLP, BlackboxNLP@EMNLP 2020, Online, November 2020}, pages = {204--216}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.blackboxnlp-1.20}, doi = {10.18653/V1/2020.BLACKBOXNLP-1.20}, timestamp = {Mon, 09 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/blackboxnlp/RungeH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/SpiliopoulouPH20, author = {Evangelia Spiliopoulou and Artidoro Pagnoni and Eduard H. Hovy}, editor = {Donia Scott and N{\'{u}}ria Bel and Chengqing Zong}, title = {Definition Frames: Using Definitions for Hybrid Concept Representations}, booktitle = {Proceedings of the 28th International Conference on Computational Linguistics, {COLING} 2020, Barcelona, Spain (Online), December 8-13, 2020}, pages = {3060--3068}, publisher = {International Committee on Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.coling-main.273}, doi = {10.18653/V1/2020.COLING-MAIN.273}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/SpiliopoulouPH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/XieLHL20, author = {Qizhe Xie and Minh{-}Thang Luong and Eduard H. Hovy and Quoc V. Le}, title = {Self-Training With Noisy Student Improves ImageNet Classification}, booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020}, pages = {10684--10695}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2020}, url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Xie\_Self-Training\_With\_Noisy\_Student\_Improves\_ImageNet\_Classification\_CVPR\_2020\_paper.html}, doi = {10.1109/CVPR42600.2020.01070}, timestamp = {Tue, 31 Aug 2021 14:00:04 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/XieLHL20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ChandrasekaranF20, author = {Muthu Kumar Chandrasekaran and Guy Feigenblat and Dayne Freitag and Tirthankar Ghosal and Eduard H. Hovy and Philipp Mayr and Michal Shmueli{-}Scheuer and Anita de Waard}, editor = {Muthu Kumar Chandrasekaran and Anita de Waard and Guy Feigenblat and Dayne Freitag and Tirthankar Ghosal and Eduard H. Hovy and Petr Knoth and David Konopnicki and Philipp Mayr and Robert M. Patton and Michal Shmueli{-}Scheuer}, title = {Overview of the First Workshop on Scholarly Document Processing {(SDP)}}, booktitle = {Proceedings of the First Workshop on Scholarly Document Processing, SDP@EMNLP 2020, Online, November 19, 2020}, pages = {1--6}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.sdp-1.1}, doi = {10.18653/V1/2020.SDP-1.1}, timestamp = {Fri, 06 Aug 2021 00:40:22 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ChandrasekaranF20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/JoBMHR20, author = {Yohan Jo and Seojin Bang and Emaad A. Manzoor and Eduard H. Hovy and Chris Reed}, editor = {Bonnie Webber and Trevor Cohn and Yulan He and Yang Liu}, title = {Detecting Attackable Sentences in Arguments}, booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2020, Online, November 16-20, 2020}, pages = {1--23}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.emnlp-main.1}, doi = {10.18653/V1/2020.EMNLP-MAIN.1}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/JoBMHR20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/JoVRH20, author = {Yohan Jo and Jacky Visser and Chris Reed and Eduard H. Hovy}, editor = {Bonnie Webber and Trevor Cohn and Yulan He and Yang Liu}, title = {Extracting Implicitly Asserted Propositions in Argumentation}, booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2020, Online, November 16-20, 2020}, pages = {24--38}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.emnlp-main.2}, doi = {10.18653/V1/2020.EMNLP-MAIN.2}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/JoVRH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ChandrasekaranF20a, author = {Muthu Kumar Chandrasekaran and Guy Feigenblat and Eduard H. Hovy and Abhilasha Ravichander and Michal Shmueli{-}Scheuer and Anita de Waard}, editor = {Muthu Kumar Chandrasekaran and Anita de Waard and Guy Feigenblat and Dayne Freitag and Tirthankar Ghosal and Eduard H. Hovy and Petr Knoth and David Konopnicki and Philipp Mayr and Robert M. Patton and Michal Shmueli{-}Scheuer}, title = {Overview and Insights from the Shared Tasks at Scholarly Document Processing 2020: CL-SciSumm, LaySumm and LongSumm}, booktitle = {Proceedings of the First Workshop on Scholarly Document Processing, SDP@EMNLP 2020, Online, November 19, 2020}, pages = {214--224}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.sdp-1.24}, doi = {10.18653/V1/2020.SDP-1.24}, timestamp = {Fri, 18 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/ChandrasekaranF20a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/KongZH20, author = {Xiang Kong and Zhisong Zhang and Eduard H. Hovy}, editor = {Bonnie Webber and Trevor Cohn and Yulan He and Yang Liu}, title = {Incorporating a Local Translation Mechanism into Non-autoregressive Translation}, booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2020, Online, November 16-20, 2020}, pages = {1067--1073}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.emnlp-main.79}, doi = {10.18653/V1/2020.EMNLP-MAIN.79}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/KongZH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhangKLH20, author = {Zhisong Zhang and Xiang Kong and Lori S. Levin and Eduard H. Hovy}, editor = {Trevor Cohn and Yulan He and Yang Liu}, title = {An Empirical Exploration of Local Ordering Pre-training for Structured Learning}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2020, Online Event, 16-20 November 2020}, series = {Findings of {ACL}}, volume = {{EMNLP} 2020}, pages = {1770--1783}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.findings-emnlp.160}, doi = {10.18653/V1/2020.FINDINGS-EMNLP.160}, timestamp = {Wed, 23 Mar 2022 10:11:55 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/ZhangKLH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/RajagopalTCDH20, author = {Dheeraj Rajagopal and Niket Tandon and Peter Clark and Bhavana Dalvi and Eduard H. Hovy}, editor = {Trevor Cohn and Yulan He and Yang Liu}, title = {What-if {I} ask you to explain: Explaining the effects of perturbations in procedural text}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2020, Online Event, 16-20 November 2020}, series = {Findings of {ACL}}, volume = {{EMNLP} 2020}, pages = {3345--3355}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.findings-emnlp.300}, doi = {10.18653/V1/2020.FINDINGS-EMNLP.300}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/RajagopalTCDH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/MazaSHH20, author = {Salvador Medina Maza and Evangelia Spiliopoulou and Eduard H. Hovy and Alexander G. Hauptmann}, editor = {Trevor Cohn and Yulan He and Yang Liu}, title = {Event-Related Bias Removal for Real-time Disaster Events}, booktitle = {Findings of the Association for Computational Linguistics: {EMNLP} 2020, Online Event, 16-20 November 2020}, series = {Findings of {ACL}}, volume = {{EMNLP} 2020}, pages = {3858--3868}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.findings-emnlp.344}, doi = {10.18653/V1/2020.FINDINGS-EMNLP.344}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/MazaSHH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/TandonSDRCGRH20, author = {Niket Tandon and Keisuke Sakaguchi and Bhavana Dalvi and Dheeraj Rajagopal and Peter Clark and Michal Guerquin and Kyle Richardson and Eduard H. Hovy}, editor = {Bonnie Webber and Trevor Cohn and Yulan He and Yang Liu}, title = {A Dataset for Tracking Entities in Open Domain Procedural Text}, booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2020, Online, November 16-20, 2020}, pages = {6408--6417}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.emnlp-main.520}, doi = {10.18653/V1/2020.EMNLP-MAIN.520}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/TandonSDRCGRH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/KangH20, author = {Dongyeop Kang and Eduard H. Hovy}, editor = {Bonnie Webber and Trevor Cohn and Yulan He and Yang Liu}, title = {Plan ahead: Self-Supervised Text Planning for Paragraph Completion Task}, booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2020, Online, November 16-20, 2020}, pages = {6533--6543}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://doi.org/10.18653/v1/2020.emnlp-main.529}, doi = {10.18653/V1/2020.EMNLP-MAIN.529}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/KangH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/KaushikHL20, author = {Divyansh Kaushik and Eduard H. Hovy and Zachary Chase Lipton}, title = {Learning The Difference That Makes {A} Difference With Counterfactually-Augmented Data}, booktitle = {8th International Conference on Learning Representations, {ICLR} 2020, Addis Ababa, Ethiopia, April 26-30, 2020}, publisher = {OpenReview.net}, year = {2020}, url = {https://openreview.net/forum?id=Sklgs0NFvr}, timestamp = {Thu, 07 May 2020 17:11:47 +0200}, biburl = {https://dblp.org/rec/conf/iclr/KaushikHL20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/JoMRH20, author = {Yohan Jo and Elijah Mayfield and Chris Reed and Eduard H. Hovy}, editor = {Nicoletta Calzolari and Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and Philippe Blache and Khalid Choukri and Christopher Cieri and Thierry Declerck and Sara Goggi and Hitoshi Isahara and Bente Maegaard and Joseph Mariani and H{\'{e}}l{\`{e}}ne Mazo and Asunci{\'{o}}n Moreno and Jan Odijk and Stelios Piperidis}, title = {Machine-Aided Annotation for Fine-Grained Proposition Types in Argumentation}, booktitle = {Proceedings of The 12th Language Resources and Evaluation Conference, {LREC} 2020, Marseille, France, May 11-16, 2020}, pages = {1008--1018}, publisher = {European Language Resources Association}, year = {2020}, url = {https://aclanthology.org/2020.lrec-1.127/}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lrec/JoMRH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mir/0001CHH20, author = {Po{-}Yao Huang and Xiaojun Chang and Alexander G. Hauptmann and Eduard H. Hovy}, editor = {Cathal Gurrin and Bj{\"{o}}rn {\TH}{\'{o}}r J{\'{o}}nsson and Noriko Kando and Klaus Sch{\"{o}}ffmann and Yi{-}Ping Phoebe Chen and Noel E. O'Connor}, title = {Forward and Backward Multimodal {NMT} for Improved Monolingual and Multilingual Cross-Modal Retrieval}, booktitle = {Proceedings of the 2020 on International Conference on Multimedia Retrieval, {ICMR} 2020, Dublin, Ireland, June 8-11, 2020}, pages = {53--62}, publisher = {{ACM}}, year = {2020}, url = {https://doi.org/10.1145/3372278.3390674}, doi = {10.1145/3372278.3390674}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mir/0001CHH20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/XieDHL020, author = {Qizhe Xie and Zihang Dai and Eduard H. Hovy and Thang Luong and Quoc Le}, editor = {Hugo Larochelle and Marc'Aurelio Ranzato and Raia Hadsell and Maria{-}Florina Balcan and Hsuan{-}Tien Lin}, title = {Unsupervised Data Augmentation for Consistency Training}, booktitle = {Advances in Neural Information Processing Systems 33: Annual Conference on Neural Information Processing Systems 2020, NeurIPS 2020, December 6-12, 2020, virtual}, year = {2020}, url = {https://proceedings.neurips.cc/paper/2020/hash/44feb0096faa8326192570788b38c1d1-Abstract.html}, timestamp = {Tue, 19 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nips/XieDHL020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/starsem/RavichanderHSTC20, author = {Abhilasha Ravichander and Eduard H. Hovy and Kaheer Suleman and Adam Trischler and Jackie Chi Kit Cheung}, editor = {Iryna Gurevych and Marianna Apidianaki and Manaal Faruqui}, title = {On the Systematicity of Probing Contextualized Word Representations: The Case of Hypernymy in {BERT}}, booktitle = {Proceedings of the Ninth Joint Conference on Lexical and Computational Semantics, *SEM@COLING 2020, Barcelona, Spain (Online), December 12-13, 2020}, pages = {88--102}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://aclanthology.org/2020.starsem-1.10/}, timestamp = {Wed, 25 Aug 2021 17:11:16 +0200}, biburl = {https://dblp.org/rec/conf/starsem/RavichanderHSTC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/emnlp/2020sdp, editor = {Muthu Kumar Chandrasekaran and Anita de Waard and Guy Feigenblat and Dayne Freitag and Tirthankar Ghosal and Eduard H. Hovy and Petr Knoth and David Konopnicki and Philipp Mayr and Robert M. Patton and Michal Shmueli{-}Scheuer}, title = {Proceedings of the First Workshop on Scholarly Document Processing, SDP@EMNLP 2020, Online, November 19, 2020}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://aclanthology.org/volumes/2020.sdp-1/}, isbn = {978-1-952148-70-5}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/2020sdp.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/eval4nlp/2020, editor = {Steffen Eger and Yang Gao and Maxime Peyrard and Wei Zhao and Eduard H. Hovy}, title = {Proceedings of the First Workshop on Evaluation and Comparison of {NLP} Systems, Eval4NLP 2020, Online, November 20, 2020}, publisher = {Association for Computational Linguistics}, year = {2020}, url = {https://www.aclweb.org/anthology/volumes/2020.eval4nlp-1/}, isbn = {978-1-952148-82-8}, timestamp = {Tue, 16 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eval4nlp/2020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2004-11820, author = {Xuezhe Ma and Xiang Kong and Shanghang Zhang and Eduard H. Hovy}, title = {Decoupling Global and Local Representations from/for Image Generation}, journal = {CoRR}, volume = {abs/2004.11820}, year = {2020}, url = {https://arxiv.org/abs/2004.11820}, eprinttype = {arXiv}, eprint = {2004.11820}, timestamp = {Tue, 28 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2004-11820.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2004-12934, author = {Xiang Kong and Varun Gangal and Eduard H. Hovy}, title = {{SCDE:} Sentence Cloze Dataset with High Quality Distractors From Examinations}, journal = {CoRR}, volume = {abs/2004.12934}, year = {2020}, url = {https://arxiv.org/abs/2004.12934}, eprinttype = {arXiv}, eprint = {2004.12934}, timestamp = {Wed, 29 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2004-12934.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2005-00719, author = {Abhilasha Ravichander and Yonatan Belinkov and Eduard H. Hovy}, title = {Probing the Probing Paradigm: Does Probing Accuracy Entail Task Relevance?}, journal = {CoRR}, volume = {abs/2005.00719}, year = {2020}, url = {https://arxiv.org/abs/2005.00719}, eprinttype = {arXiv}, eprint = {2005.00719}, timestamp = {Fri, 08 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2005-00719.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2005-01526, author = {Dheeraj Rajagopal and Niket Tandon and Peter Clark and Bhavana Dalvi and Eduard H. Hovy}, title = {What-if {I} ask you to explain: Explaining the effects of perturbations in procedural text}, journal = {CoRR}, volume = {abs/2005.01526}, year = {2020}, url = {https://arxiv.org/abs/2005.01526}, eprinttype = {arXiv}, eprint = {2005.01526}, timestamp = {Wed, 03 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2005-01526.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2006-07425, author = {Shi Zong and Alan Ritter and Eduard H. Hovy}, title = {Measuring Forecasting Skill from Text}, journal = {CoRR}, volume = {abs/2006.07425}, year = {2020}, url = {https://arxiv.org/abs/2006.07425}, eprinttype = {arXiv}, eprint = {2006.07425}, timestamp = {Wed, 17 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2006-07425.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-01794, author = {Steven Y. Feng and Varun Gangal and Dongyeop Kang and Teruko Mitamura and Eduard H. Hovy}, title = {GenAug: Data Augmentation for Finetuning Text Generators}, journal = {CoRR}, volume = {abs/2010.01794}, year = {2020}, url = {https://arxiv.org/abs/2010.01794}, eprinttype = {arXiv}, eprint = {2010.01794}, timestamp = {Mon, 12 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-01794.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-02114, author = {Divyansh Kaushik and Amrith Setlur and Eduard H. Hovy and Zachary C. Lipton}, title = {Explaining The Efficacy of Counterfactually-Augmented Data}, journal = {CoRR}, volume = {abs/2010.02114}, year = {2020}, url = {https://arxiv.org/abs/2010.02114}, eprinttype = {arXiv}, eprint = {2010.02114}, timestamp = {Mon, 12 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-02114.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-02654, author = {Yohan Jo and Jacky Visser and Chris Reed and Eduard H. Hovy}, title = {Extracting Implicitly Asserted Propositions in Argumentation}, journal = {CoRR}, volume = {abs/2010.02654}, year = {2020}, url = {https://arxiv.org/abs/2010.02654}, eprinttype = {arXiv}, eprint = {2010.02654}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-02654.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-02660, author = {Yohan Jo and Seojin Bang and Emaad A. Manzoor and Eduard H. Hovy and Chris Reed}, title = {Detecting Attackable Sentences in Arguments}, journal = {CoRR}, volume = {abs/2010.02660}, year = {2020}, url = {https://arxiv.org/abs/2010.02660}, eprinttype = {arXiv}, eprint = {2010.02660}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-02660.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-04098, author = {Varun Gangal and Eduard H. Hovy}, title = {BERTering {RAMS:} What and How Much does {BERT} Already Know About Event Arguments? - {A} Study on the {RAMS} Dataset}, journal = {CoRR}, volume = {abs/2010.04098}, year = {2020}, url = {https://arxiv.org/abs/2010.04098}, eprinttype = {arXiv}, eprint = {2010.04098}, timestamp = {Tue, 13 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-04098.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-05141, author = {Dongyeop Kang and Eduard H. Hovy}, title = {Plan ahead: Self-Supervised Text Planning for Paragraph Completion Task}, journal = {CoRR}, volume = {abs/2010.05141}, year = {2020}, url = {https://arxiv.org/abs/2010.05141}, eprinttype = {arXiv}, eprint = {2010.05141}, timestamp = {Tue, 20 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-05141.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-06943, author = {Yuxian Meng and Chun Fan and Zijun Sun and Eduard H. Hovy and Fei Wu and Jiwei Li}, title = {Pair the Dots: Jointly Examining Training History and Test Stimuli for Model Interpretability}, journal = {CoRR}, volume = {abs/2010.06943}, year = {2020}, url = {https://arxiv.org/abs/2010.06943}, eprinttype = {arXiv}, eprint = {2010.06943}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-06943.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-11764, author = {Aman Madaan and Dheeraj Rajagopal and Yiming Yang and Abhilasha Ravichander and Eduard H. Hovy and Shrimai Prabhumoye}, title = {{EIGEN:} Event Influence GENeration using Pre-trained Language Models}, journal = {CoRR}, volume = {abs/2010.11764}, year = {2020}, url = {https://arxiv.org/abs/2010.11764}, eprinttype = {arXiv}, eprint = {2010.11764}, timestamp = {Tue, 27 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-11764.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-00681, author = {Evangelia Spiliopoulou and Salvador Medina Maza and Eduard H. Hovy and Alexander G. Hauptmann}, title = {Event-Related Bias Removal for Real-time Disaster Events}, journal = {CoRR}, volume = {abs/2011.00681}, year = {2020}, url = {https://arxiv.org/abs/2011.00681}, eprinttype = {arXiv}, eprint = {2011.00681}, timestamp = {Fri, 06 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-00681.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-06132, author = {Xiang Kong and Zhisong Zhang and Eduard H. Hovy}, title = {Incorporating a Local Translation Mechanism into Non-autoregressive Translation}, journal = {CoRR}, volume = {abs/2011.06132}, year = {2020}, url = {https://arxiv.org/abs/2011.06132}, eprinttype = {arXiv}, eprint = {2011.06132}, timestamp = {Wed, 18 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-06132.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-08092, author = {Niket Tandon and Keisuke Sakaguchi and Bhavana Dalvi Mishra and Dheeraj Rajagopal and Peter Clark and Michal Guerquin and Kyle Richardson and Eduard H. Hovy}, title = {A Dataset for Tracking Entities in Open Domain Procedural Text}, journal = {CoRR}, volume = {abs/2011.08092}, year = {2020}, url = {https://arxiv.org/abs/2011.08092}, eprinttype = {arXiv}, eprint = {2011.08092}, timestamp = {Fri, 12 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-08092.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2011-08951, author = {Andrew Runge and Eduard H. Hovy}, title = {Exploring Neural Entity Representations for Semantic Information}, journal = {CoRR}, volume = {abs/2011.08951}, year = {2020}, url = {https://arxiv.org/abs/2011.08951}, eprinttype = {arXiv}, eprint = {2011.08951}, timestamp = {Wed, 25 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2011-08951.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/PoriaMMH19, author = {Soujanya Poria and Navonil Majumder and Rada Mihalcea and Eduard H. Hovy}, title = {Emotion Recognition in Conversation: Research Challenges, Datasets, and Recent Advances}, journal = {{IEEE} Access}, volume = {7}, pages = {100943--100953}, year = {2019}, url = {https://doi.org/10.1109/ACCESS.2019.2929050}, doi = {10.1109/ACCESS.2019.2929050}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/PoriaMMH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/coling/SachanDHMRX19, author = {Mrinmaya Sachan and Avinava Dubey and Eduard H. Hovy and Tom M. Mitchell and Dan Roth and Eric P. Xing}, title = {Discourse in Multimedia: {A} Case Study in Extracting Geometry Knowledge from Textbooks}, journal = {Comput. Linguistics}, volume = {45}, number = {4}, pages = {627--665}, year = {2019}, url = {https://doi.org/10.1162/coli\_a\_00360}, doi = {10.1162/COLI\_A\_00360}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/coling/SachanDHMRX19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/lre/SutcliffeHCWCR19, author = {Richard F. E. Sutcliffe and Eduard H. Hovy and Tom Collins and Stephen Wan and Tim Crawford and Deane L. Root}, title = {Searching for musical features using natural language queries: the C@merata evaluations at MediaEval}, journal = {Lang. Resour. Evaluation}, volume = {53}, number = {1}, pages = {87--140}, year = {2019}, url = {https://doi.org/10.1007/s10579-018-9422-2}, doi = {10.1007/S10579-018-9422-2}, timestamp = {Thu, 05 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/lre/SutcliffeHCWCR19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/KongTSHZ19, author = {Xiang Kong and Zhaopeng Tu and Shuming Shi and Eduard H. Hovy and Tong Zhang}, title = {Neural Machine Translation with Adequacy-Oriented Learning}, booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI} 2019, The Thirty-First Innovative Applications of Artificial Intelligence Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii, USA, January 27 - February 1, 2019}, pages = {6618--6625}, publisher = {{AAAI} Press}, year = {2019}, url = {https://doi.org/10.1609/aaai.v33i01.33016618}, doi = {10.1609/AAAI.V33I01.33016618}, timestamp = {Mon, 04 Sep 2023 12:29:24 +0200}, biburl = {https://dblp.org/rec/conf/aaai/KongTSHZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/KongXDH19, author = {Xiang Kong and Qizhe Xie and Zihang Dai and Eduard H. Hovy}, title = {Fast and Simple Mixture of Softmaxes with {BPE} and Hybrid-LightRNN for Language Generation}, booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI} 2019, The Thirty-First Innovative Applications of Artificial Intelligence Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii, USA, January 27 - February 1, 2019}, pages = {6626--6633}, publisher = {{AAAI} Press}, year = {2019}, url = {https://doi.org/10.1609/aaai.v33i01.33016626}, doi = {10.1609/AAAI.V33I01.33016626}, timestamp = {Tue, 02 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aaai/KongXDH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/NaikRRH19, author = {Aakanksha Naik and Abhilasha Ravichander and Carolyn P. Ros{\'{e}} and Eduard H. Hovy}, editor = {Anna Korhonen and David R. Traum and Llu{\'{\i}}s M{\`{a}}rquez}, title = {Exploring Numeracy in Word Embeddings}, booktitle = {Proceedings of the 57th Conference of the Association for Computational Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019, Volume 1: Long Papers}, pages = {3374--3380}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/p19-1329}, doi = {10.18653/V1/P19-1329}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/NaikRRH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/GarimellaBHM19, author = {Aparna Garimella and Carmen Banea and Eduard H. Hovy and Rada Mihalcea}, editor = {Anna Korhonen and David R. Traum and Llu{\'{\i}}s M{\`{a}}rquez}, title = {Women's Syntactic Resilience and Men's Grammatical Luck: Gender-Bias in Part-of-Speech Tagging and Dependency Parsing}, booktitle = {Proceedings of the 57th Conference of the Association for Computational Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019, Volume 1: Long Papers}, pages = {3493--3498}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/p19-1339}, doi = {10.18653/V1/P19-1339}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/GarimellaBHM19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/OtaniH19, author = {Naoki Otani and Eduard H. Hovy}, editor = {Anna Korhonen and David R. Traum and Llu{\'{\i}}s M{\`{a}}rquez}, title = {Toward Comprehensive Understanding of a Sentiment Based on Human Motives}, booktitle = {Proceedings of the 57th Conference of the Association for Computational Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019, Volume 1: Long Papers}, pages = {4672--4677}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/p19-1461}, doi = {10.18653/V1/P19-1461}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/OtaniH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/ZhangMH19, author = {Zhisong Zhang and Xuezhe Ma and Eduard H. Hovy}, editor = {Anna Korhonen and David R. Traum and Llu{\'{\i}}s M{\`{a}}rquez}, title = {An Empirical Investigation of Structured Output Modeling for Graph-based Neural Dependency Parsing}, booktitle = {Proceedings of the 57th Conference of the Association for Computational Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019, Volume 1: Long Papers}, pages = {5592--5598}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/p19-1562}, doi = {10.18653/V1/P19-1562}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/ZhangMH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/argmining/JoVRH19, author = {Yohan Jo and Jacky Visser and Chris Reed and Eduard H. Hovy}, editor = {Benno Stein and Henning Wachsmuth}, title = {A Cascade Model for Proposition Extraction in Argumentation}, booktitle = {Proceedings of the 6th Workshop on Argument Mining, ArgMining@ACL 2019, Florence, Italy, August 1, 2019}, pages = {11--24}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/w19-4502}, doi = {10.18653/V1/W19-4502}, timestamp = {Wed, 09 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/argmining/JoVRH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bionlp/RajagopalVSRTH19, author = {Dheeraj Rajagopal and Nidhi Vyas and Aditya Siddhant and Anirudha Rayasam and Niket Tandon and Eduard H. Hovy}, editor = {Dina Demner{-}Fushman and Kevin Bretonnel Cohen and Sophia Ananiadou and Junichi Tsujii}, title = {Domain Adaptation of {SRL} Systems for Biological Processes}, booktitle = {Proceedings of the 18th BioNLP Workshop and Shared Task, BioNLP@ACL 2019, Florence, Italy, August 1, 2019}, pages = {80--87}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/w19-5009}, doi = {10.18653/V1/W19-5009}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/bionlp/RajagopalVSRTH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/conll/RavichanderNRH19, author = {Abhilasha Ravichander and Aakanksha Naik and Carolyn P. Ros{\'{e}} and Eduard H. Hovy}, editor = {Mohit Bansal and Aline Villavicencio}, title = {{EQUATE:} {A} Benchmark Evaluation Framework for Quantitative Reasoning in Natural Language Inference}, booktitle = {Proceedings of the 23rd Conference on Computational Natural Language Learning, CoNLL 2019, Hong Kong, China, November 3-4, 2019}, pages = {349--361}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/K19-1033}, doi = {10.18653/V1/K19-1033}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/conll/RavichanderNRH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/KangGH19, author = {Dongyeop Kang and Varun Gangal and Eduard H. Hovy}, editor = {Kentaro Inui and Jing Jiang and Vincent Ng and Xiaojun Wan}, title = {(Male, Bachelor) and (Female, Ph.D) have different connotations: Parallelly Annotated Stylistic Language Dataset with Multiple Personas}, booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing and the 9th International Joint Conference on Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China, November 3-7, 2019}, pages = {1696--1706}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/D19-1179}, doi = {10.18653/V1/D19-1179}, timestamp = {Thu, 07 Apr 2022 09:14:07 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/KangGH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/JungKMH19, author = {Taehee Jung and Dongyeop Kang and Lucas Mentch and Eduard H. Hovy}, editor = {Kentaro Inui and Jing Jiang and Vincent Ng and Xiaojun Wan}, title = {Earlier Isn't Always Better: Sub-aspect Analysis on Corpus and System Biases in Summarization}, booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing and the 9th International Joint Conference on Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China, November 3-7, 2019}, pages = {3322--3333}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/D19-1327}, doi = {10.18653/V1/D19-1327}, timestamp = {Thu, 12 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/JungKMH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/MaZLNH19, author = {Xuezhe Ma and Chunting Zhou and Xian Li and Graham Neubig and Eduard H. Hovy}, editor = {Kentaro Inui and Jing Jiang and Vincent Ng and Xiaojun Wan}, title = {FlowSeq: Non-Autoregressive Conditional Sequence Generation with Generative Flow}, booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing and the 9th International Joint Conference on Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China, November 3-7, 2019}, pages = {4281--4291}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/D19-1437}, doi = {10.18653/V1/D19-1437}, timestamp = {Thu, 12 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/MaZLNH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/KangH19, author = {Dongyeop Kang and Eduard H. Hovy}, editor = {Kentaro Inui and Jing Jiang and Vincent Ng and Xiaojun Wan}, title = {Linguistic Versus Latent Relations for Modeling Coherent Flow in Paragraphs}, booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural Language Processing and the 9th International Joint Conference on Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China, November 3-7, 2019}, pages = {5808--5814}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/D19-1589}, doi = {10.18653/V1/D19-1589}, timestamp = {Thu, 12 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/KangH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/VyasRMHB19, author = {Nidhi Vyas and Sai Krishna Rallabandi and Lalitesh Morishetti and Eduard H. Hovy and Alan W. Black}, title = {Learning Disentangled Representation in Latent Stochastic Models: {A} Case Study with Image Captioning}, booktitle = {{IEEE} International Conference on Acoustics, Speech and Signal Processing, {ICASSP} 2019, Brighton, United Kingdom, May 12-17, 2019}, pages = {4010--4014}, publisher = {{IEEE}}, year = {2019}, url = {https://doi.org/10.1109/ICASSP.2019.8683370}, doi = {10.1109/ICASSP.2019.8683370}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icassp/VyasRMHB19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/MaZH19, author = {Xuezhe Ma and Chunting Zhou and Eduard H. Hovy}, title = {{MAE:} Mutual Posterior-Divergence Regularization for Variational AutoEncoders}, booktitle = {7th International Conference on Learning Representations, {ICLR} 2019, New Orleans, LA, USA, May 6-9, 2019}, publisher = {OpenReview.net}, year = {2019}, url = {https://openreview.net/forum?id=Hke4l2AcKQ}, timestamp = {Thu, 25 Jul 2019 13:03:15 +0200}, biburl = {https://dblp.org/rec/conf/iclr/MaZH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Echizen-yaAH19, author = {Hiroshi Echizen{-}ya and Kenji Araki and Eduard H. Hovy}, editor = {Jill Burstein and Christy Doran and Thamar Solorio}, title = {Word Embedding-Based Automatic {MT} Evaluation Metric using Word Position Information}, booktitle = {Proceedings of the 2019 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, {NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long and Short Papers)}, pages = {1874--1883}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/n19-1186}, doi = {10.18653/V1/N19-1186}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Echizen-yaAH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/AhmadZMHCP19, author = {Wasi Uddin Ahmad and Zhisong Zhang and Xuezhe Ma and Eduard H. Hovy and Kai{-}Wei Chang and Nanyun Peng}, editor = {Jill Burstein and Christy Doran and Thamar Solorio}, title = {On Difficulties of Cross-Lingual Transfer with Order Differences: {A} Case Study on Dependency Parsing}, booktitle = {Proceedings of the 2019 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, {NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long and Short Papers)}, pages = {2440--2452}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/n19-1253}, doi = {10.18653/V1/N19-1253}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/AhmadZMHCP19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Dasigi0MZH19, author = {Pradeep Dasigi and Matt Gardner and Shikhar Murty and Luke Zettlemoyer and Eduard H. Hovy}, editor = {Jill Burstein and Christy Doran and Thamar Solorio}, title = {Iterative Search for Weakly Supervised Semantic Parsing}, booktitle = {Proceedings of the 2019 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, {NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long and Short Papers)}, pages = {2669--2680}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/n19-1273}, doi = {10.18653/V1/N19-1273}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Dasigi0MZH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/YangCYJH19, author = {Diyi Yang and Jiaao Chen and Zichao Yang and Dan Jurafsky and Eduard H. Hovy}, editor = {Jill Burstein and Christy Doran and Thamar Solorio}, title = {Let's Make Your Request More Persuasive: Modeling Persuasive Strategies via Semi-Supervised Neural Nets on Crowdfunding Platforms}, booktitle = {Proceedings of the 2019 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, {NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long and Short Papers)}, pages = {3620--3630}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/n19-1364}, doi = {10.18653/V1/N19-1364}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/YangCYJH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/MaKZH19, author = {Xuezhe Ma and Xiang Kong and Shanghang Zhang and Eduard H. Hovy}, editor = {Hanna M. Wallach and Hugo Larochelle and Alina Beygelzimer and Florence d'Alch{\'{e}}{-}Buc and Emily B. Fox and Roman Garnett}, title = {MaCow: Masked Convolutional Generative Flow}, booktitle = {Advances in Neural Information Processing Systems 32: Annual Conference on Neural Information Processing Systems 2019, NeurIPS 2019, December 8-14, 2019, Vancouver, BC, Canada}, pages = {5891--5900}, year = {2019}, url = {https://proceedings.neurips.cc/paper/2019/hash/20c86a628232a67e7bd46f76fba7ce12-Abstract.html}, timestamp = {Mon, 16 May 2022 15:41:51 +0200}, biburl = {https://dblp.org/rec/conf/nips/MaKZH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/textgraphs/VaibhavAH19, author = {Vaibhav Vaibhav and Raghuram Mandyam Annasamy and Eduard H. Hovy}, editor = {Dmitry Ustalov and Swapna Somasundaran and Peter Jansen and Goran Glavas and Martin Riedl and Mihai Surdeanu and Michalis Vazirgiannis}, title = {Do Sentence Interactions Matter? Leveraging Sentence Level Representations for Fake News Classification}, booktitle = {Proceedings of the Thirteenth Workshop on Graph-Based Methods for Natural Language Processing, TextGraphs@EMNLP 2019, Hong Kong, November 4, 2019}, pages = {134--139}, publisher = {Association for Computational Linguistics}, year = {2019}, url = {https://doi.org/10.18653/v1/D19-5316}, doi = {10.18653/V1/D19-5316}, timestamp = {Thu, 05 May 2022 07:34:24 +0200}, biburl = {https://dblp.org/rec/conf/textgraphs/VaibhavAH19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/sp/19/PenasRMFHSG19, author = {Anselmo Pe{\~{n}}as and {\'{A}}lvaro Rodrigo and Bernardo Magnini and Pamela Forner and Eduard H. Hovy and Richard F. E. Sutcliffe and Danilo Giampiccolo}, editor = {Nicola Ferro and Carol Peters}, title = {Results and Lessons of the Question Answering Track at {CLEF}}, booktitle = {Information Retrieval Evaluation in a Changing World - Lessons Learned from 20 Years of {CLEF}}, series = {The Information Retrieval Series}, volume = {41}, pages = {441--460}, publisher = {Springer}, year = {2019}, url = {https://doi.org/10.1007/978-3-030-22948-1\_18}, doi = {10.1007/978-3-030-22948-1\_18}, timestamp = {Thu, 15 Aug 2019 08:40:53 +0200}, biburl = {https://dblp.org/rec/books/sp/19/PenasRMFHSG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/HovyCCGHMMSDCCK19, author = {Eduard H. Hovy and Jaime G. Carbonell and Hans Chalupsky and Anatole Gershman and Alex Hauptmann and Florian Metze and Teruko Mitamura and Zaid Sheikh and Ankit Dangi and Aditi Chaudhary and Xianyang Chen and Xiang Kong and Bernie Huang and Salvador Medina and Hector Liu and Xuezhe Ma and Maria Ryskina and Ramon Sanabria and Varun Gangal}, title = {{OPERA:} Operations-oriented Probabilistic Extraction, Reasoning, and Analysis}, booktitle = {Proceedings of the 2019 Text Analysis Conference, {TAC} 2019, Gaithersburg, Maryland, USA, November 12-13, 2019}, publisher = {{NIST}}, year = {2019}, url = {https://tac.nist.gov/publications/2019/participant.papers/TAC2019.OPERA.proceedings.pdf}, timestamp = {Mon, 19 Apr 2021 12:42:35 +0200}, biburl = {https://dblp.org/rec/conf/tac/HovyCCGHMMSDCCK19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1901-01498, author = {Xuezhe Ma and Chunting Zhou and Eduard H. Hovy}, title = {{MAE:} Mutual Posterior-Divergence Regularization for Variational AutoEncoders}, journal = {CoRR}, volume = {abs/1901.01498}, year = {2019}, url = {http://arxiv.org/abs/1901.01498}, eprinttype = {arXiv}, eprint = {1901.01498}, timestamp = {Thu, 31 Jan 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1901-01498.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1901-03735, author = {Abhilasha Ravichander and Aakanksha Naik and Carolyn P. Ros{\'{e}} and Eduard H. Hovy}, title = {{EQUATE:} {A} Benchmark Evaluation Framework for Quantitative Reasoning in Natural Language Inference}, journal = {CoRR}, volume = {abs/1901.03735}, year = {2019}, url = {http://arxiv.org/abs/1901.03735}, eprinttype = {arXiv}, eprint = {1901.03735}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1901-03735.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1901-07129, author = {Xiang Kong and Bohan Li and Graham Neubig and Eduard H. Hovy and Yiming Yang}, title = {An Adversarial Approach to High-Quality, Sentiment-Controlled Neural Dialogue Generation}, journal = {CoRR}, volume = {abs/1901.07129}, year = {2019}, url = {http://arxiv.org/abs/1901.07129}, eprinttype = {arXiv}, eprint = {1901.07129}, timestamp = {Fri, 01 Feb 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1901-07129.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1902-04208, author = {Xuezhe Ma and Eduard H. Hovy}, title = {MaCow: Masked Convolutional Generative Flow}, journal = {CoRR}, volume = {abs/1902.04208}, year = {2019}, url = {http://arxiv.org/abs/1902.04208}, eprinttype = {arXiv}, eprint = {1902.04208}, timestamp = {Tue, 21 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1902-04208.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1902-08899, author = {Aditi Chaudhary and Siddharth Dalmia and Junjie Hu and Xinjian Li and Austin Matthews and Aldrian Obaja Muis and Naoki Otani and Shruti Rijhwani and Zaid Sheikh and Nidhi Vyas and Xinyi Wang and Jiateng Xie and Ruochen Xu and Chunting Zhou and Peter J. Jansen and Yiming Yang and Lori S. Levin and Florian Metze and Teruko Mitamura and David R. Mortensen and Graham Neubig and Eduard H. Hovy and Alan W. Black and Jaime G. Carbonell and Graham Horwood and Shabnam Tafreshi and Mona T. Diab and Efsun Sarioglu Kayi and Noura Farra and Kathleen R. McKeown}, title = {The {ARIEL-CMU} Systems for LoReHLT18}, journal = {CoRR}, volume = {abs/1902.08899}, year = {2019}, url = {http://arxiv.org/abs/1902.08899}, eprinttype = {arXiv}, eprint = {1902.08899}, timestamp = {Fri, 03 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1902-08899.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1904-12848, author = {Qizhe Xie and Zihang Dai and Eduard H. Hovy and Minh{-}Thang Luong and Quoc V. Le}, title = {Unsupervised Data Augmentation}, journal = {CoRR}, volume = {abs/1904.12848}, year = {2019}, url = {http://arxiv.org/abs/1904.12848}, eprinttype = {arXiv}, eprint = {1904.12848}, timestamp = {Thu, 02 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1904-12848.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1905-02947, author = {Soujanya Poria and Navonil Majumder and Rada Mihalcea and Eduard H. Hovy}, title = {Emotion Recognition in Conversation: Research Challenges, Datasets, and Recent Advances}, journal = {CoRR}, volume = {abs/1905.02947}, year = {2019}, url = {http://arxiv.org/abs/1905.02947}, eprinttype = {arXiv}, eprint = {1905.02947}, timestamp = {Tue, 23 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1905-02947.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1908-11723, author = {Taehee Jung and Dongyeop Kang and Lucas Mentch and Eduard H. Hovy}, title = {Earlier Isn't Always Better: Sub-aspect Analysis on Corpus and System Biases in Summarization}, journal = {CoRR}, volume = {abs/1908.11723}, year = {2019}, url = {http://arxiv.org/abs/1908.11723}, eprinttype = {arXiv}, eprint = {1908.11723}, timestamp = {Wed, 04 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1908-11723.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1908-11790, author = {Dongyeop Kang and Hiroaki Hayashi and Alan W. Black and Eduard H. Hovy}, title = {Linguistic Versus Latent Relations for Modeling Coherent Flow in Paragraphs}, journal = {CoRR}, volume = {abs/1908.11790}, year = {2019}, url = {http://arxiv.org/abs/1908.11790}, eprinttype = {arXiv}, eprint = {1908.11790}, timestamp = {Wed, 04 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1908-11790.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1909-00098, author = {Dongyeop Kang and Varun Gangal and Eduard H. Hovy}, title = {(Male, Bachelor) and (Female, Ph.D) have different connotations: Parallelly Annotated Stylistic Language Dataset with Multiple Personas}, journal = {CoRR}, volume = {abs/1909.00098}, year = {2019}, url = {http://arxiv.org/abs/1909.00098}, eprinttype = {arXiv}, eprint = {1909.00098}, timestamp = {Mon, 16 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-00098.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1909-02250, author = {Takashi Shibuya and Eduard H. Hovy}, title = {Nested Named Entity Recognition via Second-best Sequence Learning and Decoding}, journal = {CoRR}, volume = {abs/1909.02250}, year = {2019}, url = {http://arxiv.org/abs/1909.02250}, eprinttype = {arXiv}, eprint = {1909.02250}, timestamp = {Mon, 24 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-02250.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1909-02480, author = {Xuezhe Ma and Chunting Zhou and Xian Li and Graham Neubig and Eduard H. Hovy}, title = {FlowSeq: Non-Autoregressive Conditional Sequence Generation with Generative Flow}, journal = {CoRR}, volume = {abs/1909.02480}, year = {2019}, url = {http://arxiv.org/abs/1909.02480}, eprinttype = {arXiv}, eprint = {1909.02480}, timestamp = {Mon, 16 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-02480.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1909-04793, author = {Evangelia Spiliopoulou and Eduard H. Hovy}, title = {Definition Frames: Using Definitions for Hybrid Concept Representations}, journal = {CoRR}, volume = {abs/1909.04793}, year = {2019}, url = {http://arxiv.org/abs/1909.04793}, eprinttype = {arXiv}, eprint = {1909.04793}, timestamp = {Tue, 17 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-04793.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1909-12434, author = {Divyansh Kaushik and Eduard H. Hovy and Zachary C. Lipton}, title = {Learning the Difference that Makes a Difference with Counterfactually-Augmented Data}, journal = {CoRR}, volume = {abs/1909.12434}, year = {2019}, url = {http://arxiv.org/abs/1909.12434}, eprinttype = {arXiv}, eprint = {1909.12434}, timestamp = {Mon, 06 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1909-12434.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1910-12203, author = {Vaibhav Vaibhav and Raghuram Mandyam Annasamy and Eduard H. Hovy}, title = {Do Sentence Interactions Matter? Leveraging Sentence Level Representations for Fake News Classification}, journal = {CoRR}, volume = {abs/1910.12203}, year = {2019}, url = {http://arxiv.org/abs/1910.12203}, eprinttype = {arXiv}, eprint = {1910.12203}, timestamp = {Mon, 06 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1910-12203.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1911-03663, author = {Dongyeop Kang and Eduard H. Hovy}, title = {xSLUE: {A} Benchmark and Analysis Platform for Cross-Style Language Understanding and Evaluation}, journal = {CoRR}, volume = {abs/1911.03663}, year = {2019}, url = {http://arxiv.org/abs/1911.03663}, eprinttype = {arXiv}, eprint = {1911.03663}, timestamp = {Sun, 01 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1911-03663.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1911-04053, author = {Xiang Kong and Xianyang Chen and Eduard H. Hovy}, title = {Decompressing Knowledge Graph Representations for Link Prediction}, journal = {CoRR}, volume = {abs/1911.04053}, year = {2019}, url = {http://arxiv.org/abs/1911.04053}, eprinttype = {arXiv}, eprint = {1911.04053}, timestamp = {Sun, 01 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1911-04053.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1911-04252, author = {Qizhe Xie and Eduard H. Hovy and Minh{-}Thang Luong and Quoc V. Le}, title = {Self-training with Noisy Student improves ImageNet classification}, journal = {CoRR}, volume = {abs/1911.04252}, year = {2019}, url = {http://arxiv.org/abs/1911.04252}, eprinttype = {arXiv}, eprint = {1911.04252}, timestamp = {Sun, 01 Dec 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1911-04252.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mt/LittellTXSMLTHH18, author = {Patrick Littell and Tian Tian and Ruochen Xu and Zaid Sheikh and David R. Mortensen and Lori S. Levin and Francis M. Tyers and Hiroaki Hayashi and Graham Horwood and Steve Sloto and Emily Tagtow and Alan W. Black and Yiming Yang and Teruko Mitamura and Eduard H. Hovy}, title = {The {ARIEL-CMU} situation frame detection pipeline for LoReHLT16: a model translation approach}, journal = {Mach. Transl.}, volume = {32}, number = {1-2}, pages = {105--126}, year = {2018}, url = {https://doi.org/10.1007/s10590-017-9205-3}, doi = {10.1007/S10590-017-9205-3}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/mt/LittellTXSMLTHH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/SubramanianPJBH18, author = {Anant Subramanian and Danish Pruthi and Harsh Jhamtani and Taylor Berg{-}Kirkpatrick and Eduard H. Hovy}, editor = {Sheila A. McIlraith and Kilian Q. Weinberger}, title = {{SPINE:} SParse Interpretable Neural Embeddings}, booktitle = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence, (AAAI-18), the 30th innovative Applications of Artificial Intelligence (IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February 2-7, 2018}, pages = {4921--4928}, publisher = {{AAAI} Press}, year = {2018}, url = {https://doi.org/10.1609/aaai.v32i1.11935}, doi = {10.1609/AAAI.V32I1.11935}, timestamp = {Mon, 04 Sep 2023 12:29:24 +0200}, biburl = {https://dblp.org/rec/conf/aaai/SubramanianPJBH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/HovyMNPHL18, author = {Xuezhe Ma and Zecong Hu and Jingzhou Liu and Nanyun Peng and Graham Neubig and Eduard H. Hovy}, editor = {Iryna Gurevych and Yusuke Miyao}, title = {Stack-Pointer Networks for Dependency Parsing}, booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume 1: Long Papers}, pages = {1403--1414}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/P18-1130/}, doi = {10.18653/V1/P18-1130}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/HovyMNPHL18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/HovyNBGJ18, author = {Harsh Jhamtani and Varun Gangal and Eduard H. Hovy and Graham Neubig and Taylor Berg{-}Kirkpatrick}, editor = {Iryna Gurevych and Yusuke Miyao}, title = {Learning to Generate Move-by-Move Commentary for Chess Games from Large-Scale Social Forum Data}, booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume 1: Long Papers}, pages = {1661--1671}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/P18-1154/}, doi = {10.18653/V1/P18-1154}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/HovyNBGJ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/HovyXD18, author = {Zihang Dai and Qizhe Xie and Eduard H. Hovy}, editor = {Iryna Gurevych and Yusuke Miyao}, title = {From Credit Assignment to Entropy Regularization: Two New Algorithms for Neural Sequence Prediction}, booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume 1: Long Papers}, pages = {1672--1682}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/P18-1155/}, doi = {10.18653/V1/P18-1155}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/HovyXD18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/HovyKSK18, author = {Dongyeop Kang and Tushar Khot and Ashish Sabharwal and Eduard H. Hovy}, editor = {Iryna Gurevych and Yusuke Miyao}, title = {AdvEntuRe: Adversarial Training for Textual Entailment with Knowledge-Guided Examples}, booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume 1: Long Papers}, pages = {2418--2428}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/P18-1225/}, doi = {10.18653/V1/P18-1225}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/HovyKSK18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/MuisOVXYMH18, author = {Aldrian Obaja Muis and Naoki Otani and Nidhi Vyas and Ruochen Xu and Yiming Yang and Teruko Mitamura and Eduard H. Hovy}, editor = {Emily M. Bender and Leon Derczynski and Pierre Isabelle}, title = {Low-resource Cross-lingual Event Type Detection via Distant Supervision with Minimal Effort}, booktitle = {Proceedings of the 27th International Conference on Computational Linguistics, {COLING} 2018, Santa Fe, New Mexico, USA, August 20-26, 2018}, pages = {70--82}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/C18-1007/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/MuisOVXYMH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/LiuMH18, author = {Zhengzhong Liu and Teruko Mitamura and Eduard H. Hovy}, editor = {Emily M. Bender and Leon Derczynski and Pierre Isabelle}, title = {Graph Based Decoding for Event Sequencing and Coreference Resolution}, booktitle = {Proceedings of the 27th International Conference on Computational Linguistics, {COLING} 2018, Santa Fe, New Mexico, USA, August 20-26, 2018}, pages = {3645--3657}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/C18-1309/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/LiuMH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiuXMH18, author = {Zhengzhong Liu and Chenyan Xiong and Teruko Mitamura and Eduard H. Hovy}, editor = {Ellen Riloff and David Chiang and Julia Hockenmaier and Jun'ichi Tsujii}, title = {Automatic Event Salience Identification}, booktitle = {Proceedings of the 2018 Conference on Empirical Methods in Natural Language Processing, Brussels, Belgium, October 31 - November 4, 2018}, pages = {1226--1236}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://doi.org/10.18653/v1/d18-1154}, doi = {10.18653/V1/D18-1154}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/LiuXMH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/XieLDH18, author = {Qizhe Xie and Guokun Lai and Zihang Dai and Eduard H. Hovy}, editor = {Ellen Riloff and David Chiang and Julia Hockenmaier and Jun'ichi Tsujii}, title = {Large-scale Cloze Test Dataset Created by Teachers}, booktitle = {Proceedings of the 2018 Conference on Empirical Methods in Natural Language Processing, Brussels, Belgium, October 31 - November 4, 2018}, pages = {2344--2356}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://doi.org/10.18653/v1/d18-1257}, doi = {10.18653/V1/D18-1257}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/XieLDH18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icaart/Hovy18, author = {Eduard H. Hovy}, editor = {Ana Paula Rocha and H. Jaap van den Herik}, title = {Reading Agents that Hunger for Knowledge}, booktitle = {Proceedings of the 10th International Conference on Agents and Artificial Intelligence, {ICAART} 2018, Volume 1, Funchal, Madeira, Portugal, January 16-18, 2018}, pages = {9}, publisher = {SciTePress}, year = {2018}, timestamp = {Fri, 04 Oct 2019 14:17:27 +0200}, biburl = {https://dblp.org/rec/conf/icaart/Hovy18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/KangADZKHS18, author = {Dongyeop Kang and Waleed Ammar and Bhavana Dalvi and Madeleine van Zuylen and Sebastian Kohlmeier and Eduard H. Hovy and Roy Schwartz}, editor = {Marilyn A. Walker and Heng Ji and Amanda Stent}, title = {A Dataset of Peer Reviews (PeerRead): Collection, Insights and {NLP} Applications}, booktitle = {Proceedings of the 2018 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, {NAACL-HLT} 2018, New Orleans, Louisiana, USA, June 1-6, 2018, Volume 1 (Long Papers)}, pages = {1647--1661}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://doi.org/10.18653/v1/n18-1149}, doi = {10.18653/V1/N18-1149}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/KangADZKHS18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/coling/2018eventstory, editor = {Tommaso Caselli and Ben Miller and Marieke van Erp and Piek Vossen and Martha Palmer and Eduard H. Hovy and Teruko Mitamura and David Caswell and Susan Windisch Brown and Claire Bonial}, title = {Proceedings of the Workshop Events and Stories in the News, EventStory@Coling 2018, Santa Fe, New Mexico, USA, August 20, 2018}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/volumes/W18-43/}, isbn = {978-1-948087-59-9}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/2018eventstory.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/textgraphs/2018, editor = {Goran Glavas and Swapna Somasundaran and Martin Riedl and Eduard H. Hovy}, title = {Proceedings of the Twelfth Workshop on Graph-Based Methods for Natural Language Processing, TextGraphs@NAACL-HLT 2018, New Orleans, Louisiana, USA, June 6, 2018}, publisher = {Association for Computational Linguistics}, year = {2018}, url = {https://aclanthology.org/volumes/W18-17/}, isbn = {978-1-948087-25-4}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/textgraphs/2018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/HovyBCCGHMMCCHL18, author = {Eduard H. Hovy and Taylor Berg{-}Kirkpatrick and Jaime G. Carbonell and Hans Chalupsky and Anatole Gershman and Alexander G. Hauptmann and Florian Metze and Teruko Mitamura and Aditi Chaudhary and Xianyang Chen and Bernie Po{-}Yao Huang and Hector Zhengzhong Liu and Xuezhe Ma and Shruti Palaskar and Dheeraj Rajagopal and Maria Ryskina and Ramon Sanabria}, title = {{OPERA:} Operations-oriented Probabilistic Extraction, Reasoning, and Analysis}, booktitle = {Proceedings of the 2018 Text Analysis Conference, {TAC} 2018, Gaithersburg, Maryland, USA, November 13-14, 2018}, publisher = {{NIST}}, year = {2018}, url = {https://tac.nist.gov/publications/2018/participant.papers/TAC2018.OPERA.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 14:30:47 +0200}, biburl = {https://dblp.org/rec/conf/tac/HovyBCCGHMMCCHL18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1804-09635, author = {Dongyeop Kang and Waleed Ammar and Bhavana Dalvi and Madeleine van Zuylen and Sebastian Kohlmeier and Eduard H. Hovy and Roy Schwartz}, title = {A Dataset of Peer Reviews (PeerRead): Collection, Insights and {NLP} Applications}, journal = {CoRR}, volume = {abs/1804.09635}, year = {2018}, url = {http://arxiv.org/abs/1804.09635}, eprinttype = {arXiv}, eprint = {1804.09635}, timestamp = {Wed, 23 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1804-09635.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1804-10974, author = {Zihang Dai and Qizhe Xie and Eduard H. Hovy}, title = {From Credit Assignment to Entropy Regularization: Two New Algorithms for Neural Sequence Prediction}, journal = {CoRR}, volume = {abs/1804.10974}, year = {2018}, url = {http://arxiv.org/abs/1804.10974}, eprinttype = {arXiv}, eprint = {1804.10974}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1804-10974.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1805-01087, author = {Xuezhe Ma and Zecong Hu and Jingzhou Liu and Nanyun Peng and Graham Neubig and Eduard H. Hovy}, title = {Stack-Pointer Networks for Dependency Parsing}, journal = {CoRR}, volume = {abs/1805.01087}, year = {2018}, url = {http://arxiv.org/abs/1805.01087}, eprinttype = {arXiv}, eprint = {1805.01087}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1805-01087.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1805-04680, author = {Dongyeop Kang and Tushar Khot and Ashish Sabharwal and Eduard H. Hovy}, title = {AdvEntuRe: Adversarial Training for Textual Entailment with Knowledge-Guided Examples}, journal = {CoRR}, volume = {abs/1805.04680}, year = {2018}, url = {http://arxiv.org/abs/1805.04680}, eprinttype = {arXiv}, eprint = {1805.04680}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1805-04680.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1806-05099, author = {Zhengzhong Liu and Teruko Mitamura and Eduard H. Hovy}, title = {Graph-Based Decoding for Event Sequencing and Coreference Resolution}, journal = {CoRR}, volume = {abs/1806.05099}, year = {2018}, url = {http://arxiv.org/abs/1806.05099}, eprinttype = {arXiv}, eprint = {1806.05099}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1806-05099.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-00647, author = {Zhengzhong Liu and Chenyan Xiong and Teruko Mitamura and Eduard H. Hovy}, title = {Automatic Event Salience Identification}, journal = {CoRR}, volume = {abs/1809.00647}, year = {2018}, url = {http://arxiv.org/abs/1809.00647}, eprinttype = {arXiv}, eprint = {1809.00647}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-00647.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1809-09296, author = {Xiang Kong and Qizhe Xie and Zihang Dai and Eduard H. Hovy}, title = {Fast and Simple Mixture of Softmaxes with {BPE} and Hybrid-LightRNN for Language Generation}, journal = {CoRR}, volume = {abs/1809.09296}, year = {2018}, url = {http://arxiv.org/abs/1809.09296}, eprinttype = {arXiv}, eprint = {1809.09296}, timestamp = {Fri, 05 Oct 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1809-09296.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1810-00782, author = {Filip Ilievski and Eduard H. Hovy and Qizhe Xie and Piek Vossen}, title = {The Profiling Machine: Active Generalization over Knowledge}, journal = {CoRR}, volume = {abs/1810.00782}, year = {2018}, url = {http://arxiv.org/abs/1810.00782}, eprinttype = {arXiv}, eprint = {1810.00782}, timestamp = {Tue, 30 Oct 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1810-00782.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1811-00570, author = {Wasi Uddin Ahmad and Zhisong Zhang and Xuezhe Ma and Eduard H. Hovy and Kai{-}Wei Chang and Nanyun Peng}, title = {Near or Far, Wide Range Zero-Shot Cross-Lingual Dependency Parsing}, journal = {CoRR}, volume = {abs/1811.00570}, year = {2018}, url = {http://arxiv.org/abs/1811.00570}, eprinttype = {arXiv}, eprint = {1811.00570}, timestamp = {Thu, 22 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1811-00570.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1811-05546, author = {Mrinmaya Sachan and Kumar Avinava Dubey and Eduard H. Hovy and Tom M. Mitchell and Dan Roth and Eric P. Xing}, title = {Discourse in Multimedia: {A} Case Study in Information Extraction}, journal = {CoRR}, volume = {abs/1811.05546}, year = {2018}, url = {http://arxiv.org/abs/1811.05546}, eprinttype = {arXiv}, eprint = {1811.05546}, timestamp = {Sat, 24 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1811-05546.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1811-08541, author = {Xiang Kong and Zhaopeng Tu and Shuming Shi and Eduard H. Hovy and Tong Zhang}, title = {Neural Machine Translation with Adequacy-Oriented Learning}, journal = {CoRR}, volume = {abs/1811.08541}, year = {2018}, url = {http://arxiv.org/abs/1811.08541}, eprinttype = {arXiv}, eprint = {1811.08541}, timestamp = {Mon, 18 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1811-08541.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/SpiliopoulouHM17, author = {Evangelia Spiliopoulou and Eduard H. Hovy and Teruko Mitamura}, editor = {Tommaso Caselli and Ben Miller and Marieke van Erp and Piek Vossen and Martha Palmer and Eduard H. Hovy and Teruko Mitamura and David Caswell}, title = {Event Detection Using Frame-Semantic Parser}, booktitle = {Proceedings of the Events and Stories in the News Workshop@ACL 2017, Vancouver, Canada, August 4, 2017}, pages = {15--20}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/w17-2703}, doi = {10.18653/V1/W17-2703}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/SpiliopoulouHM17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/XieMDH17, author = {Qizhe Xie and Xuezhe Ma and Zihang Dai and Eduard H. Hovy}, editor = {Regina Barzilay and Min{-}Yen Kan}, title = {An Interpretable Knowledge Transfer Model for Knowledge Base Completion}, booktitle = {Proceedings of the 55th Annual Meeting of the Association for Computational Linguistics, {ACL} 2017, Vancouver, Canada, July 30 - August 4, Volume 1: Long Papers}, pages = {950--962}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/P17-1088}, doi = {10.18653/V1/P17-1088}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/XieMDH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/DasigiADH17, author = {Pradeep Dasigi and Waleed Ammar and Chris Dyer and Eduard H. Hovy}, editor = {Regina Barzilay and Min{-}Yen Kan}, title = {Ontology-Aware Token Embeddings for Prepositional Phrase Attachment}, booktitle = {Proceedings of the 55th Annual Meeting of the Association for Computational Linguistics, {ACL} 2017, Vancouver, Canada, July 30 - August 4, Volume 1: Long Papers}, pages = {2089--2098}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/P17-1191}, doi = {10.18653/V1/P17-1191}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/DasigiADH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aclnut/SalehiHHS17, author = {Bahar Salehi and Dirk Hovy and Eduard H. Hovy and Anders S{\o}gaard}, editor = {Leon Derczynski and Wei Xu and Alan Ritter and Tim Baldwin}, title = {Huntsville, hospitals, and hockey teams: Names can reveal your location}, booktitle = {Proceedings of the 3rd Workshop on Noisy User-generated Text, NUT@EMNLP 2017, Copenhagen, Denmark, September 7, 2017}, pages = {116--121}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/w17-4415}, doi = {10.18653/V1/W17-4415}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aclnut/SalehiHHS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cikm/XiongLCH17, author = {Chenyan Xiong and Zhengzhong Liu and Jamie Callan and Eduard H. Hovy}, editor = {Ee{-}Peng Lim and Marianne Winslett and Mark Sanderson and Ada Wai{-}Chee Fu and Jimeng Sun and J. Shane Culpepper and Eric Lo and Joyce C. Ho and Debora Donato and Rakesh Agrawal and Yu Zheng and Carlos Castillo and Aixin Sun and Vincent S. Tseng and Chenliang Li}, title = {JointSem: Combining Query Entity Linking and Entity based Document Ranking}, booktitle = {Proceedings of the 2017 {ACM} on Conference on Information and Knowledge Management, {CIKM} 2017, Singapore, November 06 - 10, 2017}, pages = {2391--2394}, publisher = {{ACM}}, year = {2017}, url = {https://doi.org/10.1145/3132847.3133048}, doi = {10.1145/3132847.3133048}, timestamp = {Tue, 29 Aug 2023 16:24:43 +0200}, biburl = {https://dblp.org/rec/conf/cikm/XiongLCH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LaiXLYH17, author = {Guokun Lai and Qizhe Xie and Hanxiao Liu and Yiming Yang and Eduard H. Hovy}, editor = {Martha Palmer and Rebecca Hwa and Sebastian Riedel}, title = {{RACE:} Large-scale ReAding Comprehension Dataset From Examinations}, booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September 9-11, 2017}, pages = {785--794}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/d17-1082}, doi = {10.18653/V1/D17-1082}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/LaiXLYH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/YangHKH17, author = {Diyi Yang and Aaron Halfaker and Robert E. Kraut and Eduard H. Hovy}, editor = {Martha Palmer and Rebecca Hwa and Sebastian Riedel}, title = {Identifying Semantic Edit Intentions from Revisions in Wikipedia}, booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September 9-11, 2017}, pages = {2000--2010}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/d17-1213}, doi = {10.18653/V1/D17-1213}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/YangHKH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/KangGLCH17, author = {Dongyeop Kang and Varun Gangal and Ang Lu and Zheng Chen and Eduard H. Hovy}, editor = {Martha Palmer and Rebecca Hwa and Sebastian Riedel}, title = {Detecting and Explaining Causes From Text For a Time Series Event}, booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September 9-11, 2017}, pages = {2758--2767}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/d17-1292}, doi = {10.18653/V1/D17-1292}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/KangGLCH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/GangalJNHN17, author = {Varun Gangal and Harsh Jhamtani and Graham Neubig and Eduard H. Hovy and Eric Nyberg}, editor = {Martha Palmer and Rebecca Hwa and Sebastian Riedel}, title = {Charmanteau: Character Embedding Models For Portmanteau Creation}, booktitle = {Proceedings of the 2017 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2017, Copenhagen, Denmark, September 9-11, 2017}, pages = {2917--2922}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/d17-1315}, doi = {10.18653/V1/D17-1315}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/GangalJNHN17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/DaiABHC17, author = {Zihang Dai and Amjad Almahairi and Philip Bachman and Eduard H. Hovy and Aaron C. Courville}, title = {Calibrating Energy-based Generative Adversarial Networks}, booktitle = {5th International Conference on Learning Representations, {ICLR} 2017, Toulon, France, April 24-26, 2017, Conference Track Proceedings}, publisher = {OpenReview.net}, year = {2017}, url = {https://openreview.net/forum?id=SyxeqhP9ll}, timestamp = {Thu, 25 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/DaiABHC17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iclr/MaGHYDH17, author = {Xuezhe Ma and Yingkai Gao and Zhiting Hu and Yaoliang Yu and Yuntian Deng and Eduard H. Hovy}, title = {Dropout with Expectation-linear Regularization}, booktitle = {5th International Conference on Learning Representations, {ICLR} 2017, Toulon, France, April 24-26, 2017, Conference Track Proceedings}, publisher = {OpenReview.net}, year = {2017}, url = {https://openreview.net/forum?id=rkGabzZgl}, timestamp = {Thu, 25 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iclr/MaGHYDH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnlp/MaH17, author = {Xuezhe Ma and Eduard H. Hovy}, editor = {Greg Kondrak and Taro Watanabe}, title = {Neural Probabilistic Model for Non-projective {MST} Parsing}, booktitle = {Proceedings of the Eighth International Joint Conference on Natural Language Processing, {IJCNLP} 2017, Taipei, Taiwan, November 27 - December 1, 2017 - Volume 1: Long Papers}, pages = {59--69}, publisher = {Asian Federation of Natural Language Processing}, year = {2017}, url = {https://aclanthology.org/I17-1007/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcnlp/MaH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnlp/XuMTH17, author = {Jiarui Xu and Xuezhe Ma and Chen{-}Tse Tsai and Eduard H. Hovy}, editor = {Seong{-}Bae Park and Thepchai Supnithi}, title = {{STCP:} Simplified-Traditional Chinese Conversion and Proofreading}, booktitle = {Proceedings of the {IJCNLP} 2017, Tapei, Taiwan, November 27 - December 1, 2017, System Demonstrations}, pages = {61--64}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://aclanthology.org/I17-3016/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcnlp/XuMTH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mediaeval/SutcliffeMH17, author = {Richard F. E. Sutcliffe and Donncha {\'{O}} Maid{\'{\i}}n and Eduard H. Hovy}, editor = {Guillaume Gravier and Benjamin Bischke and Claire{-}H{\'{e}}l{\`{e}}ne Demarty and Maia Zaharieva and Michael Riegler and Emmanuel Dellandr{\'{e}}a and Dmitry Bogdanov and Richard F. E. Sutcliffe and Gareth J. F. Jones and Martha A. Larson}, title = {The C@merata task at MediaEval 2017: Natural Language Queries about Music, their {JSON} Representations, and Matching Passages in MusicXML Scores}, booktitle = {Working Notes Proceedings of the MediaEval 2017 Workshop co-located with the Conference and Labs of the Evaluation Forum {(CLEF} 2017), Dublin, Ireland, September 13-15, 2017}, series = {{CEUR} Workshop Proceedings}, volume = {1984}, publisher = {CEUR-WS.org}, year = {2017}, url = {https://ceur-ws.org/Vol-1984/Mediaeval\_2017\_paper\_35.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:12 +0100}, biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeMH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/XieDDHN17, author = {Qizhe Xie and Zihang Dai and Yulun Du and Eduard H. Hovy and Graham Neubig}, editor = {Isabelle Guyon and Ulrike von Luxburg and Samy Bengio and Hanna M. Wallach and Rob Fergus and S. V. N. Vishwanathan and Roman Garnett}, title = {Controllable Invariance through Adversarial Feature Learning}, booktitle = {Advances in Neural Information Processing Systems 30: Annual Conference on Neural Information Processing Systems 2017, December 4-9, 2017, Long Beach, CA, {USA}}, pages = {585--596}, year = {2017}, url = {https://proceedings.neurips.cc/paper/2017/hash/8cb22bdd0b7ba1ab13d742e22eed8da2-Abstract.html}, timestamp = {Thu, 21 Jan 2021 13:58:27 +0100}, biburl = {https://dblp.org/rec/conf/nips/XieDDHN17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/semweb/BurnsDH17, author = {Gully Burns and Pradeep Dasigi and Eduard H. Hovy}, editor = {Daniel Garijo and Willem Robert van Hage and Tomi Kauppinen and Tobias Kuhn and Jun Zhao}, title = {Extracting Evidence Fragments for Distant Supervision of Molecular Interactions}, booktitle = {Proceedings of the First Workshop on Enabling Open Semantic Science co-located with 16th International Semantic Web Conference {(ISWC} 2017), Vienna, Austria, October 21st, 2017}, series = {{CEUR} Workshop Proceedings}, volume = {1931}, pages = {7--14}, publisher = {CEUR-WS.org}, year = {2017}, url = {https://ceur-ws.org/Vol-1931/paper-02.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:05 +0100}, biburl = {https://dblp.org/rec/conf/semweb/BurnsDH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigdial/JangMHR17, author = {Hyeju Jang and Keith Maki and Eduard H. Hovy and Carolyn P. Ros{\'{e}}}, editor = {Kristiina Jokinen and Manfred Stede and David DeVault and Annie Louis}, title = {Finding Structure in Figurative Language: Metaphor Detection with Topic-based Frames}, booktitle = {Proceedings of the 18th Annual SIGdial Meeting on Discourse and Dialogue, Saarbr{\"{u}}cken, Germany, August 15-17, 2017}, pages = {320--330}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/w17-5538}, doi = {10.18653/V1/W17-5538}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sigdial/JangMHR17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/starsem/JauharH17, author = {Sujay Kumar Jauhar and Eduard H. Hovy}, editor = {Nancy Ide and Aur{\'{e}}lie Herbelot and Llu{\'{\i}}s M{\`{a}}rquez}, title = {Embedded Semantic Lexicon Induction with Joint Global and Local Optimization}, booktitle = {Proceedings of the 6th Joint Conference on Lexical and Computational Semantics, *SEM @ACM 2017, Vancouver, Canada, August 3-4, 2017}, pages = {209--219}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://doi.org/10.18653/v1/S17-1025}, doi = {10.18653/V1/S17-1025}, timestamp = {Fri, 06 Aug 2021 00:40:02 +0200}, biburl = {https://dblp.org/rec/conf/starsem/JauharH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/acl/2017news, editor = {Tommaso Caselli and Ben Miller and Marieke van Erp and Piek Vossen and Martha Palmer and Eduard H. Hovy and Teruko Mitamura and David Caswell}, title = {Proceedings of the Events and Stories in the News Workshop@ACL 2017, Vancouver, Canada, August 4, 2017}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://aclanthology.org/volumes/W17-27/}, isbn = {978-1-945626-63-0}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/2017news.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/textgraphs/2017, editor = {Martin Riedl and Swapna Somasundaran and Goran Glavas and Eduard H. Hovy}, title = {Proceedings of TextGraphs@ACL 2017: the 11th Workshop on Graph-based Methods for Natural Language Processing, Vancouver, Canada, August 3, 2017}, publisher = {Association for Computational Linguistics}, year = {2017}, url = {https://aclanthology.org/volumes/W17-24/}, isbn = {978-1-945626-60-9}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/textgraphs/2017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/ChalupskyAHHLMS17, author = {Hans Chalupsky and Jun Araki and Eduard H. Hovy and Andrew Hsi and Zhengzhong Liu and Xuezhe Ma and Evangelia Spiliopoulou and Shuxin Yao}, title = {Multi-lingual Extraction and Integration of Entities, Relations, Events and Sentiments into ColdStart++ KBs with the {SAFT} System}, booktitle = {Proceedings of the 2017 Text Analysis Conference, {TAC} 2017, Gaithersburg, Maryland, USA, November 13-14, 2017}, publisher = {{NIST}}, year = {2017}, url = {https://tac.nist.gov/publications/2017/participant.papers/TAC2017.SAFT\_ISI.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 13:25:18 +0200}, biburl = {https://dblp.org/rec/conf/tac/ChalupskyAHHLMS17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/MaFLH17, author = {Xuezhe Ma and Nicolas R. Fauceglia and Yiu{-}Chang Lin and Eduard H. Hovy}, title = {{CMU} System for Entity Discovery and Linking at {TAC-KBP} 2017}, booktitle = {Proceedings of the 2017 Text Analysis Conference, {TAC} 2017, Gaithersburg, Maryland, USA, November 13-14, 2017}, publisher = {{NIST}}, year = {2017}, url = {https://tac.nist.gov/publications/2017/participant.papers/TAC2017.CMUCS\_EDL.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tac/MaFLH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/MitamuraLH17, author = {Teruko Mitamura and Zhengzhong Liu and Eduard H. Hovy}, title = {Events Detection, Coreference and Sequencing: What's next? Overview of the {TAC} {KBP} 2017 Event Track}, booktitle = {Proceedings of the 2017 Text Analysis Conference, {TAC} 2017, Gaithersburg, Maryland, USA, November 13-14, 2017}, publisher = {{NIST}}, year = {2017}, url = {https://tac.nist.gov/publications/2017/additional.papers/TAC2017.KBP\_Event\_Nugget\_overview.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tac/MitamuraLH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/MaH17, author = {Xuezhe Ma and Eduard H. Hovy}, title = {Neural Probabilistic Model for Non-projective {MST} Parsing}, journal = {CoRR}, volume = {abs/1701.00874}, year = {2017}, url = {http://arxiv.org/abs/1701.00874}, eprinttype = {arXiv}, eprint = {1701.00874}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/MaH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/DaiABHC17, author = {Zihang Dai and Amjad Almahairi and Philip Bachman and Eduard H. Hovy and Aaron C. Courville}, title = {Calibrating Energy-based Generative Adversarial Networks}, journal = {CoRR}, volume = {abs/1702.01691}, year = {2017}, url = {http://arxiv.org/abs/1702.01691}, eprinttype = {arXiv}, eprint = {1702.01691}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/DaiABHC17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/DasigiBHW17, author = {Pradeep Dasigi and Gully A. P. C. Burns and Eduard H. Hovy and Anita de Waard}, title = {Experiment Segmentation in Scientific Discourse as Clause-level Structured Prediction using Recurrent Neural Networks}, journal = {CoRR}, volume = {abs/1702.05398}, year = {2017}, url = {http://arxiv.org/abs/1702.05398}, eprinttype = {arXiv}, eprint = {1702.05398}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/DasigiBHW17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LaiXLYH17, author = {Guokun Lai and Qizhe Xie and Hanxiao Liu and Yiming Yang and Eduard H. Hovy}, title = {{RACE:} Large-scale ReAding Comprehension Dataset From Examinations}, journal = {CoRR}, volume = {abs/1704.04683}, year = {2017}, url = {http://arxiv.org/abs/1704.04683}, eprinttype = {arXiv}, eprint = {1704.04683}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/LaiXLYH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/XieMDH17, author = {Qizhe Xie and Xuezhe Ma and Zihang Dai and Eduard H. Hovy}, title = {An Interpretable Knowledge Transfer Model for Knowledge Base Completion}, journal = {CoRR}, volume = {abs/1704.05908}, year = {2017}, url = {http://arxiv.org/abs/1704.05908}, eprinttype = {arXiv}, eprint = {1704.05908}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/XieMDH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/DasigiADH17, author = {Pradeep Dasigi and Waleed Ammar and Chris Dyer and Eduard H. Hovy}, title = {Ontology-Aware Token Embeddings for Prepositional Phrase Attachment}, journal = {CoRR}, volume = {abs/1705.02925}, year = {2017}, url = {http://arxiv.org/abs/1705.02925}, eprinttype = {arXiv}, eprint = {1705.02925}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/DasigiADH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/MaYLNH17, author = {Xuezhe Ma and Pengcheng Yin and Jingzhou Liu and Graham Neubig and Eduard H. Hovy}, title = {Softmax Q-Distribution Estimation for Structured Prediction: {A} Theoretical Interpretation for {RAML}}, journal = {CoRR}, volume = {abs/1705.07136}, year = {2017}, url = {http://arxiv.org/abs/1705.07136}, eprinttype = {arXiv}, eprint = {1705.07136}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/MaYLNH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/XieDDHN17, author = {Qizhe Xie and Zihang Dai and Yulun Du and Eduard H. Hovy and Graham Neubig}, title = {Controllable Invariance through Adversarial Feature Learning}, journal = {CoRR}, volume = {abs/1705.11122}, year = {2017}, url = {http://arxiv.org/abs/1705.11122}, eprinttype = {arXiv}, eprint = {1705.11122}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/XieDDHN17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/JhamtaniGHN17, author = {Harsh Jhamtani and Varun Gangal and Eduard H. Hovy and Eric Nyberg}, title = {Shakespearizing Modern Language Using Copy-Enriched Sequence-to-Sequence Models}, journal = {CoRR}, volume = {abs/1707.01161}, year = {2017}, url = {http://arxiv.org/abs/1707.01161}, eprinttype = {arXiv}, eprint = {1707.01161}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/JhamtaniGHN17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/GangalJNHN17, author = {Varun Gangal and Harsh Jhamtani and Graham Neubig and Eduard H. Hovy and Eric Nyberg}, title = {CharManteau: Character Embedding Models For Portmanteau Creation}, journal = {CoRR}, volume = {abs/1707.01176}, year = {2017}, url = {http://arxiv.org/abs/1707.01176}, eprinttype = {arXiv}, eprint = {1707.01176}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/GangalJNHN17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/KangGLCH17, author = {Dongyeop Kang and Varun Gangal and Ang Lu and Zheng Chen and Eduard H. Hovy}, title = {Detecting and Explaining Causes From Text For a Time Series Event}, journal = {CoRR}, volume = {abs/1707.08852}, year = {2017}, url = {http://arxiv.org/abs/1707.08852}, eprinttype = {arXiv}, eprint = {1707.08852}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/KangGLCH17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1711-03225, author = {Qizhe Xie and Guokun Lai and Zihang Dai and Eduard H. Hovy}, title = {Large-scale Cloze Test Dataset Designed by Teachers}, journal = {CoRR}, volume = {abs/1711.03225}, year = {2017}, url = {http://arxiv.org/abs/1711.03225}, eprinttype = {arXiv}, eprint = {1711.03225}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1711-03225.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1711-08792, author = {Anant Subramanian and Danish Pruthi and Harsh Jhamtani and Taylor Berg{-}Kirkpatrick and Eduard H. Hovy}, title = {{SPINE:} SParse Interpretable Neural Embeddings}, journal = {CoRR}, volume = {abs/1711.08792}, year = {2017}, url = {http://arxiv.org/abs/1711.08792}, eprinttype = {arXiv}, eprint = {1711.08792}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1711-08792.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/biodb/BurnsDWH16, author = {Gully A. P. C. Burns and Pradeep Dasigi and Anita de Waard and Eduard H. Hovy}, title = {Automated detection of discourse segment and experimental types from the text of cancer pathway results sections}, journal = {Database J. Biol. Databases Curation}, volume = {2016}, year = {2016}, url = {https://doi.org/10.1093/database/baw122}, doi = {10.1093/DATABASE/BAW122}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/biodb/BurnsDWH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/HuMLHX16, author = {Zhiting Hu and Xuezhe Ma and Zhengzhong Liu and Eduard H. Hovy and Eric P. Xing}, title = {Harnessing Deep Neural Networks with Logic Rules}, booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume 1: Long Papers}, publisher = {The Association for Computer Linguistics}, year = {2016}, url = {https://doi.org/10.18653/v1/p16-1228}, doi = {10.18653/V1/P16-1228}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/HuMLHX16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/JauharTH16, author = {Sujay Kumar Jauhar and Peter D. Turney and Eduard H. Hovy}, title = {Tables as Semi-structured Knowledge for Question Answering}, booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume 1: Long Papers}, publisher = {The Association for Computer Linguistics}, year = {2016}, url = {https://doi.org/10.18653/v1/p16-1045}, doi = {10.18653/V1/P16-1045}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/JauharTH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/MaH16, author = {Xuezhe Ma and Eduard H. Hovy}, title = {End-to-end Sequence Labeling via Bi-directional LSTM-CNNs-CRF}, booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume 1: Long Papers}, publisher = {The Association for Computer Linguistics}, year = {2016}, url = {https://doi.org/10.18653/v1/p16-1101}, doi = {10.18653/V1/P16-1101}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/MaH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/WilsonSDLCLAZSR16, author = {Shomir Wilson and Florian Schaub and Aswarth Abhilash Dara and Frederick Liu and Sushain Cherivirala and Pedro Giovanni Leon and Mads Schaarup Andersen and Sebastian Zimmeck and Kanthashree Mysore Sathyendra and N. Cameron Russell and Thomas B. Norton and Eduard H. Hovy and Joel R. Reidenberg and Norman M. Sadeh}, title = {The Creation and Analysis of a Website Privacy Policy Corpus}, booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume 1: Long Papers}, publisher = {The Association for Computer Linguistics}, year = {2016}, url = {https://doi.org/10.18653/v1/p16-1126}, doi = {10.18653/V1/P16-1126}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/WilsonSDLCLAZSR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccis/DustdarHLG16, author = {Schahram Dustdar and Eduard H. Hovy and Xiangyang Li and Moncef Gabbouj}, title = {Keynote speech}, booktitle = {4th International Conference on Cloud Computing and Intelligence Systems, {CCIS} 2016, Beijing, China, August 17-19, 2016}, publisher = {{IEEE}}, year = {2016}, url = {https://doi.org/10.1109/CCIS.2016.7790315}, doi = {10.1109/CCIS.2016.7790315}, timestamp = {Wed, 16 Oct 2019 14:14:57 +0200}, biburl = {https://dblp.org/rec/conf/ccis/DustdarHLG16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icbo/BurnsWDH16, author = {Gully A. P. C. Burns and Anita de Waard and Pradeep Dasigi and Eduard H. Hovy}, editor = {Pankaj Jaiswal and Robert Hoehndorf and Cecilia N. Arighi and Austin Meier}, title = {Cycles of Scientific Investigation in Discourse - Machine Reading Methods for the Primary Research Contributions of a Paper}, booktitle = {Proceedings of the Joint International Conference on Biological Ontology and BioCreative, Corvallis, Oregon, United States, August 1-4, 2016}, series = {{CEUR} Workshop Proceedings}, volume = {1747}, publisher = {CEUR-WS.org}, year = {2016}, url = {https://ceur-ws.org/Vol-1747/BT102\_ICBO2016.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:23 +0100}, biburl = {https://dblp.org/rec/conf/icbo/BurnsWDH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icwsm/YangHKH16, author = {Diyi Yang and Aaron Halfaker and Robert E. Kraut and Eduard H. Hovy}, title = {Who Did What: Editor Role Identification in Wikipedia}, booktitle = {Proceedings of the Tenth International Conference on Web and Social Media, Cologne, Germany, May 17-20, 2016}, pages = {446--455}, publisher = {{AAAI} Press}, year = {2016}, url = {http://www.aaai.org/ocs/index.php/ICWSM/ICWSM16/paper/view/13077}, timestamp = {Fri, 05 Feb 2021 11:07:46 +0100}, biburl = {https://dblp.org/rec/conf/icwsm/YangHKH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/YangHKH16, author = {Diyi Yang and Aaron Halfaker and Robert E. Kraut and Eduard H. Hovy}, editor = {Nicoletta Calzolari and Khalid Choukri and Thierry Declerck and Sara Goggi and Marko Grobelnik and Bente Maegaard and Joseph Mariani and H{\'{e}}l{\`{e}}ne Mazo and Asunci{\'{o}}n Moreno and Jan Odijk and Stelios Piperidis}, title = {Edit Categories and Editor Role Identification in Wikipedia}, booktitle = {Proceedings of the Tenth International Conference on Language Resources and Evaluation {LREC} 2016, Portoro{\v{z}}, Slovenia, May 23-28, 2016}, publisher = {European Language Resources Association {(ELRA)}}, year = {2016}, url = {http://www.lrec-conf.org/proceedings/lrec2016/summaries/582.html}, timestamp = {Mon, 19 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lrec/YangHKH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mediaeval/SutcliffeCHLFR16, author = {Richard F. E. Sutcliffe and Tom Collins and Eduard H. Hovy and Richard Lewis and Chris Fox and Deane L. Root}, editor = {Guillaume Gravier and Claire{-}H{\'{e}}l{\`{e}}ne Demarty and Herv{\'{e}} Bredin and Bogdan Ionescu and Christina Boididou and Emmanuel Dellandr{\'{e}}a and Jaeyoung Choi and Michael Riegler and Richard F. E. Sutcliffe and Igor Sz{\"{o}}ke and Gareth J. F. Jones and Martha A. Larson}, title = {The C@merata task at MediaEval 2016: Natural Language Queries Derived from Exam Papers, Articles and Other Sources against Classical Music Scores in MusicXML}, booktitle = {Working Notes Proceedings of the MediaEval 2016 Workshop, Hilversum, The Netherlands, October 20-21, 2016}, series = {{CEUR} Workshop Proceedings}, volume = {1739}, publisher = {CEUR-WS.org}, year = {2016}, url = {https://ceur-ws.org/Vol-1739/MediaEval\_2016\_paper\_55.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:12 +0100}, biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeCHLFR16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/LiCHJ16, author = {Jiwei Li and Xinlei Chen and Eduard H. Hovy and Dan Jurafsky}, editor = {Kevin Knight and Ani Nenkova and Owen Rambow}, title = {Visualizing and Understanding Neural Models in {NLP}}, booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, San Diego California, USA, June 12-17, 2016}, pages = {681--691}, publisher = {The Association for Computational Linguistics}, year = {2016}, url = {https://doi.org/10.18653/v1/n16-1082}, doi = {10.18653/V1/N16-1082}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/naacl/LiCHJ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/MaLH16, author = {Xuezhe Ma and Zhengzhong Liu and Eduard H. Hovy}, editor = {Kevin Knight and Ani Nenkova and Owen Rambow}, title = {Unsupervised Ranking Model for Entity Coreference Resolution}, booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, San Diego California, USA, June 12-17, 2016}, pages = {1012--1018}, publisher = {The Association for Computational Linguistics}, year = {2016}, url = {https://doi.org/10.18653/v1/n16-1116}, doi = {10.18653/V1/N16-1116}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/MaLH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/YangYDHSH16, author = {Zichao Yang and Diyi Yang and Chris Dyer and Xiaodong He and Alexander J. Smola and Eduard H. Hovy}, editor = {Kevin Knight and Ani Nenkova and Owen Rambow}, title = {Hierarchical Attention Networks for Document Classification}, booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, San Diego California, USA, June 12-17, 2016}, pages = {1480--1489}, publisher = {The Association for Computational Linguistics}, year = {2016}, url = {https://doi.org/10.18653/v1/n16-1174}, doi = {10.18653/V1/N16-1174}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/YangYDHSH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/aclevents/2016, editor = {Martha Palmer and Eduard H. Hovy and Teruko Mitamura and Tim O'Gorman}, title = {Proceedings of the Fourth Workshop on Events, EVENTS@HLT-NAACL 2016, San Diego, California, USA, June 17, 2016}, publisher = {Association for Computational Linguistics}, year = {2016}, url = {https://aclanthology.org/volumes/W16-10/}, isbn = {978-1-941643-89-1}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aclevents/2016.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/LiuAMH16, author = {Zhengzhong Liu and Jun Araki and Teruko Mitamura and Eduard H. Hovy}, title = {{CMU-LTI} at {KBP} 2016 Event Nugget Track}, booktitle = {Proceedings of the 2016 Text Analysis Conference, {TAC} 2016, Gaithersburg, Maryland, USA, November 14-15, 2016}, publisher = {{NIST}}, year = {2016}, url = {https://tac.nist.gov/publications/2016/participant.papers/TAC2016.LTI\_CMU.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 13:25:24 +0200}, biburl = {https://dblp.org/rec/conf/tac/LiuAMH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/MaFLH16, author = {Xuezhe Ma and Nicolas R. Fauceglia and Yiu{-}Chang Lin and Eduard H. Hovy}, title = {{CMU} System for Entity Discovery and Linking at {TAC-KBP} 2016}, booktitle = {Proceedings of the 2016 Text Analysis Conference, {TAC} 2016, Gaithersburg, Maryland, USA, November 14-15, 2016}, publisher = {{NIST}}, year = {2016}, url = {https://tac.nist.gov/publications/2016/participant.papers/TAC2016.CMU\_CS\_EDL.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tac/MaFLH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/MitamuraLH16, author = {Teruko Mitamura and Zhengzhong Liu and Eduard H. Hovy}, title = {Overview of {TAC-KBP} 2016 Event Nugget Track}, booktitle = {Proceedings of the 2016 Text Analysis Conference, {TAC} 2016, Gaithersburg, Maryland, USA, November 14-15, 2016}, publisher = {{NIST}}, year = {2016}, url = {https://tac.nist.gov/publications/2016/additional.papers/TAC2016.KBP\_Event\_Nugget\_overview.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tac/MitamuraLH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/JauharTH16, author = {Sujay Kumar Jauhar and Peter D. Turney and Eduard H. Hovy}, title = {TabMCQ: {A} Dataset of General Knowledge Tables and Multiple-choice Questions}, journal = {CoRR}, volume = {abs/1602.03960}, year = {2016}, url = {http://arxiv.org/abs/1602.03960}, eprinttype = {arXiv}, eprint = {1602.03960}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/JauharTH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/MaH16, author = {Xuezhe Ma and Eduard H. Hovy}, title = {End-to-end Sequence Labeling via Bi-directional LSTM-CNNs-CRF}, journal = {CoRR}, volume = {abs/1603.01354}, year = {2016}, url = {http://arxiv.org/abs/1603.01354}, eprinttype = {arXiv}, eprint = {1603.01354}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/MaH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/MaLH16, author = {Xuezhe Ma and Zhengzhong Liu and Eduard H. Hovy}, title = {Unsupervised Ranking Model for Entity Coreference Resolution}, journal = {CoRR}, volume = {abs/1603.04553}, year = {2016}, url = {http://arxiv.org/abs/1603.04553}, eprinttype = {arXiv}, eprint = {1603.04553}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/MaLH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/HuMLHX16, author = {Zhiting Hu and Xuezhe Ma and Zhengzhong Liu and Eduard H. Hovy and Eric P. Xing}, title = {Harnessing Deep Neural Networks with Logic Rules}, journal = {CoRR}, volume = {abs/1603.06318}, year = {2016}, url = {http://arxiv.org/abs/1603.06318}, eprinttype = {arXiv}, eprint = {1603.06318}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/HuMLHX16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/MaGHYDH16, author = {Xuezhe Ma and Yingkai Gao and Zhiting Hu and Yaoliang Yu and Yuntian Deng and Eduard H. Hovy}, title = {Dropout with Expectation-linear Regularization}, journal = {CoRR}, volume = {abs/1609.08017}, year = {2016}, url = {http://arxiv.org/abs/1609.08017}, eprinttype = {arXiv}, eprint = {1609.08017}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/MaGHYDH16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/CirikHM16, author = {Volkan Cirik and Eduard H. Hovy and Louis{-}Philippe Morency}, title = {Visualizing and Understanding Curriculum Learning for Long Short-Term Memory Networks}, journal = {CoRR}, volume = {abs/1611.06204}, year = {2016}, url = {http://arxiv.org/abs/1611.06204}, eprinttype = {arXiv}, eprint = {1611.06204}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/CirikHM16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/WangHD15, author = {Haoyu Wang and Eduard H. Hovy and Mark Dredze}, editor = {Arash Shaban{-}Nejad and David L. Buckeridge and John S. Brownstein}, title = {The Hurricane Sandy Twitter Corpus}, booktitle = {World Wide Web and Public Health Intelligence, Papers from the 2015 {AAAI} Workshop, Austin, Texas, USA, January, 2015}, series = {{AAAI} Technical Report}, volume = {{WS-15-15}}, publisher = {{AAAI} Press}, year = {2015}, url = {http://aaai.org/ocs/index.php/WS/AAAIW15/paper/view/10079}, timestamp = {Tue, 05 Sep 2023 08:59:27 +0200}, biburl = {https://dblp.org/rec/conf/aaai/WangHD15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aclevents/FaucegliaLMH15, author = {Nicolas R. Fauceglia and Yiu{-}Chang Lin and Xuezhe Ma and Eduard H. Hovy}, editor = {Eduard H. Hovy and Teruko Mitamura and Martha Palmer}, title = {Word Sense Disambiguation via PropStore and OntoNotes for Event Mention Detection}, booktitle = {Proceedings of the The 3rd Workshop on {EVENTS:} Definition, Detection, Coreference, and Representation, EVENTS@HLP-NAACL 2015, Denver, Colorado, USA, June 4, 2015}, pages = {11--15}, publisher = {Association for Computational Linguistics}, year = {2015}, url = {https://doi.org/10.3115/v1/W15-0802}, doi = {10.3115/V1/W15-0802}, timestamp = {Fri, 06 Aug 2021 00:40:18 +0200}, biburl = {https://dblp.org/rec/conf/aclevents/FaucegliaLMH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aclevents/LiuMH15, author = {Zhengzhong Liu and Teruko Mitamura and Eduard H. Hovy}, editor = {Eduard H. Hovy and Teruko Mitamura and Martha Palmer}, title = {Evaluation Algorithms for Event Nugget Detection : {A} Pilot Study}, booktitle = {Proceedings of the The 3rd Workshop on {EVENTS:} Definition, Detection, Coreference, and Representation, EVENTS@HLP-NAACL 2015, Denver, Colorado, USA, June 4, 2015}, pages = {53--57}, publisher = {Association for Computational Linguistics}, year = {2015}, url = {https://doi.org/10.3115/v1/W15-0807}, doi = {10.3115/V1/W15-0807}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aclevents/LiuMH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/RodrigoPMHK15, author = {{\'{A}}lvaro Rodrigo and Anselmo Pe{\~{n}}as and Yusuke Miyao and Eduard H. Hovy and Noriko Kando}, editor = {Linda Cappellato and Nicola Ferro and Gareth J. F. Jones and Eric SanJuan}, title = {Overview of {CLEF} {QA} Entrance Exams Task 2015}, booktitle = {Working Notes of {CLEF} 2015 - Conference and Labs of the Evaluation forum, Toulouse, France, September 8-11, 2015}, series = {{CEUR} Workshop Proceedings}, volume = {1391}, publisher = {CEUR-WS.org}, year = {2015}, url = {https://ceur-ws.org/Vol-1391/171-CR.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:42 +0100}, biburl = {https://dblp.org/rec/conf/clef/RodrigoPMHK15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/MaH15, author = {Xuezhe Ma and Eduard H. Hovy}, editor = {Llu{\'{\i}}s M{\`{a}}rquez and Chris Callison{-}Burch and Jian Su and Daniele Pighin and Yuval Marton}, title = {Efficient Inner-to-outer Greedy Algorithm for Higher-order Labeled Dependency Parsing}, booktitle = {Proceedings of the 2015 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2015, Lisbon, Portugal, September 17-21, 2015}, pages = {1322--1328}, publisher = {The Association for Computational Linguistics}, year = {2015}, url = {https://doi.org/10.18653/v1/d15-1154}, doi = {10.18653/V1/D15-1154}, timestamp = {Thu, 14 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/MaH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiLJH15, author = {Jiwei Li and Thang Luong and Dan Jurafsky and Eduard H. Hovy}, editor = {Llu{\'{\i}}s M{\`{a}}rquez and Chris Callison{-}Burch and Jian Su and Daniele Pighin and Yuval Marton}, title = {When Are Tree Structures Necessary for Deep Learning of Representations?}, booktitle = {Proceedings of the 2015 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2015, Lisbon, Portugal, September 17-21, 2015}, pages = {2304--2314}, publisher = {The Association for Computational Linguistics}, year = {2015}, url = {https://doi.org/10.18653/v1/d15-1278}, doi = {10.18653/V1/D15-1278}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/LiLJH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/YangLDH15, author = {Diyi Yang and Alon Lavie and Chris Dyer and Eduard H. Hovy}, editor = {Llu{\'{\i}}s M{\`{a}}rquez and Chris Callison{-}Burch and Jian Su and Daniele Pighin and Yuval Marton}, title = {Humor Recognition and Humor Anchor Extraction}, booktitle = {Proceedings of the 2015 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2015, Lisbon, Portugal, September 17-21, 2015}, pages = {2367--2376}, publisher = {The Association for Computational Linguistics}, year = {2015}, url = {https://doi.org/10.18653/v1/d15-1284}, doi = {10.18653/V1/D15-1284}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/YangLDH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/SachanHX15, author = {Mrinmaya Sachan and Eduard H. Hovy and Eric P. Xing}, editor = {Qiang Yang and Michael J. Wooldridge}, title = {An Active Learning Approach to Coreference Resolution}, booktitle = {Proceedings of the Twenty-Fourth International Joint Conference on Artificial Intelligence, {IJCAI} 2015, Buenos Aires, Argentina, July 25-31, 2015}, pages = {1312--1318}, publisher = {{AAAI} Press}, year = {2015}, url = {http://ijcai.org/Abstract/15/189}, timestamp = {Tue, 20 Aug 2019 16:16:43 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/SachanHX15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ismir/SutcliffeCFRHL15, author = {Richard F. E. Sutcliffe and Tim Crawford and Chris Fox and Deane L. Root and Eduard H. Hovy and Richard Lewis}, editor = {Meinard M{\"{u}}ller and Frans Wiering}, title = {Relating Natural Language Text to Musical Passages}, booktitle = {Proceedings of the 16th International Society for Music Information Retrieval Conference, {ISMIR} 2015, M{\'{a}}laga, Spain, October 26-30, 2015}, pages = {524--530}, year = {2015}, url = {http://ismir2015.uma.es/articles/263\_Paper.pdf}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ismir/SutcliffeCFRHL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mediaeval/SutcliffeFRHL15, author = {Richard F. E. Sutcliffe and Chris Fox and Deane L. Root and Eduard H. Hovy and Richard Lewis}, editor = {Martha A. Larson and Bogdan Ionescu and Mats Sj{\"{o}}berg and Xavier Anguera and Johann Poignant and Michael Riegler and Maria Eskevich and Claudia Hauff and Richard F. E. Sutcliffe and Gareth J. F. Jones and Yi{-}Hsuan Yang and Mohammad Soleymani and Symeon Papadopoulos}, title = {The C@merata Task at MediaEval 2015: Natural Language Queries on Classical Music Scores}, booktitle = {Working Notes Proceedings of the MediaEval 2015 Workshop, Wurzen, Germany, September 14-15, 2015}, series = {{CEUR} Workshop Proceedings}, volume = {1436}, publisher = {CEUR-WS.org}, year = {2015}, url = {https://ceur-ws.org/Vol-1436/Paper12.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:12 +0100}, biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeFRHL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/JauharDH15, author = {Sujay Kumar Jauhar and Chris Dyer and Eduard H. Hovy}, editor = {Rada Mihalcea and Joyce Yue Chai and Anoop Sarkar}, title = {Ontologically Grounded Multi-sense Representation Learning for Semantic Vector Space Models}, booktitle = {{NAACL} {HLT} 2015, The 2015 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, Denver, Colorado, USA, May 31 - June 5, 2015}, pages = {683--693}, publisher = {The Association for Computational Linguistics}, year = {2015}, url = {https://doi.org/10.3115/v1/n15-1070}, doi = {10.3115/V1/N15-1070}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/JauharDH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/FaruquiDJDHS15, author = {Manaal Faruqui and Jesse Dodge and Sujay Kumar Jauhar and Chris Dyer and Eduard H. Hovy and Noah A. Smith}, editor = {Rada Mihalcea and Joyce Yue Chai and Anoop Sarkar}, title = {Retrofitting Word Vectors to Semantic Lexicons}, booktitle = {{NAACL} {HLT} 2015, The 2015 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies, Denver, Colorado, USA, May 31 - June 5, 2015}, pages = {1606--1615}, publisher = {The Association for Computational Linguistics}, year = {2015}, url = {https://doi.org/10.3115/v1/n15-1184}, doi = {10.3115/V1/N15-1184}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/FaruquiDJDHS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/aclevents/2015, editor = {Eduard H. Hovy and Teruko Mitamura and Martha Palmer}, title = {Proceedings of the The 3rd Workshop on {EVENTS:} Definition, Detection, Coreference, and Representation, EVENTS@HLP-NAACL 2015, Denver, Colorado, USA, June 4, 2015}, publisher = {Association for Computational Linguistics}, year = {2015}, url = {https://aclanthology.org/volumes/W15-08/}, isbn = {978-1-941643-37-2}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aclevents/2015.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/FaucegliaLMH15, author = {Nicolas R. Fauceglia and Yiu{-}Chang Lin and Xuezhe Ma and Eduard H. Hovy}, title = {{CMU} System for Entity Discovery and Linking at {TAC-KBP} 2015}, booktitle = {Proceedings of the 2015 Text Analysis Conference, {TAC} 2015, Gaithersburg, Maryland, USA, November 16-17, 2015, 2015}, publisher = {{NIST}}, year = {2015}, url = {https://tac.nist.gov/publications/2015/participant.papers/TAC2015.CMU\_Edvisees.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 13:25:17 +0200}, biburl = {https://dblp.org/rec/conf/tac/FaucegliaLMH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/LiuADMH15, author = {Zhengzhong Liu and Jun Araki and Dheeru Dua and Teruko Mitamura and Eduard H. Hovy}, title = {{CMU-LTI} at {KBP} 2015 Event Track}, booktitle = {Proceedings of the 2015 Text Analysis Conference, {TAC} 2015, Gaithersburg, Maryland, USA, November 16-17, 2015, 2015}, publisher = {{NIST}}, year = {2015}, url = {https://tac.nist.gov/publications/2015/participant.papers/TAC2015.LTI.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tac/LiuADMH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/MitamuraLH15, author = {Teruko Mitamura and Zhengzhong Liu and Eduard H. Hovy}, title = {Overview of {TAC} {KBP} 2015 Event Nugget Track}, booktitle = {Proceedings of the 2015 Text Analysis Conference, {TAC} 2015, Gaithersburg, Maryland, USA, November 16-17, 2015, 2015}, publisher = {{NIST}}, year = {2015}, url = {https://tac.nist.gov/publications/2015/additional.papers/TAC2015.KBP\_Event\_Nugget\_overview.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tac/MitamuraLH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiH15, author = {Jiwei Li and Eduard H. Hovy}, title = {The {NLP} Engine: {A} Universal Turing Machine for {NLP}}, journal = {CoRR}, volume = {abs/1503.00168}, year = {2015}, url = {http://arxiv.org/abs/1503.00168}, eprinttype = {arXiv}, eprint = {1503.00168}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/LiH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiJH15, author = {Jiwei Li and Dan Jurafsky and Eduard H. Hovy}, title = {When Are Tree Structures Necessary for Deep Learning of Representations?}, journal = {CoRR}, volume = {abs/1503.00185}, year = {2015}, url = {http://arxiv.org/abs/1503.00185}, eprinttype = {arXiv}, eprint = {1503.00185}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/LiJH15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiCHJ15, author = {Jiwei Li and Xinlei Chen and Eduard H. Hovy and Dan Jurafsky}, title = {Visualizing and Understanding Neural Models in {NLP}}, journal = {CoRR}, volume = {abs/1506.01066}, year = {2015}, url = {http://arxiv.org/abs/1506.01066}, eprinttype = {arXiv}, eprint = {1506.01066}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/LiCHJ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiH15b, author = {Jiwei Li and Eduard H. Hovy}, title = {Reflections on Sentiment/Opinion Analysis}, journal = {CoRR}, volume = {abs/1507.01636}, year = {2015}, url = {http://arxiv.org/abs/1507.01636}, eprinttype = {arXiv}, eprint = {1507.01636}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/LiH15b.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dagstuhl-reports/GurevychHSS15, author = {Iryna Gurevych and Eduard H. Hovy and Noam Slonim and Benno Stein}, title = {Debating Technologies (Dagstuhl Seminar 15512)}, journal = {Dagstuhl Reports}, volume = {5}, number = {12}, pages = {18--46}, year = {2015}, url = {https://doi.org/10.4230/DagRep.5.12.18}, doi = {10.4230/DAGREP.5.12.18}, timestamp = {Wed, 30 Oct 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/dagstuhl-reports/GurevychHSS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/LuoPRH14, author = {Xiaoqiang Luo and Sameer Pradhan and Marta Recasens and Eduard H. Hovy}, title = {An Extension of {BLANC} to System Mentions}, booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume 2: Short Papers}, pages = {24--29}, publisher = {The Association for Computer Linguistics}, year = {2014}, url = {https://doi.org/10.3115/v1/p14-2005}, doi = {10.3115/V1/P14-2005}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/LuoPRH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/PradhanLRHNS14, author = {Sameer Pradhan and Xiaoqiang Luo and Marta Recasens and Eduard H. Hovy and Vincent Ng and Michael Strube}, title = {Scoring Coreference Partitions of Predicted Mentions: {A} Reference Implementation}, booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume 2: Short Papers}, pages = {30--35}, publisher = {The Association for Computer Linguistics}, year = {2014}, url = {https://doi.org/10.3115/v1/p14-2006}, doi = {10.3115/V1/P14-2006}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/PradhanLRHNS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/LiRH14, author = {Jiwei Li and Alan Ritter and Eduard H. Hovy}, title = {Weakly Supervised User Profile Extraction from Twitter}, booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume 1: Long Papers}, pages = {165--174}, publisher = {The Association for Computer Linguistics}, year = {2014}, url = {https://doi.org/10.3115/v1/p14-1016}, doi = {10.3115/V1/P14-1016}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/LiRH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/SrivastavaH14, author = {Shashank Srivastava and Eduard H. Hovy}, title = {Vector space semantics with frequency-driven motifs}, booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume 1: Long Papers}, pages = {634--643}, publisher = {The Association for Computer Linguistics}, year = {2014}, url = {https://doi.org/10.3115/v1/p14-1060}, doi = {10.3115/V1/P14-1060}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/SrivastavaH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/LiOCH14, author = {Jiwei Li and Myle Ott and Claire Cardie and Eduard H. Hovy}, title = {Towards a General Rule for Identifying Deceptive Opinion Spam}, booktitle = {Proceedings of the 52nd Annual Meeting of the Association for Computational Linguistics, {ACL} 2014, June 22-27, 2014, Baltimore, MD, USA, Volume 1: Long Papers}, pages = {1566--1576}, publisher = {The Association for Computer Linguistics}, year = {2014}, url = {https://doi.org/10.3115/v1/p14-1147}, doi = {10.3115/V1/P14-1147}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acl/LiOCH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aclevents/ArakiHM14, author = {Jun Araki and Eduard H. Hovy and Teruko Mitamura}, editor = {Teruko Mitamura and Eduard H. Hovy and Martha Palmer}, title = {Evaluation for Partial Event Coreference}, booktitle = {Proceedings of the Second Workshop on {EVENTS:} Definition, Detection, Coreference, and Representation, EVENTS@ACL 2014, Baltimore, Maryland, USA, June 2014}, pages = {68--76}, publisher = {Association for Computational Linguistics}, year = {2014}, url = {https://doi.org/10.3115/v1/W14-2910}, doi = {10.3115/V1/W14-2910}, timestamp = {Fri, 06 Aug 2021 00:40:18 +0200}, biburl = {https://dblp.org/rec/conf/aclevents/ArakiHM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cikm/LiWH14, author = {Jiwei Li and Xun Wang and Eduard H. Hovy}, editor = {Jianzhong Li and Xiaoyang Sean Wang and Minos N. Garofalakis and Ian Soboroff and Torsten Suel and Min Wang}, title = {What a Nasty Day: Exploring Mood-Weather Relationship from Twitter}, booktitle = {Proceedings of the 23rd {ACM} International Conference on Conference on Information and Knowledge Management, {CIKM} 2014, Shanghai, China, November 3-7, 2014}, pages = {1309--1318}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2661829.2662090}, doi = {10.1145/2661829.2662090}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cikm/LiWH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/PenasMRHK14, author = {Anselmo Pe{\~{n}}as and Yusuke Miyao and {\'{A}}lvaro Rodrigo and Eduard H. Hovy and Noriko Kando}, editor = {Linda Cappellato and Nicola Ferro and Martin Halvey and Wessel Kraaij}, title = {Overview of {CLEF} {QA} Entrance Exams Task 2014}, booktitle = {Working Notes for {CLEF} 2014 Conference, Sheffield, UK, September 15-18, 2014}, series = {{CEUR} Workshop Proceedings}, volume = {1180}, pages = {1194--1200}, publisher = {CEUR-WS.org}, year = {2014}, url = {https://ceur-ws.org/Vol-1180/CLEF2014wn-QA-PenasEt2014.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:41 +0100}, biburl = {https://dblp.org/rec/conf/clef/PenasMRHK14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/JauharH14, author = {Sujay Kumar Jauhar and Eduard H. Hovy}, editor = {Jan Hajic and Junichi Tsujii}, title = {Inducing Latent Semantic Relations for Structured Distributional Semantics}, booktitle = {{COLING} 2014, 25th International Conference on Computational Linguistics, Proceedings of the Conference: Technical Papers, August 23-29, 2014, Dublin, Ireland}, pages = {698--708}, publisher = {{ACL}}, year = {2014}, url = {https://aclanthology.org/C14-1066/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/JauharH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/GoyalH14, author = {Kartik Goyal and Eduard H. Hovy}, editor = {Jan Hajic and Junichi Tsujii}, title = {Unsupervised Word Sense Induction using Distributional Statistics}, booktitle = {{COLING} 2014, 25th International Conference on Computational Linguistics, Proceedings of the Conference: Technical Papers, August 23-29, 2014, Dublin, Ireland}, pages = {1302--1310}, publisher = {{ACL}}, year = {2014}, url = {https://aclanthology.org/C14-1123/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/GoyalH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/DasigiH14, author = {Pradeep Dasigi and Eduard H. Hovy}, editor = {Jan Hajic and Junichi Tsujii}, title = {Modeling Newswire Events using Neural Networks for Anomaly Detection}, booktitle = {{COLING} 2014, 25th International Conference on Computational Linguistics, Proceedings of the Conference: Technical Papers, August 23-29, 2014, Dublin, Ireland}, pages = {1414--1422}, publisher = {{ACL}}, year = {2014}, url = {https://aclanthology.org/C14-1134/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/DasigiH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/KlaperH14, author = {David Klaper and Eduard H. Hovy}, editor = {Gabriel Puron Cid and Scott P. Robertson and Jing Zhang and J. Ram{\'{o}}n Gil{-}Garc{\'{\i}}a}, title = {A taxonomy and a knowledge portal for cybersecurity}, booktitle = {15th Annual International Conference on Digital Government Research, dg.o '14, Aguascalientes, Mexico, June 18-21, 2014}, pages = {79--85}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2612733.2612759}, doi = {10.1145/2612733.2612759}, timestamp = {Fri, 08 Sep 2023 15:13:05 +0200}, biburl = {https://dblp.org/rec/conf/dgo/KlaperH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/SilvaPSBH14, author = {Daniel Ribeiro Silva and Andrew Philpot and Abhishek Sundararajan and Nicole Marie Bryan and Eduard H. Hovy}, editor = {Gabriel Puron Cid and Scott P. Robertson and Jing Zhang and J. Ram{\'{o}}n Gil{-}Garc{\'{\i}}a}, title = {Data integration from open internet sources and network detection to combat underage sex trafficking}, booktitle = {15th Annual International Conference on Digital Government Research, dg.o '14, Aguascalientes, Mexico, June 18-21, 2014}, pages = {86--90}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2612733.2612746}, doi = {10.1145/2612733.2612746}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/SilvaPSBH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiH14, author = {Jiwei Li and Eduard H. Hovy}, editor = {Alessandro Moschitti and Bo Pang and Walter Daelemans}, title = {Sentiment Analysis on the People's Daily}, booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {467--476}, publisher = {{ACL}}, year = {2014}, url = {https://doi.org/10.3115/v1/d14-1053}, doi = {10.3115/V1/D14-1053}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/LiH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiRCH14, author = {Jiwei Li and Alan Ritter and Claire Cardie and Eduard H. Hovy}, editor = {Alessandro Moschitti and Bo Pang and Walter Daelemans}, title = {Major Life Event Extraction from Twitter based on Congratulations/Condolences Speech Acts}, booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {1997--2007}, publisher = {{ACL}}, year = {2014}, url = {https://doi.org/10.3115/v1/d14-1214}, doi = {10.3115/V1/D14-1214}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/LiRCH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiH14a, author = {Jiwei Li and Eduard H. Hovy}, editor = {Alessandro Moschitti and Bo Pang and Walter Daelemans}, title = {A Model of Coherence Based on Distributed Sentence Representation}, booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {2039--2048}, publisher = {{ACL}}, year = {2014}, url = {https://doi.org/10.3115/v1/d14-1218}, doi = {10.3115/V1/D14-1218}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/LiH14a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/LiLH14, author = {Jiwei Li and Rumeng Li and Eduard H. Hovy}, editor = {Alessandro Moschitti and Bo Pang and Walter Daelemans}, title = {Recursive Deep Models for Discourse Parsing}, booktitle = {Proceedings of the 2014 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2014, October 25-29, 2014, Doha, Qatar, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {2061--2069}, publisher = {{ACL}}, year = {2014}, url = {https://doi.org/10.3115/v1/d14-1220}, doi = {10.3115/V1/D14-1220}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/LiLH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/JainBRH14, author = {Siddharth Jain and Archna Bhatia and Angelique Rein and Eduard H. Hovy}, editor = {Nicoletta Calzolari and Khalid Choukri and Thierry Declerck and Hrafn Loftsson and Bente Maegaard and Joseph Mariani and Asunci{\'{o}}n Moreno and Jan Odijk and Stelios Piperidis}, title = {A Corpus of Participant Roles in Contentious Discussions}, booktitle = {Proceedings of the Ninth International Conference on Language Resources and Evaluation, {LREC} 2014, Reykjavik, Iceland, May 26-31, 2014}, pages = {1751--1756}, publisher = {European Language Resources Association {(ELRA)}}, year = {2014}, url = {http://www.lrec-conf.org/proceedings/lrec2014/summaries/1019.html}, timestamp = {Mon, 19 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lrec/JainBRH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/LiuAHM14, author = {Zhengzhong Liu and Jun Araki and Eduard H. Hovy and Teruko Mitamura}, editor = {Nicoletta Calzolari and Khalid Choukri and Thierry Declerck and Hrafn Loftsson and Bente Maegaard and Joseph Mariani and Asunci{\'{o}}n Moreno and Jan Odijk and Stelios Piperidis}, title = {Supervised Within-Document Event Coreference using Information Propagation}, booktitle = {Proceedings of the Ninth International Conference on Language Resources and Evaluation, {LREC} 2014, Reykjavik, Iceland, May 26-31, 2014}, pages = {4539--4544}, publisher = {European Language Resources Association {(ELRA)}}, year = {2014}, url = {http://www.lrec-conf.org/proceedings/lrec2014/summaries/646.html}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lrec/LiuAHM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/ArakiLHM14, author = {Jun Araki and Zhengzhong Liu and Eduard H. Hovy and Teruko Mitamura}, editor = {Nicoletta Calzolari and Khalid Choukri and Thierry Declerck and Hrafn Loftsson and Bente Maegaard and Joseph Mariani and Asunci{\'{o}}n Moreno and Jan Odijk and Stelios Piperidis}, title = {Detecting Subevent Structure for Event Coreference Resolution}, booktitle = {Proceedings of the Ninth International Conference on Language Resources and Evaluation, {LREC} 2014, Reykjavik, Iceland, May 26-31, 2014}, pages = {4553--4558}, publisher = {European Language Resources Association {(ELRA)}}, year = {2014}, url = {http://www.lrec-conf.org/proceedings/lrec2014/summaries/963.html}, timestamp = {Tue, 20 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lrec/ArakiLHM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mediaeval/SutcliffeCFRH14, author = {Richard F. E. Sutcliffe and Tim Crawford and Chris Fox and Deane L. Root and Eduard H. Hovy}, editor = {Martha A. Larson and Bogdan Ionescu and Xavier Anguera and Maria Eskevich and Pavel Korshunov and Markus Schedl and Mohammad Soleymani and Georgios Petkos and Richard F. E. Sutcliffe and Jaeyoung Choi and Gareth J. F. Jones}, title = {The C@merata Task at MediaEval 2014: Natural Language Queries on Classical Music Scores}, booktitle = {Working Notes Proceedings of the MediaEval 2014 Workshop, Barcelona, Catalunya, Spain, October 16-17, 2014}, series = {{CEUR} Workshop Proceedings}, volume = {1263}, publisher = {CEUR-WS.org}, year = {2014}, url = {https://ceur-ws.org/Vol-1263/mediaeval2014\_submission\_46.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:12 +0100}, biburl = {https://dblp.org/rec/conf/mediaeval/SutcliffeCFRH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/Hovy14, author = {Eduard H. Hovy}, editor = {Julio Gonzalo and Hang Li and Alessandro Moschitti and Jun Xu}, title = {Distributional Semantics for {IR}}, booktitle = {Proceedings of Workshop on Semantic Matching in Information Retrieval co-located with the 37th international {ACM} {SIGIR} conference on research and development in information retrieval, SMIR@SIGIR 2014, Queensland, Australia, July 11, 2014}, series = {{CEUR} Workshop Proceedings}, volume = {1204}, pages = {2--3}, publisher = {CEUR-WS.org}, year = {2014}, url = {https://ceur-ws.org/Vol-1204/papers/invited\_paper\_5.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:16 +0100}, biburl = {https://dblp.org/rec/conf/sigir/Hovy14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/specom/Echizen-yaAUH14, author = {Hiroshi Echizen{-}ya and Kenji Araki and Yuzu Uchida and Eduard H. Hovy}, editor = {Andrey Ronzhin and Rodmonga Potapova and Vlado Delic}, title = {Automatic Post-Editing Method Using Translation Knowledge Based on Intuitive Common Parts Continuum for Statistical Machine Translation}, booktitle = {Speech and Computer - 16th International Conference, {SPECOM} 2014, Novi Sad, Serbia, October 5-9, 2014. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8773}, pages = {129--136}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-11581-8\_16}, doi = {10.1007/978-3-319-11581-8\_16}, timestamp = {Tue, 29 Dec 2020 18:27:39 +0100}, biburl = {https://dblp.org/rec/conf/specom/Echizen-yaAUH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wmt/Echizen-yaAH14, author = {Hiroshi Echizen{-}ya and Kenji Araki and Eduard H. Hovy}, title = {Application of Prize based on Sentence Length in Chunk-based Automatic Evaluation of Machine Translation}, booktitle = {Proceedings of the Ninth Workshop on Statistical Machine Translation, WMT@ACL 2014, June 26-27, 2014, Baltimore, Maryland, {USA}}, pages = {381--386}, publisher = {The Association for Computer Linguistics}, year = {2014}, url = {https://doi.org/10.3115/v1/w14-3349}, doi = {10.3115/V1/W14-3349}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wmt/Echizen-yaAH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsdm/SachanDSXH14, author = {Mrinmaya Sachan and Avinava Dubey and Shashank Srivastava and Eric P. Xing and Eduard H. Hovy}, editor = {Ben Carterette and Fernando Diaz and Carlos Castillo and Donald Metzler}, title = {Spatial compactness meets topical consistency: jointly modeling links and content for community detection}, booktitle = {Seventh {ACM} International Conference on Web Search and Data Mining, {WSDM} 2014, New York, NY, USA, February 24-28, 2014}, pages = {503--512}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2556195.2556219}, doi = {10.1145/2556195.2556219}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wsdm/SachanDSXH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/aclevents/2014, editor = {Teruko Mitamura and Eduard H. Hovy and Martha Palmer}, title = {Proceedings of the Second Workshop on {EVENTS:} Definition, Detection, Coreference, and Representation, EVENTS@ACL 2014, Baltimore, Maryland, USA, June 2014}, publisher = {Association for Computational Linguistics}, year = {2014}, url = {https://aclanthology.org/volumes/W14-29/}, isbn = {978-1-941643-14-3}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aclevents/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiWH14, author = {Jiwei Li and Xun Wang and Eduard H. Hovy}, title = {What a Nasty day: Exploring Mood-Weather Relationship from Twitter}, journal = {CoRR}, volume = {abs/1410.8749}, year = {2014}, url = {http://arxiv.org/abs/1410.8749}, eprinttype = {arXiv}, eprint = {1410.8749}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/LiWH14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/FaruquiDJDHS14, author = {Manaal Faruqui and Jesse Dodge and Sujay Kumar Jauhar and Chris Dyer and Eduard H. Hovy and Noah A. Smith}, title = {Retrofitting Word Vectors to Semantic Lexicons}, journal = {CoRR}, volume = {abs/1411.4166}, year = {2014}, url = {http://arxiv.org/abs/1411.4166}, eprinttype = {arXiv}, eprint = {1411.4166}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/FaruquiDJDHS14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ai/HovyNP13, author = {Eduard H. Hovy and Roberto Navigli and Simone Paolo Ponzetto}, title = {Editorial}, journal = {Artif. Intell.}, volume = {194}, pages = {1}, year = {2013}, url = {https://doi.org/10.1016/j.artint.2012.11.001}, doi = {10.1016/J.ARTINT.2012.11.001}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ai/HovyNP13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ai/HovyNP13a, author = {Eduard H. Hovy and Roberto Navigli and Simone Paolo Ponzetto}, title = {Collaboratively built semi-structured content and Artificial Intelligence: The story so far}, journal = {Artif. Intell.}, volume = {194}, pages = {2--27}, year = {2013}, url = {https://doi.org/10.1016/j.artint.2012.10.002}, doi = {10.1016/J.ARTINT.2012.10.002}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ai/HovyNP13a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/coling/BhagatH13, author = {Rahul Bhagat and Eduard H. Hovy}, title = {What Is a Paraphrase?}, journal = {Comput. Linguistics}, volume = {39}, number = {3}, pages = {463--472}, year = {2013}, url = {https://doi.org/10.1162/COLI\_a\_00166}, doi = {10.1162/COLI\_A\_00166}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/coling/BhagatH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/lre/KozarevaH13, author = {Zornitsa Kozareva and Eduard H. Hovy}, title = {Tailoring the automated construction of large-scale taxonomies using the web}, journal = {Lang. Resour. Evaluation}, volume = {47}, number = {3}, pages = {859--890}, year = {2013}, url = {https://doi.org/10.1007/s10579-013-9229-0}, doi = {10.1007/S10579-013-9229-0}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/lre/KozarevaH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaiss/HovyMMU13, author = {Eduard H. Hovy and Vita Markman and Craig Martell and David C. Uthus}, title = {Preface}, booktitle = {Analyzing Microtext, Papers from the 2013 {AAAI} Spring Symposium, Palo Alto, California, USA, March 25-27, 2013}, series = {{AAAI} Technical Report}, volume = {{SS-13-01}}, publisher = {{AAAI}}, year = {2013}, url = {http://www.aaai.org/ocs/index.php/SSS/SSS13/paper/view/5961}, timestamp = {Mon, 09 Sep 2013 15:08:42 +0200}, biburl = {https://dblp.org/rec/conf/aaaiss/HovyMMU13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/GoyalJLSSH13a, author = {Kartik Goyal and Sujay Kumar Jauhar and Huiying Li and Mrinmaya Sachan and Shashank Srivastava and Eduard H. Hovy}, editor = {Alexandre Allauzen and Hugo Larochelle and Christopher D. Manning and Richard Socher}, title = {A Structured Distributional Semantic Model : Integrating Structure with Semantics}, booktitle = {Proceedings of the Workshop on Continuous Vector Space Models and their Compositionality, CVSM@ACL 2013, Sofia, Bulgaria, August 9, 2013}, pages = {20--29}, publisher = {Association for Computational Linguistics}, year = {2013}, url = {https://aclanthology.org/W13-3203/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/GoyalJLSSH13a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/TratzH13, author = {Stephen Tratz and Eduard H. Hovy}, title = {Automatic Interpretation of the English Possessive}, booktitle = {Proceedings of the 51st Annual Meeting of the Association for Computational Linguistics, {ACL} 2013, 4-9 August 2013, Sofia, Bulgaria, Volume 1: Long Papers}, pages = {372--381}, publisher = {The Association for Computer Linguistics}, year = {2013}, url = {https://aclanthology.org/P13-1037/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/TratzH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/GoyalJLSSH13, author = {Kartik Goyal and Sujay Kumar Jauhar and Huiying Li and Mrinmaya Sachan and Shashank Srivastava and Eduard H. Hovy}, title = {A Structured Distributional Semantic Model for Event Co-reference}, booktitle = {Proceedings of the 51st Annual Meeting of the Association for Computational Linguistics, {ACL} 2013, 4-9 August 2013, Sofia, Bulgaria, Volume 2: Short Papers}, pages = {467--473}, publisher = {The Association for Computer Linguistics}, year = {2013}, url = {https://aclanthology.org/P13-2083/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/GoyalJLSSH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aldt/ChalupskyDHKMMORWX13, author = {Hans Chalupsky and Robert DeMarco and Eduard H. Hovy and Paul B. Kantor and Alisa Matlin and Priyam Mitra and Birnur Ozbas and Fred S. Roberts and James Wojtowicz and Minge Xie}, editor = {Patrice Perny and Marc Pirlot and Alexis Tsouki{\`{a}}s}, title = {Estimating Violation Risk for Fisheries Regulations}, booktitle = {Algorithmic Decision Theory - Third International Conference, {ADT} 2013, Bruxelles, Belgium, November 12-14, 2013, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8176}, pages = {297--308}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-41575-3\_23}, doi = {10.1007/978-3-642-41575-3\_23}, timestamp = {Mon, 03 Jan 2022 22:21:02 +0100}, biburl = {https://dblp.org/rec/conf/aldt/ChalupskyDHKMMORWX13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/PenasHFRSM13, author = {Anselmo Pe{\~{n}}as and Eduard H. Hovy and Pamela Forner and {\'{A}}lvaro Rodrigo and Richard F. E. Sutcliffe and Roser Morante}, editor = {Pamela Forner and Henning M{\"{u}}ller and Roberto Paredes and Paolo Rosso and Benno Stein}, title = {{QA4MRE} 2011-2013: Overview of Question Answering for Machine Reading Evaluation}, booktitle = {Information Access Evaluation. Multilinguality, Multimodality, and Visualization - 4th International Conference of the {CLEF} Initiative, {CLEF} 2013, Valencia, Spain, September 23-26, 2013. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {8138}, pages = {303--320}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-40802-1\_29}, doi = {10.1007/978-3-642-40802-1\_29}, timestamp = {Wed, 30 Oct 2019 15:47:55 +0100}, biburl = {https://dblp.org/rec/conf/clef/PenasHFRSM13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/PenasMHFK13, author = {Anselmo Pe{\~{n}}as and Yusuke Miyao and Eduard H. Hovy and Pamela Forner and Noriko Kando}, editor = {Pamela Forner and Roberto Navigli and Dan Tufis and Nicola Ferro}, title = {Overview of {QA4MRE} 2013 Entrance Exams Task}, booktitle = {Working Notes for {CLEF} 2013 Conference , Valencia, Spain, September 23-26, 2013}, series = {{CEUR} Workshop Proceedings}, volume = {1179}, publisher = {CEUR-WS.org}, year = {2013}, url = {https://ceur-ws.org/Vol-1179/CLEF2013wn-QA4MRE-PenasEt2013.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:37 +0100}, biburl = {https://dblp.org/rec/conf/clef/PenasMHFK13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/SutcliffePHFRFBO13, author = {Richard F. E. Sutcliffe and Anselmo Pe{\~{n}}as and Eduard H. Hovy and Pamela Forner and {\'{A}}lvaro Rodrigo and Corina Forascu and Yassine Benajiba and Petya Osenova}, editor = {Pamela Forner and Roberto Navigli and Dan Tufis and Nicola Ferro}, title = {Overview of {QA4MRE} Main Task at {CLEF} 2013}, booktitle = {Working Notes for {CLEF} 2013 Conference , Valencia, Spain, September 23-26, 2013}, series = {{CEUR} Workshop Proceedings}, volume = {1179}, publisher = {CEUR-WS.org}, year = {2013}, url = {https://ceur-ws.org/Vol-1179/CLEF2013wn-QA4MRE-SutcliffeEt2013.pdf}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/clef/SutcliffePHFRFBO13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/SrivastavaHH13, author = {Shashank Srivastava and Dirk Hovy and Eduard H. Hovy}, title = {A Walk-Based Semantically Enriched Tree Kernel Over Distributed Word Representations}, booktitle = {Proceedings of the 2013 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2013, 18-21 October 2013, Grand Hyatt Seattle, Seattle, Washington, USA, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {1411--1416}, publisher = {{ACL}}, year = {2013}, url = {https://aclanthology.org/D13-1144/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/SrivastavaHH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icmcs/JainH13, author = {Siddharth Jain and Eduard H. Hovy}, title = {Determining leadership in contentious discussions}, booktitle = {2013 {IEEE} International Conference on Multimedia and Expo Workshops, San Jose, CA, USA, July 15-19, 2013}, pages = {1--6}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/ICMEW.2013.6618370}, doi = {10.1109/ICMEW.2013.6618370}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icmcs/JainH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/interspeech/HovyAPVLHB13, author = {Dirk Hovy and Gopala Krishna Anumanchipalli and Alok Parlikar and Caroline Vaughn and Adam C. Lammert and Eduard H. Hovy and Alan W. Black}, editor = {Fr{\'{e}}d{\'{e}}ric Bimbot and Christophe Cerisara and C{\'{e}}cile Fougeron and Guillaume Gravier and Lori Lamel and Fran{\c{c}}ois Pellegrino and Pascal Perrier}, title = {Analysis and modeling of "focus" in context}, booktitle = {{INTERSPEECH} 2013, 14th Annual Conference of the International Speech Communication Association, Lyon, France, August 25-29, 2013}, pages = {402--406}, publisher = {{ISCA}}, year = {2013}, url = {https://doi.org/10.21437/Interspeech.2013-109}, doi = {10.21437/INTERSPEECH.2013-109}, timestamp = {Fri, 23 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/interspeech/HovyAPVLHB13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/HovyMVAP13, author = {Eduard H. Hovy and Teruko Mitamura and Felisa Verdejo and Jun Araki and Andrew Philpot}, editor = {Eduard H. Hovy and Teruko Mitamura and Martha Palmer}, title = {Events are Not Simple: Identity, Non-Identity, and Quasi-Identity}, booktitle = {Workshop on Events: Definition, Detection, Coreference, and Representation, EVENTS@NAACL-HLT 2013, Atlanta, Georgia, USA, June 14, 2013}, pages = {21--28}, publisher = {Association for Computational Linguistics}, year = {2013}, url = {https://aclanthology.org/W13-1203/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/HovyMVAP13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/HovyBVH13, author = {Dirk Hovy and Taylor Berg{-}Kirkpatrick and Ashish Vaswani and Eduard H. Hovy}, editor = {Lucy Vanderwende and Hal Daum{\'{e}} III and Katrin Kirchhoff}, title = {Learning Whom to Trust with {MACE}}, booktitle = {Human Language Technologies: Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 9-14, 2013, Westin Peachtree Plaza Hotel, Atlanta, Georgia, {USA}}, pages = {1120--1130}, publisher = {The Association for Computational Linguistics}, year = {2013}, url = {https://aclanthology.org/N13-1132/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/HovyBVH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ranlp/Echizen-yaAH13, author = {Hiroshi Echizen{-}ya and Kenji Araki and Eduard H. Hovy}, editor = {Galia Angelova and Kalina Bontcheva and Ruslan Mitkov}, title = {Automatic Evaluation Metric for Machine Translation that is Independent of Sentence Length}, booktitle = {Recent Advances in Natural Language Processing, {RANLP} 2013, 9-11 September, 2013, Hissar, Bulgaria}, pages = {230--236}, publisher = {{RANLP} 2013 Organising Committee / {ACL}}, year = {2013}, url = {https://aclanthology.org/R13-1030/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ranlp/Echizen-yaAH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/www/SaqchanHH13, author = {Mrinmaya Sachan and Dirk Hovy and Eduard H. Hovy}, editor = {Leslie Carr and Alberto H. F. Laender and Bernadette Farias L{\'{o}}scio and Irwin King and Marcus Fontoura and Denny Vrandecic and Lora Aroyo and Jos{\'{e}} Palazzo M. de Oliveira and Fernanda Lima and Erik Wilde}, title = {Solving electrical networks to incorporate supervision in random walks}, booktitle = {22nd International World Wide Web Conference, {WWW} '13, Rio de Janeiro, Brazil, May 13-17, 2013, Companion Volume}, pages = {109--110}, publisher = {International World Wide Web Conferences Steering Committee / {ACM}}, year = {2013}, url = {https://doi.org/10.1145/2487788.2487838}, doi = {10.1145/2487788.2487838}, timestamp = {Mon, 03 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/www/SaqchanHH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/tanlp/OltramariVQH13, author = {Alessandro Oltramari and Piek Vossen and Lu Qin and Eduard H. Hovy}, editor = {Alessandro Oltramari and Piek Vossen and Lu Qin and Eduard H. Hovy}, title = {Introduction}, booktitle = {New Trends of Research in Ontologies and Lexical Resources, Ideas, Projects, Systems}, series = {Theory and Applications of Natural Language Processing}, pages = {1--3}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-31782-8\_1}, doi = {10.1007/978-3-642-31782-8\_1}, timestamp = {Wed, 05 Jan 2022 14:22:10 +0100}, biburl = {https://dblp.org/rec/series/tanlp/OltramariVQH13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/naacl/2013events, editor = {Eduard H. Hovy and Teruko Mitamura and Martha Palmer}, title = {Workshop on Events: Definition, Detection, Coreference, and Representation, EVENTS@NAACL-HLT 2013, Atlanta, Georgia, USA, June 14, 2013}, publisher = {Association for Computational Linguistics}, year = {2013}, url = {https://aclanthology.org/volumes/W13-12/}, isbn = {978-1-937284-47-3}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/2013events.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:series/tanlp/OVQH2013, editor = {Alessandro Oltramari and Piek Vossen and Lu Qin and Eduard H. Hovy}, title = {New Trends of Research in Ontologies and Lexical Resources, Ideas, Projects, Systems}, series = {Theory and Applications of Natural Language Processing}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-31782-8}, doi = {10.1007/978-3-642-31782-8}, isbn = {978-3-642-31781-1}, timestamp = {Wed, 05 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/series/tanlp/OVQH2013.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/scfbm/RamakrishnanPHB12, author = {Cartic Ramakrishnan and Abhishek Patnia and Eduard H. Hovy and Gully A. P. C. Burns}, title = {Layout-aware text extraction from full-text {PDF} of scientific articles}, journal = {Source Code Biol. Medicine}, volume = {7}, pages = {7}, year = {2012}, url = {https://doi.org/10.1186/1751-0473-7-7}, doi = {10.1186/1751-0473-7-7}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/scfbm/RamakrishnanPHB12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/PenasHFRSSFBO12, author = {Anselmo Pe{\~{n}}as and Eduard H. Hovy and Pamela Forner and {\'{A}}lvaro Rodrigo and Richard F. E. Sutcliffe and Caroline Sporleder and Corina Forascu and Yassine Benajiba and Petya Osenova}, editor = {Pamela Forner and Jussi Karlgren and Christa Womser{-}Hacker}, title = {Overview of {QA4MRE} at {CLEF} 2012: Question Answering for Machine Reading Evaluation}, booktitle = {{CLEF} 2012 Evaluation Labs and Workshop, Online Working Notes, Rome, Italy, September 17-20, 2012}, series = {{CEUR} Workshop Proceedings}, volume = {1178}, publisher = {CEUR-WS.org}, year = {2012}, url = {https://ceur-ws.org/Vol-1178/CLEF2012wn-QA4MRE-PenasEt2012.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:42 +0100}, biburl = {https://dblp.org/rec/conf/clef/PenasHFRSSFBO12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/WangCPLHM12, author = {Hao Wang and Congxing Cai and Andrew Philpot and Mark Latonero and Eduard H. Hovy and Donald Metzler}, editor = {John Carlo Bertot and Luis F. Luna{-}Reyes and Sehl Mellouli}, title = {Data integration from open internet sources to combat sex trafficking of minors}, booktitle = {13th Annual International Conference on Digital Government Research, dg.o 2012, College Park, MD, USA, June 4-7, 2012}, pages = {246--252}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2307729.2307769}, doi = {10.1145/2307729.2307769}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/WangCPLHM12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/PenasHFRSFS12, author = {Anselmo Pe{\~{n}}as and Eduard H. Hovy and Pamela Forner and {\'{A}}lvaro Rodrigo and Richard F. E. Sutcliffe and Corina Forascu and Caroline Sporleder}, editor = {Nicoletta Calzolari and Khalid Choukri and Thierry Declerck and Mehmet Ugur Dogan and Bente Maegaard and Joseph Mariani and Jan Odijk and Stelios Piperidis}, title = {Evaluating Machine Reading Systems through Comprehension Tests}, booktitle = {Proceedings of the Eighth International Conference on Language Resources and Evaluation, {LREC} 2012, Istanbul, Turkey, May 23-25, 2012}, pages = {1143--1147}, publisher = {European Language Resources Association {(ELRA)}}, year = {2012}, url = {http://www.lrec-conf.org/proceedings/lrec2012/summaries/315.html}, timestamp = {Mon, 19 Aug 2019 14:40:54 +0200}, biburl = {https://dblp.org/rec/conf/lrec/PenasHFRSFS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/MetzlerCH12, author = {Donald Metzler and Congxing Cai and Eduard H. Hovy}, title = {Structured Event Retrieval over Microblog Archives}, booktitle = {Human Language Technologies: Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 3-8, 2012, Montr{\'{e}}al, Canada}, pages = {646--655}, publisher = {The Association for Computational Linguistics}, year = {2012}, url = {https://aclanthology.org/N12-1083/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/MetzlerCH12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dagstuhl-reports/BuitelaarCCH12, author = {Paul Buitelaar and Key{-}Sun Choi and Philipp Cimiano and Eduard H. Hovy}, title = {The Multilingual Semantic Web (Dagstuhl Seminar 12362)}, journal = {Dagstuhl Reports}, volume = {2}, number = {9}, pages = {15--94}, year = {2012}, url = {https://doi.org/10.4230/DagRep.2.9.15}, doi = {10.4230/DAGREP.2.9.15}, timestamp = {Wed, 07 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/dagstuhl-reports/BuitelaarCCH12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bmcbi/RussRHBB11, author = {Thomas A. Russ and Cartic Ramakrishnan and Eduard H. Hovy and Mihail Bota and Gully A. P. C. Burns}, title = {Knowledge Engineering Tools for Reasoning with Scientific Observations and Interpretations: a Neural Connectivity Use Case}, journal = {{BMC} Bioinform.}, volume = {12}, pages = {351}, year = {2011}, url = {https://doi.org/10.1186/1471-2105-12-351}, doi = {10.1186/1471-2105-12-351}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bmcbi/RussRHBB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dagstuhl-manifestos/BourneCDWHHS11, author = {Philip E. Bourne and Timothy W. Clark and Robert Dale and Anita de Waard and Ivan Herman and Eduard H. Hovy and David M. Shotton}, title = {Improving The Future of Research Communications and e-Scholarship (Dagstuhl Perspectives Workshop 11331)}, journal = {Dagstuhl Manifestos}, volume = {1}, number = {1}, pages = {41--60}, year = {2011}, url = {https://doi.org/10.4230/DagMan.1.1.41}, doi = {10.4230/DAGMAN.1.1.41}, timestamp = {Wed, 14 Jun 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/dagstuhl-manifestos/BourneCDWHHS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nle/RecasensH11, author = {Marta Recasens and Eduard H. Hovy}, title = {{BLANC:} Implementing the Rand index for coreference evaluation}, journal = {Nat. Lang. Eng.}, volume = {17}, number = {4}, pages = {485--510}, year = {2011}, url = {https://doi.org/10.1017/S135132491000029X}, doi = {10.1017/S135132491000029X}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/nle/RecasensH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaiss/Mulkar-MehtaHH11, author = {Rutu Mulkar{-}Mehta and Jerry R. Hobbs and Eduard H. Hovy}, title = {Applications and Discovery of Granularity Structures in Natural Language Discourse}, booktitle = {Logical Formalizations of Commonsense Reasoning, Papers from the 2011 {AAAI} Spring Symposium, Technical Report SS-11-06, Stanford, California, USA, March 21-23, 2011}, publisher = {{AAAI}}, year = {2011}, url = {http://www.aaai.org/ocs/index.php/SSS/SSS11/paper/view/2394}, timestamp = {Mon, 13 Feb 2012 17:07:39 +0100}, biburl = {https://dblp.org/rec/conf/aaaiss/Mulkar-MehtaHH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/HovyVTCH11, author = {Dirk Hovy and Ashish Vaswani and Stephen Tratz and David Chiang and Eduard H. Hovy}, title = {Models and Training for Unsupervised Preposition Sense Disambiguation}, booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics: Human Language Technologies, Proceedings of the Conference, 19-24 June, 2011, Portland, Oregon, {USA} - Short Papers}, pages = {323--328}, publisher = {The Association for Computer Linguistics}, year = {2011}, url = {https://aclanthology.org/P11-2056/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/HovyVTCH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/MetzlerHZ11, author = {Donald Metzler and Eduard H. Hovy and Chunliang Zhang}, title = {An Empirical Evaluation of Data-Driven Paraphrase Generation Techniques}, booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics: Human Language Technologies, Proceedings of the Conference, 19-24 June, 2011, Portland, Oregon, {USA} - Short Papers}, pages = {546--551}, publisher = {The Association for Computer Linguistics}, year = {2011}, url = {https://aclanthology.org/P11-2096/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/MetzlerHZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/HovyZHP11, author = {Dirk Hovy and Chunliang Zhang and Eduard H. Hovy and Anselmo Pe{\~{n}}as}, editor = {Dekang Lin and Yuji Matsumoto and Rada Mihalcea}, title = {Unsupervised Discovery of Domain-Specific Knowledge from Text}, booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics: Human Language Technologies, Proceedings of the Conference, 19-24 June, 2011, Portland, Oregon, {USA}}, pages = {1466--1475}, publisher = {The Association for Computer Linguistics}, year = {2011}, url = {https://aclanthology.org/P11-1147/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/HovyZHP11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/KozarevaH11, author = {Zornitsa Kozareva and Eduard H. Hovy}, editor = {Dekang Lin and Yuji Matsumoto and Rada Mihalcea}, title = {Insights from Network Structure for Text Mining}, booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics: Human Language Technologies, Proceedings of the Conference, 19-24 June, 2011, Portland, Oregon, {USA}}, pages = {1616--1625}, publisher = {The Association for Computer Linguistics}, year = {2011}, url = {https://aclanthology.org/P11-1162/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/KozarevaH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bionlp/PokkunuriRRHB11, author = {Sandeep Pokkunuri and Cartic Ramakrishnan and Ellen Riloff and Eduard H. Hovy and Gully Burns}, editor = {Kevin Bretonnel Cohen and Dina Demner{-}Fushman and Sophia Ananiadou and John Pestian and Jun'ichi Tsujii and Bonnie L. Webber}, title = {The Role of Information Extraction in the Design of a Document Triage Application for Biocuration}, booktitle = {Proceedings of the 2011 Workshop on Biomedical Natural Language Processing, BioNLP@ACL, Portland, Oregon, USA, June 23-24, 2011}, pages = {46--55}, publisher = {Association for Computational Linguistics}, year = {2011}, url = {https://aclanthology.org/W11-0206/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/bionlp/PokkunuriRRHB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/PenasHFRSFS11, author = {Anselmo Pe{\~{n}}as and Eduard H. Hovy and Pamela Forner and {\'{A}}lvaro Rodrigo and Richard F. E. Sutcliffe and Corina Forascu and Caroline Sporleder}, editor = {Vivien Petras and Pamela Forner and Paul D. Clough}, title = {Overview of {QA4MRE} at {CLEF} 2011: Question Answering for Machine Reading Evaluation}, booktitle = {{CLEF} 2011 Labs and Workshop, Notebook Papers, 19-22 September 2011, Amsterdam, The Netherlands}, series = {{CEUR} Workshop Proceedings}, volume = {1177}, publisher = {CEUR-WS.org}, year = {2011}, url = {https://ceur-ws.org/Vol-1177/CLEF2011wn-QA4MRE-PenasEt2011.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:36 +0100}, biburl = {https://dblp.org/rec/conf/clef/PenasHFRSFS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/comgeo/CaiH11, author = {Congxing Cai and Eduard H. Hovy}, editor = {Lindi Liao}, title = {Summarizing textual information about locations}, booktitle = {Proceedings of the 2nd International Conference and Exhibition on Computing for Geospatial Research {\&} Application, COM.Geo 2011, Washington, DC, USA, May 23-25, 2011}, series = {{ACM} International Conference Proceeding Series}, pages = {8:1--8:9}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/1999320.1999328}, doi = {10.1145/1999320.1999328}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/comgeo/CaiH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/GouwsHM11, author = {Stephan Gouws and Eduard H. Hovy and Donald Metzler}, editor = {Omri Abend and Anna Korhonen and Ari Rappoport and Roi Reichart}, title = {Unsupervised Mining of Lexical Variants from Noisy Text}, booktitle = {Proceedings of the First workshop on Unsupervised Learning in NLP@EMNLP 2011, Edinburgh, Scotland, July 30, 2011}, pages = {82--90}, publisher = {Association for Computational Linguistics}, year = {2011}, url = {https://aclanthology.org/W11-2210/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/GouwsHM11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/TratzH11, author = {Stephen Tratz and Eduard H. Hovy}, title = {A Fast, Accurate, Non-Projective, Semantically-Enriched Parser}, booktitle = {Proceedings of the 2011 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2011, 27-31 July 2011, John McIntyre Conference Centre, Edinburgh, UK, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {1257--1268}, publisher = {{ACL}}, year = {2011}, url = {https://aclanthology.org/D11-1116/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/TratzH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/flairs/Mulkar-MehtaWHH11, author = {Rutu Mulkar{-}Mehta and Christopher A. Welty and Jerry R. Hobbs and Eduard H. Hovy}, editor = {R. Charles Murray and Philip M. McCarthy}, title = {Using Part-Of Relations for Discovering Causality}, booktitle = {Proceedings of the Twenty-Fourth International Florida Artificial Intelligence Research Society Conference, May 18-20, 2011, Palm Beach, Florida, {USA}}, publisher = {{AAAI} Press}, year = {2011}, url = {http://aaai.org/ocs/index.php/FLAIRS/FLAIRS11/paper/view/2511}, timestamp = {Wed, 26 Oct 2022 08:35:19 +0200}, biburl = {https://dblp.org/rec/conf/flairs/Mulkar-MehtaWHH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwcs/Hovy11, author = {Eduard H. Hovy}, editor = {Johan Bos and Stephen Pulman}, title = {A New Semantics: Merging Propositional and Distributional Information}, booktitle = {Proceedings of the Ninth International Conference on Computational Semantics, {IWCS} 2011, January 12-14, 2011, Oxford, {UK}}, publisher = {The Association for Computer Linguistics}, year = {2011}, url = {https://aclanthology.org/W11-0102/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwcs/Hovy11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwcs/Mulkar-MehtaHH11, author = {Rutu Mulkar{-}Mehta and Jerry R. Hobbs and Eduard H. Hovy}, editor = {Johan Bos and Stephen Pulman}, title = {Granularity in Natural Language Discourse}, booktitle = {Proceedings of the Ninth International Conference on Computational Semantics, {IWCS} 2011, January 12-14, 2011, Oxford, {UK}}, publisher = {The Association for Computer Linguistics}, year = {2011}, url = {https://aclanthology.org/W11-0143/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwcs/Mulkar-MehtaHH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/kcap/Mulkar-MehtaGHH11, author = {Rutu Mulkar{-}Mehta and Andrew S. Gordon and Jerry R. Hobbs and Eduard H. Hovy}, editor = {Mark A. Musen and {\'{O}}scar Corcho}, title = {Causal markers across domains and genres of discourse}, booktitle = {Proceedings of the 6th International Conference on Knowledge Capture {(K-CAP} 2011), June 26-29, 2011, Banff, Alberta, Canada}, pages = {183--184}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/1999676.1999716}, doi = {10.1145/1999676.1999716}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/kcap/Mulkar-MehtaGHH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mlslp/Hovy11, author = {Eduard H. Hovy}, title = {On the role of machine learning in {NLP}}, booktitle = {2011 Symposium on Machine Learning in Speech and Language Processing, {MLSLP} 2011, Bellevue, WA, USA, June 27, 2011}, publisher = {{ISCA}}, year = {2011}, url = {http://www.isca-speech.org/archive/mlslp\_2011/ml11\_103.html}, timestamp = {Tue, 16 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mlslp/Hovy11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/semco/KozarevaH11, author = {Zornitsa Kozareva and Eduard H. Hovy}, title = {Learning Temporal Information for States and Events}, booktitle = {Proceedings of the 5th {IEEE} International Conference on Semantic Computing {(ICSC} 2011), Palo Alto, CA, USA, September 18-21, 2011}, pages = {424--429}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/ICSC.2011.94}, doi = {10.1109/ICSC.2011.94}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/semco/KozarevaH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/tanlp/HovyOR11, author = {Eduard H. Hovy and Jon Oberlander and Norbert Reithinger}, editor = {Antal van den Bosch and Gosse Bouma}, title = {{IMIX:} Good Questions, Promising Answers}, booktitle = {Interactive Multi-modal Question-Answering}, pages = {271--279}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-17525-1\_12}, doi = {10.1007/978-3-642-17525-1\_12}, timestamp = {Sun, 02 Jun 2019 20:42:26 +0200}, biburl = {https://dblp.org/rec/series/tanlp/HovyOR11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/TanZWH11, author = {Yongmei Tan and Junyu Zeng and Xiaojie Wang and Eduard H. Hovy}, title = {BUPTTeam Participation at {TAC} 2011 Recognizing Textual Entailment}, booktitle = {Proceedings of the Fourth Text Analysis Conference, {TAC} 2011, Gaithersburg, Maryland, USA, November 14-15, 2011}, publisher = {{NIST}}, year = {2011}, url = {https://tac.nist.gov/publications/2011/participant.papers/BUPTTeam.proceedings.pdf}, timestamp = {Tue, 13 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/tac/TanZWH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dagstuhl-reports/ClarkWHH11, author = {Tim Clark and Anita de Waard and Ivan Herman and Eduard H. Hovy}, title = {The Future of Research Communication (Dagstuhl Perspectives Workshop 11331)}, journal = {Dagstuhl Reports}, volume = {1}, number = {8}, pages = {29--52}, year = {2011}, url = {https://doi.org/10.4230/DagRep.1.8.29}, doi = {10.4230/DAGREP.1.8.29}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/dagstuhl-reports/ClarkWHH11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ipm/YuWCLH10, author = {Liang{-}Chih Yu and Chung{-}Hsien Wu and Ru{-}Yng Chang and Chao{-}Hong Liu and Eduard H. Hovy}, title = {Annotation and verification of sense pools in OntoNotes}, journal = {Inf. Process. Manag.}, volume = {46}, number = {4}, pages = {436--447}, year = {2010}, url = {https://doi.org/10.1016/j.ipm.2009.11.002}, doi = {10.1016/J.IPM.2009.11.002}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ipm/YuWCLH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nle/DorrPFGHHHLMMRS10, author = {Bonnie J. Dorr and Rebecca J. Passonneau and David Farwell and Rebecca Green and Nizar Habash and Stephen Helmreich and Eduard H. Hovy and Lori S. Levin and Keith J. Miller and Teruko Mitamura and Owen Rambow and Advaith Siddharthan}, title = {Interlingual annotation of parallel text corpora: a new framework for annotation and evaluation}, journal = {Nat. Lang. Eng.}, volume = {16}, number = {3}, pages = {197--243}, year = {2010}, url = {https://doi.org/10.1017/S1351324910000070}, doi = {10.1017/S1351324910000070}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nle/DorrPFGHHHLMMRS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/polity/ChunSSH10, author = {Soon Ae Chun and Stuart W. Shulman and Rodrigo Sandoval and Eduard H. Hovy}, title = {Government 2.0: Making connections between citizens, data and government}, journal = {Inf. Polity}, volume = {15}, number = {1-2}, pages = {1--9}, year = {2010}, url = {https://doi.org/10.3233/IP-2010-0205}, doi = {10.3233/IP-2010-0205}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/polity/ChunSSH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tslp/ZhuWHM10, author = {Jingbo Zhu and Huizhen Wang and Eduard H. Hovy and Matthew Y. Ma}, title = {Confidence-based stopping criteria for active learning for data annotation}, journal = {{ACM} Trans. Speech Lang. Process.}, volume = {6}, number = {3}, pages = {3:1--3:24}, year = {2010}, url = {https://doi.org/10.1145/1753783.1753784}, doi = {10.1145/1753783.1753784}, timestamp = {Wed, 25 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tslp/ZhuWHM10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ws/HovyS10, author = {Eduard H. Hovy and Susie Stephens}, title = {Introduction to the Special Issue}, journal = {J. Web Semant.}, volume = {8}, number = {2-3}, pages = {143--144}, year = {2010}, url = {https://doi.org/10.1016/j.websem.2010.04.003}, doi = {10.1016/J.WEBSEM.2010.04.003}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ws/HovyS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/Hovy10, author = {Eduard H. Hovy}, editor = {Roser Morante and Caroline Sporleder}, title = {Negation and modality in distributional semantics}, booktitle = {Proceedings of the Workshop on Negation and Speculation in Natural Language Processing, NeSp-NLP@ACL 2010, Uppsala, Sweden, July 10, 2010}, pages = {50}, publisher = {University of Antwerp}, year = {2010}, url = {https://aclanthology.org/W10-3109/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/Hovy10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/TratzH10, author = {Stephen Tratz and Eduard H. Hovy}, editor = {Jan Hajic and Sandra Carberry and Stephen Clark}, title = {A Taxonomy, Dataset, and Classifier for Automatic Noun Compound Interpretation}, booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden}, pages = {678--687}, publisher = {The Association for Computer Linguistics}, year = {2010}, url = {https://aclanthology.org/P10-1070/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/TratzH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/RecasensH10, author = {Marta Recasens and Eduard H. Hovy}, editor = {Jan Hajic and Sandra Carberry and Stephen Clark}, title = {Coreference Resolution across Corpora: Languages, Coding Schemes, and Preprocessing Information}, booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden}, pages = {1423--1432}, publisher = {The Association for Computer Linguistics}, year = {2010}, url = {https://aclanthology.org/P10-1144/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/RecasensH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/KozarevaH10, author = {Zornitsa Kozareva and Eduard H. Hovy}, editor = {Jan Hajic and Sandra Carberry and Stephen Clark}, title = {Learning Arguments and Supertypes of Semantic Relations Using Recursive Patterns}, booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden}, pages = {1482--1491}, publisher = {The Association for Computer Linguistics}, year = {2010}, url = {https://aclanthology.org/P10-1150/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/KozarevaH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clef/RodrigoPHP10, author = {{\'{A}}lvaro Rodrigo and Anselmo Pe{\~{n}}as and Eduard H. Hovy and Emanuele Pianta}, editor = {Martin Braschler and Donna Harman and Emanuele Pianta}, title = {Question Answering for Machine Reading Evaluation}, booktitle = {{CLEF} 2010 LABs and Workshops, Notebook Papers, 22-23 September 2010, Padua, Italy}, series = {{CEUR} Workshop Proceedings}, volume = {1176}, publisher = {CEUR-WS.org}, year = {2010}, url = {https://ceur-ws.org/Vol-1176/CLEF2010wn-MLQA10-RodrigoEt2010.pdf}, timestamp = {Fri, 10 Mar 2023 16:23:37 +0100}, biburl = {https://dblp.org/rec/conf/clef/RodrigoPHP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/HovyTH10, author = {Dirk Hovy and Stephen Tratz and Eduard H. Hovy}, editor = {Chu{-}Ren Huang and Dan Jurafsky}, title = {What's in a Preposition? Dimensions of Sense Disambiguation for an Interesting Word Class}, booktitle = {{COLING} 2010, 23rd International Conference on Computational Linguistics, Posters Volume, 23-27 August 2010, Beijing, China}, pages = {454--462}, publisher = {Chinese Information Processing Society of China}, year = {2010}, url = {https://aclanthology.org/C10-2052/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/HovyTH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/PenasH10, author = {Anselmo Pe{\~{n}}as and Eduard H. Hovy}, editor = {Chu{-}Ren Huang and Dan Jurafsky}, title = {Filling Knowledge Gaps in Text for Machine Reading}, booktitle = {{COLING} 2010, 23rd International Conference on Computational Linguistics, Posters Volume, 23-27 August 2010, Beijing, China}, pages = {979--987}, publisher = {Chinese Information Processing Society of China}, year = {2010}, url = {https://aclanthology.org/C10-2113/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/PenasH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/KozarevaH10, author = {Zornitsa Kozareva and Eduard H. Hovy}, title = {A Semi-Supervised Method to Learn and Construct Taxonomies Using the Web}, booktitle = {Proceedings of the 2010 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2010, 9-11 October 2010, {MIT} Stata Center, Massachusetts, USA, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {1110--1118}, publisher = {{ACL}}, year = {2010}, url = {https://aclanthology.org/D10-1108/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/KozarevaH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/RecasensHM10, author = {Marta Recasens and Eduard H. Hovy and Maria Ant{\`{o}}nia Mart{\'{\i}}}, editor = {Nicoletta Calzolari and Khalid Choukri and Bente Maegaard and Joseph Mariani and Jan Odijk and Stelios Piperidis and Mike Rosner and Daniel Tapias}, title = {A Typology of Near-Identity Relations for Coreference {(NIDENT)}}, booktitle = {Proceedings of the International Conference on Language Resources and Evaluation, {LREC} 2010, 17-23 May 2010, Valletta, Malta}, publisher = {European Language Resources Association}, year = {2010}, url = {http://www.lrec-conf.org/proceedings/lrec2010/summaries/160.html}, timestamp = {Mon, 19 Aug 2019 15:22:48 +0200}, biburl = {https://dblp.org/rec/conf/lrec/RecasensHM10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/CaiH10, author = {Congxing Cai and Eduard H. Hovy}, editor = {Carolyn Penstein Ros{\'{e}}}, title = {Summarizing Textual Information about Locations In a Geo-Spatial Information Display System}, booktitle = {Human Language Technologies: Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 2, 2010, Los Angeles, California, {USA} - Demonstration Session}, pages = {5--8}, publisher = {The Association for Computational Linguistics}, year = {2010}, url = {https://aclanthology.org/N10-2002/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/CaiH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/KozarevaH10, author = {Zornitsa Kozareva and Eduard H. Hovy}, title = {Not All Seeds Are Equal: Measuring the Quality of Text Mining Seeds}, booktitle = {Human Language Technologies: Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 2-4, 2010, Los Angeles, California, {USA}}, pages = {618--626}, publisher = {The Association for Computational Linguistics}, year = {2010}, url = {https://aclanthology.org/N10-1087/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/KozarevaH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/semeval/TratzH10, author = {Stephen Tratz and Eduard H. Hovy}, editor = {Katrin Erk and Carlo Strapparava}, title = {{ISI:} Automatic Classification of Relations Between Nominals Using a Maximum Entropy Classifier}, booktitle = {Proceedings of the 5th International Workshop on Semantic Evaluation, SemEval@ACL 2010, Uppsala University, Uppsala, Sweden, July 15-16, 2010}, pages = {222--225}, publisher = {The Association for Computer Linguistics}, year = {2010}, url = {https://aclanthology.org/S10-1049/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/semeval/TratzH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaifs/MarcoWH09, author = {Chrysanne Di Marco and David Wiljer and Eduard H. Hovy}, title = {Self-Managed Access to Personalized Healthcare through Automated Generation of Tailored Health Educational Materials from Electronic Health Records}, booktitle = {Virtual Healthcare Interaction, Papers from the 2009 {AAAI} Fall Symposium, Arlington, Virginia, USA, November 5-7, 2009}, series = {{AAAI} Technical Report}, volume = {{FS-09-07}}, publisher = {{AAAI}}, year = {2009}, url = {http://aaai.org/ocs/index.php/FSS/FSS09/paper/view/959}, timestamp = {Wed, 29 Mar 2017 16:45:25 +0200}, biburl = {https://dblp.org/rec/conf/aaaifs/MarcoWH09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaiss/KozarevaHR09, author = {Zornitsa Kozareva and Eduard H. Hovy and Ellen Riloff}, title = {Learning and Evaluating the Content and Structure of a Term Taxonomy}, booktitle = {Learning by Reading and Learning to Read, Papers from the 2009 {AAAI} Spring Symposium, Technical Report SS-09-07, Stanford, California, USA, March 23-25, 2009}, pages = {50--57}, publisher = {{AAAI}}, year = {2009}, url = {http://www.aaai.org/Library/Symposia/Spring/2009/ss09-07-009.php}, timestamp = {Sat, 18 Feb 2012 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aaaiss/KozarevaHR09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/daarc/RecasensH09, author = {Marta Recasens and Eduard H. Hovy}, editor = {Sobha Lalitha Devi and Ant{\'{o}}nio Horta Branco and Ruslan Mitkov}, title = {A Deeper Look into Features for Coreference Resolution}, booktitle = {Anaphora Processing and Applications, 7th Discourse Anaphora and Anaphor Resolution Colloquium, {DAARC} 2009, Goa, India, November 5-6, 2009, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5847}, pages = {29--42}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-04975-0\_3}, doi = {10.1007/978-3-642-04975-0\_3}, timestamp = {Tue, 14 May 2019 10:00:50 +0200}, biburl = {https://dblp.org/rec/conf/daarc/RecasensH09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/HovyKR09, author = {Eduard H. Hovy and Zornitsa Kozareva and Ellen Riloff}, title = {Toward Completeness in Concept Extraction and Classification}, booktitle = {Proceedings of the 2009 Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2009, 6-7 August 2009, Singapore, {A} meeting of SIGDAT, a Special Interest Group of the {ACL}}, pages = {948--957}, publisher = {{ACL}}, year = {2009}, url = {https://aclanthology.org/D09-1099/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/HovyKR09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/kcap/BhagatHP09, author = {Rahul Bhagat and Eduard H. Hovy and Siddharth Patwardhan}, editor = {Yolanda Gil and Natasha Fridman Noy}, title = {Acquiring paraphrases from text corpora}, booktitle = {Proceedings of the 5th International Conference on Knowledge Capture {(K-CAP} 2009), September 1-4, 2009, Redondo Beach, California, {USA}}, pages = {161--168}, publisher = {{ACM}}, year = {2009}, url = {https://doi.org/10.1145/1597735.1597764}, doi = {10.1145/1597735.1597764}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/kcap/BhagatHP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nldb/Hovy09, author = {Eduard H. Hovy}, editor = {Helmut Horacek and Elisabeth M{\'{e}}tais and Rafael Mu{\~{n}}oz and Magdalena Wolska}, title = {Turning the Web into a Database: Extracting Data and Structure}, booktitle = {Natural Language Processing and Information Systems, 14th International Conference on Applications of Natural Language to Information Systems, {NLDB} 2009, Saarbr{\"{u}}cken, Germany, June 24-26, 2009. Revised Papers}, series = {Lecture Notes in Computer Science}, volume = {5723}, pages = {1--7}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-12550-8\_1}, doi = {10.1007/978-3-642-12550-8\_1}, timestamp = {Tue, 14 May 2019 10:00:53 +0200}, biburl = {https://dblp.org/rec/conf/nldb/Hovy09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/TratzH09, author = {Stephen Tratz and Eduard H. Hovy}, title = {BEwT-E for {TAC} 2009's {AESOP} Task}, booktitle = {Proceedings of the Second Text Analysis Conference, {TAC} 2009, Gaithersburg, Maryland, USA, November 16-17, 2009}, publisher = {{NIST}}, year = {2009}, url = {https://tac.nist.gov/publications/2009/participant.papers/ISI.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 13:25:17 +0200}, biburl = {https://dblp.org/rec/conf/tac/TratzH09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijclclp/YuWYH08, author = {Liang{-}Chih Yu and Chung{-}Hsien Wu and Jui{-}Feng Yeh and Eduard H. Hovy}, title = {Corpus Cleanup of Mistaken Agreement Using Word Sense Disambiguation}, journal = {Int. J. Comput. Linguistics Chin. Lang. Process.}, volume = {13}, number = {4}, year = {2008}, url = {http://www.aclclp.org.tw/clclp/v13n4/v13n4a2.pdf}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijclclp/YuWYH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/KozarevaRH08, author = {Zornitsa Kozareva and Ellen Riloff and Eduard H. Hovy}, editor = {Kathleen R. McKeown and Johanna D. Moore and Simone Teufel and James Allan and Sadaoki Furui}, title = {Semantic Class Learning from the Web with Hyponym Pattern Linkage Graphs}, booktitle = {{ACL} 2008, Proceedings of the 46th Annual Meeting of the Association for Computational Linguistics, June 15-20, 2008, Columbus, Ohio, {USA}}, pages = {1048--1056}, publisher = {The Association for Computer Linguistics}, year = {2008}, url = {https://aclanthology.org/P08-1119/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/KozarevaRH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bionlp/FengBH08, author = {Donghui Feng and Gully Burns and Eduard H. Hovy}, editor = {Dina Demner{-}Fushman and Sophia Ananiadou and Kevin Bretonnel Cohen and John Pestian and Jun'ichi Tsujii and Bonnie L. Webber}, title = {Adaptive Information Extraction for Complex Biomedical Tasks}, booktitle = {Proceedings of the Workshop on Current Trends in Biomedical Natural Language Processing, BioNLP 2008, Columbus, Ohio, USA, June 19, 2008}, pages = {120--121}, publisher = {Association for Computational Linguistics}, year = {2008}, url = {https://aclanthology.org/W08-0628/}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bionlp/FengBH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/YuWH08, author = {Liang{-}Chih Yu and Chung{-}Hsien Wu and Eduard H. Hovy}, editor = {Donia Scott and Hans Uszkoreit}, title = {OntoNotes: Corpus Cleanup of Mistaken Agreement Using Word Sense Disambiguation}, booktitle = {{COLING} 2008, 22nd International Conference on Computational Linguistics, Proceedings of the Conference, 18-22 August 2008, Manchester, {UK}}, pages = {1057--1064}, year = {2008}, url = {https://aclanthology.org/C08-1133/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/YuWH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/ZhuWH08, author = {Jingbo Zhu and Huizhen Wang and Eduard H. Hovy}, editor = {Donia Scott and Hans Uszkoreit}, title = {Multi-Criteria-Based Strategy to Stop Active Learning for Data Annotation}, booktitle = {{COLING} 2008, 22nd International Conference on Computational Linguistics, Proceedings of the Conference, 18-22 August 2008, Manchester, {UK}}, pages = {1129--1136}, year = {2008}, url = {https://aclanthology.org/C08-1142/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/ZhuWH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hicss/ShulmanKHH08, author = {Stuart W. Shulman and Namhee Kwon and Eduard H. Hovy and Emily Huisman}, title = {Tools for Rules: Technology Transfer and Electronic Rulemaking}, booktitle = {41st Hawaii International International Conference on Systems Science {(HICSS-41} 2008), Proceedings, 7-10 January 2008, Waikoloa, Big Island, HI, {USA}}, pages = {200}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/HICSS.2008.454}, doi = {10.1109/HICSS.2008.454}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/hicss/ShulmanKHH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnlp/ZhuWH08, author = {Jingbo Zhu and Huizhen Wang and Eduard H. Hovy}, title = {Learning a Stopping Criterion for Active Learning for Word Sense Disambiguation and Text Classification}, booktitle = {Third International Joint Conference on Natural Language Processing, {IJCNLP} 2008, Hyderabad, India, January 7-12, 2008}, pages = {366--372}, publisher = {The Association for Computer Linguistics}, year = {2008}, url = {https://aclanthology.org/I08-1048/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcnlp/ZhuWH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnlp/FengBZH08, author = {Donghui Feng and Gully Burns and Jingbo Zhu and Eduard H. Hovy}, title = {Towards Automated Semantic Analysis on Biomedical Research Articles}, booktitle = {Third International Joint Conference on Natural Language Processing, {IJCNLP} 2008, Hyderabad, India, January 7-12, 2008}, pages = {871--876}, publisher = {The Association for Computer Linguistics}, year = {2008}, url = {https://aclanthology.org/I08-2124/}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ijcnlp/FengBZH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/HartholtRTHR08, author = {Arno Hartholt and Thomas A. Russ and David R. Traum and Eduard H. Hovy and Susan Robinson}, title = {A Common Ground for Virtual Humans: Using an Ontology in a Natural Language Oriented Virtual Human Architecture}, booktitle = {Proceedings of the International Conference on Language Resources and Evaluation, {LREC} 2008, 26 May - 1 June 2008, Marrakech, Morocco}, publisher = {European Language Resources Association}, year = {2008}, url = {http://www.lrec-conf.org/proceedings/lrec2008/summaries/811.html}, timestamp = {Mon, 19 Aug 2019 15:22:28 +0200}, biburl = {https://dblp.org/rec/conf/lrec/HartholtRTHR08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sofsem/ShinHM08, author = {Hyun Woong Shin and Eduard H. Hovy and Dennis McLeod}, editor = {Viliam Geffert and Juhani Karhum{\"{a}}ki and Alberto Bertoni and Bart Preneel and Pavol N{\'{a}}vrat and M{\'{a}}ria Bielikov{\'{a}}}, title = {The Dynamic Web Presentations with a Generality Model on the News Domain}, booktitle = {{SOFSEM} 2008: Theory and Practice of Computer Science, 34th Conference on Current Trends in Theory and Practice of Computer Science, Nov{\'{y}} Smokovec, Slovakia, January 19-25, 2008, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4910}, pages = {755--765}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-77566-9\_65}, doi = {10.1007/978-3-540-77566-9\_65}, timestamp = {Tue, 14 May 2019 10:00:44 +0200}, biburl = {https://dblp.org/rec/conf/sofsem/ShinHM08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/sp/08/Hovy08, author = {Eduard H. Hovy}, editor = {Hsinchun Chen and Lawrence Brandt and Valerie Gregg and Roland Traunm{\"{u}}ller and Sharon S. Dawes and Eduard H. Hovy and Ann Macintosh and Catherine A. Larson}, title = {An Outline for the Foundations of Digital Government Research}, booktitle = {Digital Government: E-Government Research, Case Studies, and Implementation}, series = {Integrated Series In Information Systems}, volume = {17}, pages = {43--59}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-0-387-71611-4\_3}, doi = {10.1007/978-0-387-71611-4\_3}, timestamp = {Tue, 23 Jul 2019 18:38:58 +0200}, biburl = {https://dblp.org/rec/books/sp/08/Hovy08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/sp/08/Hovy08a, author = {Eduard H. Hovy}, editor = {Hsinchun Chen and Lawrence Brandt and Valerie Gregg and Roland Traunm{\"{u}}ller and Sharon S. Dawes and Eduard H. Hovy and Ann Macintosh and Catherine A. Larson}, title = {Data and Knowledge Integration for e-Government}, booktitle = {Digital Government: E-Government Research, Case Studies, and Implementation}, series = {Integrated Series In Information Systems}, volume = {17}, pages = {219--231}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-0-387-71611-4\_12}, doi = {10.1007/978-0-387-71611-4\_12}, timestamp = {Tue, 23 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/sp/08/Hovy08a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/sci/BurnsFH08, author = {Gully Burns and Donghui Feng and Eduard H. Hovy}, editor = {Arpad Kelemen and Ajith Abraham and Yulan Liang}, title = {Intelligent Approaches to Mining the Primary Research Literature: Techniques, Systems, and Examples}, booktitle = {Computational Intelligence in Medical Informatics}, series = {Studies in Computational Intelligence}, volume = {85}, pages = {17--50}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-75767-2\_2}, doi = {10.1007/978-3-540-75767-2\_2}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/series/sci/BurnsFH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/08/CBGTDHM2008, editor = {Hsinchun Chen and Lawrence Brandt and Valerie Gregg and Roland Traunm{\"{u}}ller and Sharon S. Dawes and Eduard H. Hovy and Ann Macintosh and Catherine A. Larson}, title = {Digital Government: E-Government Research, Case Studies, and Implementation}, series = {Integrated Series In Information Systems}, volume = {17}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-0-387-71611-4}, doi = {10.1007/978-0-387-71611-4}, isbn = {978-0-387-71610-7}, timestamp = {Tue, 23 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/sp/08/CBGTDHM2008.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tac/TratzH08, author = {Stephen Tratz and Eduard H. Hovy}, title = {Summarization Evaluation Using Transformed Basic Elements}, booktitle = {Proceedings of the First Text Analysis Conference, {TAC} 2008, Gaithersburg, Maryland, USA, November 17-19, 2008}, publisher = {{NIST}}, year = {2008}, url = {https://tac.nist.gov/publications/2008/additional.papers/ISI.proceedings.pdf}, timestamp = {Tue, 20 Aug 2019 13:25:18 +0200}, biburl = {https://dblp.org/rec/conf/tac/TratzH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijsc/PradhanHMPRW07, author = {Sameer S. Pradhan and Eduard H. Hovy and Mitchell P. Marcus and Martha Palmer and Lance A. Ramshaw and Ralph M. Weischedel}, title = {Ontonotes: a Unified Relational Semantic Representation}, journal = {Int. J. Semantic Comput.}, volume = {1}, number = {4}, pages = {405--419}, year = {2007}, url = {https://doi.org/10.1142/S1793351X07000251}, doi = {10.1142/S1793351X07000251}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijsc/PradhanHMPRW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/IEEEscc/BurnsFIH07, author = {Gully Burns and Donghui Feng and Tommy Ingulfsen and Eduard H. Hovy}, title = {Infrastructure for Annotation-Driven Information Extraction from the Primary Scientific Literature: Principles and Practice}, booktitle = {2007 {IEEE} International Conference on Services Computing - Workshops {(SCW} 2007), 9-13 July 2007, Salt Lake City, Utah, {USA}}, pages = {122--129}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/SERVICES.2007.34}, doi = {10.1109/SERVICES.2007.34}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/IEEEscc/BurnsFIH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/BarkerACFFGHHIKMPPTY07, author = {Ken Barker and Bhalchandra Agashe and Shaw Yi Chaw and James Fan and Noah S. Friedland and Michael Robert Glass and Jerry R. Hobbs and Eduard H. Hovy and David J. Israel and Doo Soon Kim and Rutu Mulkar{-}Mehta and Sourabh Patwardhan and Bruce W. Porter and Dan Tecuci and Peter Z. Yeh}, title = {Learning by Reading: {A} Prototype System, Performance Baseline and Lessons Learned}, booktitle = {Proceedings of the Twenty-Second {AAAI} Conference on Artificial Intelligence, July 22-26, 2007, Vancouver, British Columbia, Canada}, pages = {280--286}, publisher = {{AAAI} Press}, year = {2007}, url = {http://www.aaai.org/Library/AAAI/2007/aaai07-043.php}, timestamp = {Tue, 05 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aaai/BarkerACFFGHHIKMPPTY07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaiss/MulkarHH07, author = {Rutu Mulkar and Jerry R. Hobbs and Eduard H. Hovy}, title = {Learning from Reading Syntactically Complex Biology Texts}, booktitle = {Logical Formalizations of Commonsense Reasoning, Papers from the 2007 {AAAI} Spring Symposium, Technical Report SS-07-05, Stanford, California, USA, March 26-28, 2007}, pages = {132--137}, publisher = {{AAAI}}, year = {2007}, url = {http://www.aaai.org/Library/Symposia/Spring/2007/ss07-05-023.php}, timestamp = {Fri, 17 Feb 2012 14:14:44 +0100}, biburl = {https://dblp.org/rec/conf/aaaiss/MulkarHH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/YuWLHL07, author = {Liang{-}Chih Yu and Chung{-}Hsien Wu and Chin{-}Yew Lin and Eduard H. Hovy and Chia{-}Ling Lin}, editor = {John Carroll and Antal van den Bosch and Annie Zaenen}, title = {Topic Analysis for Psychiatric Document Retrieval}, booktitle = {{ACL} 2007, Proceedings of the 45th Annual Meeting of the Association for Computational Linguistics, June 23-30, 2007, Prague, Czech Republic}, publisher = {The Association for Computational Linguistics}, year = {2007}, url = {https://aclanthology.org/P07-1129/}, timestamp = {Wed, 29 Mar 2023 13:06:50 +0200}, biburl = {https://dblp.org/rec/conf/acl/YuWLHL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/KwonZHS07, author = {Namhee Kwon and Liang Zhou and Eduard H. Hovy and Stuart W. Shulman}, editor = {Judith Bayard Cushing and Theresa A. Pardo}, title = {Identifying and classifying subjective claims}, booktitle = {Proceedings of the 8th Annual International Conference on Digital Government Research, Bridging Disciplines {\&} Domains, {DG.O} 2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007}, series = {{ACM} International Conference Proceeding Series}, volume = {228}, pages = {76--81}, publisher = {Digital Government Research Center}, year = {2007}, url = {http://dl.acm.org/citation.cfm?id=1248473}, timestamp = {Fri, 20 Nov 2015 13:56:20 +0100}, biburl = {https://dblp.org/rec/conf/dgo/KwonZHS07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/PantelPH07, author = {Patrick Pantel and Andrew Philpot and Eduard H. Hovy}, editor = {Judith Bayard Cushing and Theresa A. Pardo}, title = {Data integration in the wild: from instances to concept catalogs}, booktitle = {Proceedings of the 8th Annual International Conference on Digital Government Research, Bridging Disciplines {\&} Domains, {DG.O} 2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007}, series = {{ACM} International Conference Proceeding Series}, volume = {228}, pages = {264--265}, publisher = {Digital Government Research Center}, year = {2007}, url = {http://dl.acm.org/citation.cfm?id=1248511}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/PantelPH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/Hovy07, author = {Eduard H. Hovy}, editor = {Judith Bayard Cushing and Theresa A. Pardo}, title = {Government perspective: panel: international developments in digital government}, booktitle = {Proceedings of the 8th Annual International Conference on Digital Government Research, Bridging Disciplines {\&} Domains, {DG.O} 2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007}, series = {{ACM} International Conference Proceeding Series}, volume = {228}, pages = {336}, publisher = {Digital Government Research Center}, year = {2007}, url = {http://dl.acm.org/citation.cfm?id=1248544}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/Hovy07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/Hovy07a, author = {Eduard H. Hovy}, editor = {Judith Bayard Cushing and Theresa A. Pardo}, title = {Research perspective: panel: international developments in digital government}, booktitle = {Proceedings of the 8th Annual International Conference on Digital Government Research, Bridging Disciplines {\&} Domains, {DG.O} 2007, Philadelphia, Pennsylvania, USA, May 20-23, 2007}, series = {{ACM} International Conference Proceeding Series}, volume = {228}, pages = {337--338}, publisher = {Digital Government Research Center}, year = {2007}, url = {http://dl.acm.org/citation.cfm?id=1248545}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/Hovy07a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/BhagatPH07, author = {Rahul Bhagat and Patrick Pantel and Eduard H. Hovy}, editor = {Jason Eisner}, title = {{LEDIR:} An Unsupervised Algorithm for Learning Directionality of Inference Rules}, booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical Methods in Natural Language Processing and Computational Natural Language Learning, June 28-30, 2007, Prague, Czech Republic}, pages = {161--170}, publisher = {{ACL}}, year = {2007}, url = {https://aclanthology.org/D07-1017/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/BhagatPH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhuH07, author = {Jingbo Zhu and Eduard H. Hovy}, editor = {Jason Eisner}, title = {Active Learning for Word Sense Disambiguation with Methods for Addressing the Class Imbalance Problem}, booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical Methods in Natural Language Processing and Computational Natural Language Learning, June 28-30, 2007, Prague, Czech Republic}, pages = {783--790}, publisher = {{ACL}}, year = {2007}, url = {https://aclanthology.org/D07-1082/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ZhuH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/FengBH07, author = {Donghui Feng and Gully Burns and Eduard H. Hovy}, editor = {Jason Eisner}, title = {Extracting Data Records from Unstructured Biomedical Full Text}, booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical Methods in Natural Language Processing and Computational Natural Language Learning, June 28-30, 2007, Prague, Czech Republic}, pages = {837--846}, publisher = {{ACL}}, year = {2007}, url = {https://aclanthology.org/D07-1088/}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/emnlp/FengBH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/KimH07, author = {Soo{-}Min Kim and Eduard H. Hovy}, editor = {Jason Eisner}, title = {Crystal: Analyzing Predictive Opinions on the Web}, booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical Methods in Natural Language Processing and Computational Natural Language Learning, June 28-30, 2007, Prague, Czech Republic}, pages = {1056--1064}, publisher = {{ACL}}, year = {2007}, url = {https://aclanthology.org/D07-1113/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/KimH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/BhagatH07, author = {Rahul Bhagat and Eduard H. Hovy}, editor = {Manuela M. Veloso}, title = {Phonetic Models for Generating Spelling Variants}, booktitle = {{IJCAI} 2007, Proceedings of the 20th International Joint Conference on Artificial Intelligence, Hyderabad, India, January 6-12, 2007}, pages = {1570--1575}, year = {2007}, url = {http://ijcai.org/Proceedings/07/Papers/253.pdf}, timestamp = {Tue, 20 Aug 2019 16:17:11 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/BhagatH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/kcap/KwonH07, author = {Namhee Kwon and Eduard H. Hovy}, editor = {Derek H. Sleeman and Ken Barker}, title = {Information acquisition using multiple classifications}, booktitle = {Proceedings of the 4th International Conference on Knowledge Capture {(K-CAP} 2007), October 28-31, 2007, Whistler, BC, Canada}, pages = {111--118}, publisher = {{ACM}}, year = {2007}, url = {https://doi.org/10.1145/1298406.1298427}, doi = {10.1145/1298406.1298427}, timestamp = {Mon, 24 Aug 2020 15:16:10 +0200}, biburl = {https://dblp.org/rec/conf/kcap/KwonH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/ZhouKH07, author = {Liang Zhou and Namhee Kwon and Eduard H. Hovy}, editor = {Candace L. Sidner and Tanja Schultz and Matthew Stone and ChengXiang Zhai}, title = {A Semi-Automatic Evaluation Scheme: Automated Nuggetization for Manual Annotation}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, April 22-27, 2007, Rochester, New York, {USA}}, pages = {217--220}, publisher = {The Association for Computational Linguistics}, year = {2007}, url = {https://aclanthology.org/N07-2055/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/ZhouKH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/PantelBCCH07, author = {Patrick Pantel and Rahul Bhagat and Bonaventura Coppola and Timothy Chklovski and Eduard H. Hovy}, editor = {Candace L. Sidner and Tanja Schultz and Matthew Stone and ChengXiang Zhai}, title = {{ISP:} Learning Inferential Selectional Preferences}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, April 22-27, 2007, Rochester, New York, {USA}}, pages = {564--571}, publisher = {The Association for Computational Linguistics}, year = {2007}, url = {https://aclanthology.org/N07-1071/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/PantelBCCH07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/semco/PradhanHMPRW07, author = {Sameer S. Pradhan and Eduard H. Hovy and Mitchell P. Marcus and Martha Palmer and Lance A. Ramshaw and Ralph M. Weischedel}, title = {OntoNotes: {A} Unified Relational Semantic Representation}, booktitle = {Proceedings of the First {IEEE} International Conference on Semantic Computing {(ICSC} 2007), September 17-19, 2007, Irvine, California, {USA}}, pages = {517--526}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/ICSC.2007.83}, doi = {10.1109/ICSC.2007.83}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/semco/PradhanHMPRW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/SwartoutGHHMRT06, author = {William R. Swartout and Jonathan Gratch and Randall W. Hill Jr. and Eduard H. Hovy and Stacy Marsella and Jeff Rickel and David R. Traum}, title = {Toward Virtual Humans}, journal = {{AI} Mag.}, volume = {27}, number = {2}, pages = {96--108}, year = {2006}, url = {https://doi.org/10.1609/aimag.v27i2.1883}, doi = {10.1609/AIMAG.V27I2.1883}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aim/SwartoutGHHMRT06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/FengRH06, author = {Donghui Feng and Deepak Ravichandran and Eduard H. Hovy}, title = {Mining and Re-ranking for Answering Biographical Queries on the Web}, booktitle = {Proceedings, The Twenty-First National Conference on Artificial Intelligence and the Eighteenth Innovative Applications of Artificial Intelligence Conference, July 16-20, 2006, Boston, Massachusetts, {USA}}, pages = {1283--1288}, publisher = {{AAAI} Press}, year = {2006}, url = {http://www.aaai.org/Library/AAAI/2006/aaai06-201.php}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aaai/FengRH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/FengKSH06, author = {Donghui Feng and Jihie Kim and Erin Shaw and Eduard H. Hovy}, title = {Towards Modeling Threaded Discussions using Induced Ontology Knowledge}, booktitle = {Proceedings, The Twenty-First National Conference on Artificial Intelligence and the Eighteenth Innovative Applications of Artificial Intelligence Conference, July 16-20, 2006, Boston, Massachusetts, {USA}}, pages = {1289--1294}, publisher = {{AAAI} Press}, year = {2006}, url = {http://www.aaai.org/Library/AAAI/2006/aaai06-202.php}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aaai/FengKSH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaiss/MarcoCBCCHLM06, author = {Chrysanne Di Marco and Donald D. Cowan and Peter Bray and H. Dominic Covvey and Vic Di Ciccio and Eduard H. Hovy and Joan Lipa and Douglas W. Mulholland}, title = {A Physician's Authoring Tool for Generation of Personalized Health Education in Reconstructive Surgery}, booktitle = {Argumentation for Consumers of Healthcare, Papers from the 2006 {AAAI} Spring Symposium, Technical Report SS-06-01, Stanford, California, USA, March 27-29, 2006}, pages = {39--46}, publisher = {{AAAI}}, year = {2006}, url = {http://www.aaai.org/Library/Symposia/Spring/2006/ss06-01-007.php}, timestamp = {Sat, 18 Feb 2012 12:28:06 +0100}, biburl = {https://dblp.org/rec/conf/aaaiss/MarcoCBCCHLM06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaiss/ZhouH06, author = {Liang Zhou and Eduard H. Hovy}, title = {On the Summarization of Dynamically Introduced Information: Online Discussions and Blogs}, booktitle = {Computational Approaches to Analyzing Weblogs, Papers from the 2006 {AAAI} Spring Symposium, Technical Report SS-06-03, Stanford, California, USA, March 27-29, 2006}, pages = {237}, publisher = {{AAAI}}, year = {2006}, url = {http://www.aaai.org/Library/Symposia/Spring/2006/ss06-03-048.php}, timestamp = {Sat, 18 Feb 2012 12:29:12 +0100}, biburl = {https://dblp.org/rec/conf/aaaiss/ZhouH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/KimH06, author = {Soo{-}Min Kim and Eduard H. Hovy}, editor = {Nicoletta Calzolari and Claire Cardie and Pierre Isabelle}, title = {Automatic Identification of Pro and Con Reasons in Online Reviews}, booktitle = {{ACL} 2006, 21st International Conference on Computational Linguistics and 44th Annual Meeting of the Association for Computational Linguistics, Proceedings of the Conference, Sydney, Australia, 17-21 July 2006}, publisher = {The Association for Computer Linguistics}, year = {2006}, url = {https://aclanthology.org/P06-2063/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/KimH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amia/MarcoBCCCHLY06, author = {Chrysanne Di Marco and Peter Bray and H. Dominic Covvey and Donald D. Cowan and Vic Di Ciccio and Eduard H. Hovy and Joan Lipa and C. Yang}, title = {Authoring and Generation of Individualized Patient Education Materials}, booktitle = {{AMIA} 2006, American Medical Informatics Association Annual Symposium, Washington, DC, USA, November 11-15, 2006}, publisher = {{AMIA}}, year = {2006}, url = {https://knowledge.amia.org/amia-55142-a2006a-1.620145/t-001-1.623243/f-001-1.623244/a-039-1.623631/a-040-1.623628}, timestamp = {Wed, 17 Apr 2024 11:48:16 +0200}, biburl = {https://dblp.org/rec/conf/amia/MarcoBCCCHLY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cicling/KwonH06, author = {Namhee Kwon and Eduard H. Hovy}, editor = {Alexander F. Gelbukh}, title = {Integrating Semantic Frames from Multiple Sources}, booktitle = {Computational Linguistics and Intelligent Text Processing, 7th International Conference, CICLing 2006, Mexico City, Mexico, February 19-25, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3878}, pages = {1--12}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11671299\_1}, doi = {10.1007/11671299\_1}, timestamp = {Tue, 14 May 2019 10:00:46 +0200}, biburl = {https://dblp.org/rec/conf/cicling/KwonH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/KwonSH06, author = {Namhee Kwon and Stuart W. Shulman and Eduard H. Hovy}, editor = {Jos{\'{e}} A. B. Fortes and Ann Macintosh}, title = {Multidimensional text analysis for eRulemaking}, booktitle = {Proceedings of the 7th Annual International Conference on Digital Government Research, {DG.O} 2006, San Diego, California, USA, May 21-24, 2006}, series = {{ACM} International Conference Proceeding Series}, volume = {151}, pages = {157--166}, publisher = {Digital Government Research Center}, year = {2006}, url = {https://doi.org/10.1145/1146598.1146649}, doi = {10.1145/1146598.1146649}, timestamp = {Tue, 06 Nov 2018 11:06:50 +0100}, biburl = {https://dblp.org/rec/conf/dgo/KwonSH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/ShulmanHCZ06, author = {Stuart W. Shulman and Eduard H. Hovy and Jamie Callan and Stephen Zavestoski}, editor = {Jos{\'{e}} A. B. Fortes and Ann Macintosh}, title = {Progress in language processing technology for electronic rulemaking}, booktitle = {Proceedings of the 7th Annual International Conference on Digital Government Research, {DG.O} 2006, San Diego, California, USA, May 21-24, 2006}, series = {{ACM} International Conference Proceeding Series}, volume = {151}, pages = {249--250}, publisher = {Digital Government Research Center}, year = {2006}, url = {https://doi.org/10.1145/1146598.1146664}, doi = {10.1145/1146598.1146664}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/ShulmanHCZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/CushingWBDBFSSFHHJLSBGS06, author = {Judith Bayard Cushing and Tyrone Wilson and Alan Borning and Lois M. L. Delcambre and Geoffrey C. Bowker and Mike Frame and John L. Schnase and William Sonntag and J{\'{a}}nos F{\"{u}}l{\"{o}}p and Carol A. Hert and Eduard H. Hovy and Julia Jones and Eric Landis and Charles M. Schweik and Lawrence Brandt and Valerie Gregg and Sylvia Spengler}, editor = {Jos{\'{e}} A. B. Fortes and Ann Macintosh}, title = {Eco-informatics and natural resource management}, booktitle = {Proceedings of the 7th Annual International Conference on Digital Government Research, {DG.O} 2006, San Diego, California, USA, May 21-24, 2006}, series = {{ACM} International Conference Proceeding Series}, volume = {151}, pages = {381--382}, publisher = {Digital Government Research Center}, year = {2006}, url = {https://doi.org/10.1145/1146598.1146712}, doi = {10.1145/1146598.1146712}, timestamp = {Sun, 02 Jun 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dgo/CushingWBDBFSSFHHJLSBGS06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/HovyPP06, author = {Eduard H. Hovy and Andrew Philpot and Patrick Pantel}, editor = {Jos{\'{e}} A. B. Fortes and Ann Macintosh}, title = {Entity consolidation and alignment in semi-structured data sources}, booktitle = {Proceedings of the 7th Annual International Conference on Digital Government Research, {DG.O} 2006, San Diego, California, USA, May 21-24, 2006}, series = {{ACM} International Conference Proceeding Series}, volume = {151}, pages = {400--401}, publisher = {Digital Government Research Center}, year = {2006}, url = {https://doi.org/10.1145/1146598.1146721}, doi = {10.1145/1146598.1146721}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/HovyPP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/PantelPH06, author = {Patrick Pantel and Andrew Philpot and Eduard H. Hovy}, editor = {Jos{\'{e}} A. B. Fortes and Ann Macintosh}, title = {Matching and integration across heterogeneous data sources}, booktitle = {Proceedings of the 7th Annual International Conference on Digital Government Research, {DG.O} 2006, San Diego, California, USA, May 21-24, 2006}, series = {{ACM} International Conference Proceeding Series}, volume = {151}, pages = {438--439}, publisher = {Digital Government Research Center}, year = {2006}, url = {https://doi.org/10.1145/1146598.1146738}, doi = {10.1145/1146598.1146738}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/PantelPH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhouLH06, author = {Liang Zhou and Chin{-}Yew Lin and Eduard H. Hovy}, editor = {Dan Jurafsky and {\'{E}}ric Gaussier}, title = {Re-evaluating Machine Translation Results with Paraphrase Support}, booktitle = {{EMNLP} 2006, Proceedings of the 2006 Conference on Empirical Methods in Natural Language Processing, 22-23 July 2006, Sydney, Australia}, pages = {77--84}, publisher = {{ACL}}, year = {2006}, url = {https://aclanthology.org/W06-1610/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ZhouLH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/esws/Hovy06, author = {Eduard H. Hovy}, editor = {York Sure and John Domingue}, title = {Toward Large-Scale Shallow Semantics for Higher-Quality {NLP}}, booktitle = {The Semantic Web: Research and Applications, 3rd European Semantic Web Conference, {ESWC} 2006, Budva, Montenegro, June 11-14, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4011}, pages = {2}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11762256\_2}, doi = {10.1007/11762256\_2}, timestamp = {Fri, 25 Dec 2020 01:15:10 +0100}, biburl = {https://dblp.org/rec/conf/esws/Hovy06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icde/ShinHMP06, author = {Hyun Woong Shin and Eduard H. Hovy and Dennis McLeod and Larry Pryor}, editor = {Roger S. Barga and Xiaofang Zhou}, title = {Measuring Generality of Documents}, booktitle = {Proceedings of the 22nd International Conference on Data Engineering Workshops, {ICDE} 2006, 3-7 April 2006, Atlanta, GA, {USA}}, pages = {62}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICDEW.2006.77}, doi = {10.1109/ICDEW.2006.77}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icde/ShinHMP06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iui/FleischmanH06, author = {Michael Fleischman and Eduard H. Hovy}, editor = {C{\'{e}}cile Paris and Candace L. Sidner}, title = {Taking advantage of the situation: non-linguistic context for natural language interfaces to interactive virtual environments}, booktitle = {Proceedings of the 11th International Conference on Intelligent User Interfaces, {IUI} 2006, Sydney, Australia, January 29 - February 1, 2006}, pages = {47--54}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1111449.1111467}, doi = {10.1145/1111449.1111467}, timestamp = {Tue, 06 Nov 2018 11:07:41 +0100}, biburl = {https://dblp.org/rec/conf/iui/FleischmanH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iui/FengSKH06, author = {Donghui Feng and Erin Shaw and Jihie Kim and Eduard H. Hovy}, editor = {C{\'{e}}cile Paris and Candace L. Sidner}, title = {An intelligent discussion-bot for answering student queries in threaded discussions}, booktitle = {Proceedings of the 11th International Conference on Intelligent User Interfaces, {IUI} 2006, Sydney, Australia, January 29 - February 1, 2006}, pages = {171--177}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1111449.1111488}, doi = {10.1145/1111449.1111488}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iui/FengSKH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/RambowDFGHHHLMM06, author = {Owen Rambow and Bonnie J. Dorr and David Farwell and Rebecca Green and Nizar Habash and Stephen Helmreich and Eduard H. Hovy and Lori S. Levin and Keith J. Miller and Teruko Mitamura and Florence Reeder and Advaith Siddharthan}, editor = {Nicoletta Calzolari and Khalid Choukri and Aldo Gangemi and Bente Maegaard and Joseph Mariani and Jan Odijk and Daniel Tapias}, title = {Parallel Syntactic Annotation of Multiple Languages}, booktitle = {Proceedings of the Fifth International Conference on Language Resources and Evaluation, {LREC} 2006, Genoa, Italy, May 22-28, 2006}, pages = {559--564}, publisher = {European Language Resources Association {(ELRA)}}, year = {2006}, url = {http://www.lrec-conf.org/proceedings/lrec2006/summaries/645.html}, timestamp = {Mon, 19 Aug 2019 15:23:22 +0200}, biburl = {https://dblp.org/rec/conf/lrec/RambowDFGHHHLMM06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/ZhouLH06, author = {Liang Zhou and Chin{-}Yew Lin and Eduard H. Hovy}, editor = {Nicoletta Calzolari and Khalid Choukri and Aldo Gangemi and Bente Maegaard and Joseph Mariani and Jan Odijk and Daniel Tapias}, title = {Summarizing Answers for Complicated Questions}, booktitle = {Proceedings of the Fifth International Conference on Language Resources and Evaluation, {LREC} 2006, Genoa, Italy, May 22-28, 2006}, pages = {737--740}, publisher = {European Language Resources Association {(ELRA)}}, year = {2006}, url = {http://www.lrec-conf.org/proceedings/lrec2006/summaries/443.html}, timestamp = {Mon, 19 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lrec/ZhouLH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/HovyLZF06, author = {Eduard H. Hovy and Chin{-}Yew Lin and Liang Zhou and Junichi Fukumoto}, editor = {Nicoletta Calzolari and Khalid Choukri and Aldo Gangemi and Bente Maegaard and Joseph Mariani and Jan Odijk and Daniel Tapias}, title = {Automated Summarization Evaluation with Basic Elements}, booktitle = {Proceedings of the Fifth International Conference on Language Resources and Evaluation, {LREC} 2006, Genoa, Italy, May 22-28, 2006}, pages = {899--902}, publisher = {European Language Resources Association {(ELRA)}}, year = {2006}, url = {http://www.lrec-conf.org/proceedings/lrec2006/summaries/438.html}, timestamp = {Mon, 19 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/lrec/HovyLZF06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/FengSKH06, author = {Donghui Feng and Erin Shaw and Jihie Kim and Eduard H. Hovy}, editor = {Robert C. Moore and Jeff A. Bilmes and Jennifer Chu{-}Carroll and Mark Sanderson}, title = {Learning to Detect Conversation Focus of Threaded Discussions}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 4-9, 2006, New York, New York, {USA}}, publisher = {The Association for Computational Linguistics}, year = {2006}, url = {https://aclanthology.org/N06-1027/}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/naacl/FengSKH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/HovyMPRW06, author = {Eduard H. Hovy and Mitchell P. Marcus and Martha Palmer and Lance A. Ramshaw and Ralph M. Weischedel}, editor = {Robert C. Moore and Jeff A. Bilmes and Jennifer Chu{-}Carroll and Mark Sanderson}, title = {OntoNotes: The 90{\%} Solution}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 4-9, 2006, New York, New York, {USA}}, publisher = {The Association for Computational Linguistics}, year = {2006}, url = {https://aclanthology.org/N06-2015/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/HovyMPRW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/KimH06, author = {Soo{-}Min Kim and Eduard H. Hovy}, editor = {Robert C. Moore and Jeff A. Bilmes and Jennifer Chu{-}Carroll and Mark Sanderson}, title = {Identifying and Analyzing Judgment Opinions}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 4-9, 2006, New York, New York, {USA}}, publisher = {The Association for Computational Linguistics}, year = {2006}, url = {https://aclanthology.org/N06-1026/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/KimH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/ZhouLMH06, author = {Liang Zhou and Chin{-}Yew Lin and Dragos Stefan Munteanu and Eduard H. Hovy}, editor = {Robert C. Moore and Jeff A. Bilmes and Jennifer Chu{-}Carroll and Mark Sanderson}, title = {ParaEval: Using Paraphrases to Evaluate Summaries Automatically}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association of Computational Linguistics, Proceedings, June 4-9, 2006, New York, New York, {USA}}, publisher = {The Association for Computational Linguistics}, year = {2006}, url = {https://aclanthology.org/N06-1057/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/ZhouLMH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tsd/Hovy06, author = {Eduard H. Hovy}, editor = {Petr Sojka and Ivan Kopecek and Karel Pala}, title = {Learning by Reading: An Experiment in Text Analysis}, booktitle = {Text, Speech and Dialogue, 9th International Conference, {TSD} 2006, Brno, Czech Republic, September 11-15, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4188}, pages = {3--12}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11846406\_1}, doi = {10.1007/11846406\_1}, timestamp = {Tue, 14 May 2019 10:00:45 +0200}, biburl = {https://dblp.org/rec/conf/tsd/Hovy06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/computer/PantelPH05, author = {Patrick Pantel and Andrew Philpot and Eduard H. Hovy}, title = {Data Alignment and Integration}, journal = {Computer}, volume = {38}, number = {12}, pages = {43--50}, year = {2005}, url = {https://doi.org/10.1109/MC.2005.406}, doi = {10.1109/MC.2005.406}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/computer/PantelPH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jiis/KhanMH05, author = {Latifur Khan and Dennis McLeod and Eduard H. Hovy}, title = {A Framework for Effective Annotation of Information from Closed Captions Using Ontologies}, journal = {J. Intell. Inf. Syst.}, volume = {25}, number = {2}, pages = {181--205}, year = {2005}, url = {https://doi.org/10.1007/s10844-005-0188-9}, doi = {10.1007/S10844-005-0188-9}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jiis/KhanMH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/ZhouH05, author = {Liang Zhou and Eduard H. Hovy}, editor = {Kevin Knight and Hwee Tou Ng and Kemal Oflazer}, title = {Digesting Virtual "Geek" Culture: The Summarization of Technical Internet Relay Chats}, booktitle = {{ACL} 2005, 43rd Annual Meeting of the Association for Computational Linguistics, Proceedings of the Conference, 25-30 June 2005, University of Michigan, {USA}}, pages = {298--305}, publisher = {The Association for Computer Linguistics}, year = {2005}, url = {https://aclanthology.org/P05-1037/}, doi = {10.3115/1219840.1219877}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/ZhouH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/RavichandranPH05, author = {Deepak Ravichandran and Patrick Pantel and Eduard H. Hovy}, editor = {Kevin Knight and Hwee Tou Ng and Kemal Oflazer}, title = {Randomized Algorithms and {NLP:} Using Locality Sensitive Hash Functions for High Speed Noun Clustering}, booktitle = {{ACL} 2005, 43rd Annual Meeting of the Association for Computational Linguistics, Proceedings of the Conference, 25-30 June 2005, University of Michigan, {USA}}, pages = {622--629}, publisher = {The Association for Computer Linguistics}, year = {2005}, url = {https://aclanthology.org/P05-1077/}, doi = {10.3115/1219840.1219917}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/RavichandranPH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/clin/Hovy05, author = {Eduard H. Hovy}, editor = {Khalil Sima'an and Maarten de Rijke and Remko Scha and Rob van Son}, title = {Toward Large-Scale Shallow Semantics for Higher-Quality {NLP}}, booktitle = {Computational Linguistics in the Netherlands 2005, Proceedings 16th Meeting of Computational Linguistics in the Netherlands, December 16, 2005, University of Amsterdam}, publisher = {Grafisch Centrum Amsterdam}, year = {2005}, timestamp = {Thu, 12 Mar 2020 11:35:19 +0100}, biburl = {https://dblp.org/rec/conf/clin/Hovy05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/ShulmanHCZ05, author = {Stuart W. Shulman and Eduard H. Hovy and Jamie Callan and Stephen Zavestoski}, editor = {Lois M. L. Delcambre and Genevieve Giuliano}, title = {Language processing technologies for electronic rulemaking: a project highlight}, booktitle = {Proceedings of the 2005 National Conference on Digital Government Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005}, series = {{ACM} International Conference Proceeding Series}, volume = {89}, pages = {87--88}, publisher = {Digital Government Research Center}, year = {2005}, url = {http://dl.acm.org/citation.cfm?id=1065248}, timestamp = {Fri, 20 Nov 2015 13:56:21 +0100}, biburl = {https://dblp.org/rec/conf/dgo/ShulmanHCZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/PantelPH05, author = {Patrick Pantel and Andrew Philpot and Eduard H. Hovy}, editor = {Lois M. L. Delcambre and Genevieve Giuliano}, title = {Aligning database columns using mutual information}, booktitle = {Proceedings of the 2005 National Conference on Digital Government Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005}, series = {{ACM} International Conference Proceeding Series}, volume = {89}, pages = {205--210}, publisher = {Digital Government Research Center}, year = {2005}, url = {http://dl.acm.org/citation.cfm?id=1065285}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/PantelPH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/CushingWBDBFSSFHHJLSBGS05, author = {Judith Bayard Cushing and Tyrone Wilson and Alan Borning and Lois M. L. Delcambre and Geoffrey C. Bowker and Mike Frame and John L. Schnase and William Sonntag and J{\'{a}}nos F{\"{u}}l{\"{o}}p and Carol A. Hert and Eduard H. Hovy and Julia Jones and Eric Landis and Charles M. Schweik and Lawrence Brandt and Valerie Gregg and Sylvia Spengler}, editor = {Lois M. L. Delcambre and Genevieve Giuliano}, title = {Eco-informatics and natural resource management}, booktitle = {Proceedings of the 2005 National Conference on Digital Government Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005}, series = {{ACM} International Conference Proceeding Series}, volume = {89}, pages = {211--212}, publisher = {Digital Government Research Center}, year = {2005}, url = {http://dl.acm.org/citation.cfm?id=1065286}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/CushingWBDBFSSFHHJLSBGS05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/PhilpotPH05, author = {Andrew Philpot and Patrick Pantel and Eduard H. Hovy}, editor = {Lois M. L. Delcambre and Genevieve Giuliano}, title = {Significance information for translation: air quality data integration}, booktitle = {Proceedings of the 2005 National Conference on Digital Government Research, {DG.O} 2005, Atlanta, Georgia, USA, May 15-18, 2005}, series = {{ACM} International Conference Proceeding Series}, volume = {89}, pages = {233--234}, publisher = {Digital Government Research Center}, year = {2005}, url = {http://dl.acm.org/citation.cfm?id=1065297}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/PhilpotPH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccs/Hovy05, author = {Eduard H. Hovy}, editor = {Frithjof Dau and Marie{-}Laure Mugnier and Gerd Stumme}, title = {Methodologies for the Reliable Construction of Ontological Knowledge}, booktitle = {Conceptual Structures: Common Semantics for Sharing Knowledge, 13th International Conference on Conceptual Structures, {ICCS} 2005, Kassel, Germany, July 17-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3596}, pages = {91--106}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11524564\_6}, doi = {10.1007/11524564\_6}, timestamp = {Tue, 14 May 2019 10:00:37 +0200}, biburl = {https://dblp.org/rec/conf/iccs/Hovy05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnlp/KimH05, author = {Soo{-}Min Kim and Eduard H. Hovy}, title = {Automatic Detection of Opinion Bearing Words and Sentences}, booktitle = {Natural Language Processing - {IJCNLP} 2005, Second International Joint Conference, Jeju Island, Republic of Korea, October 11-13, 2005 - Companion Volume to the Proceedings of Conference including Posters/Demos and tutorial abstracts}, publisher = {Asian Federation of Natural Language Processing}, year = {2005}, url = {https://aclanthology.org/I05-2011/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcnlp/KimH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcnlp/PhilpotHP05, author = {Andrew Philpot and Eduard H. Hovy and Patrick Pantel}, title = {The Omega Ontology}, booktitle = {Proceedings of OntoLex@IJCNLP 2005 - Ontologies and Lexical Resources, Jeju Island, Korea, October 15, 2005}, publisher = {Asian Federation of Natural Language Processing}, year = {2005}, url = {https://aclanthology.org/I05-7009/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ijcnlp/PhilpotHP05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwpt/BhagatLH05, author = {Rahul Bhagat and Anton Leuski and Eduard H. Hovy}, editor = {Harry Bunt and Robert Malouf and Alon Lavie}, title = {Statistical Shallow Semantic Parsing despite Little Training Data}, booktitle = {Proceedings of the Ninth International Workshop on Parsing Technology, {IWPT} 2005, Vancouver, Canada, October 9-10, 2005}, pages = {186--187}, publisher = {Association for Computational Linguistics}, year = {2005}, url = {https://aclanthology.org/W05-1520/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwpt/BhagatLH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/ZhouSLH05, author = {Liang Zhou and Erin Shaw and Chin{-}Yew Lin and Eduard H. Hovy}, title = {Classummary: Introducing Discussion Summarization to Online Classrooms}, booktitle = {{HLT/EMNLP} 2005, Human Language Technology Conference and Conference on Empirical Methods in Natural Language Processing, Proceedings of the Conference, 6-8 October 2005, Vancouver, British Columbia, Canada}, pages = {4--5}, publisher = {The Association for Computational Linguistics}, year = {2005}, url = {https://aclanthology.org/H05-2003/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/ZhouSLH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/FengH05, author = {Donghui Feng and Eduard H. Hovy}, title = {Handling Biographical Questions with Implicature}, booktitle = {{HLT/EMNLP} 2005, Human Language Technology Conference and Conference on Empirical Methods in Natural Language Processing, Proceedings of the Conference, 6-8 October 2005, Vancouver, British Columbia, Canada}, pages = {596--603}, publisher = {The Association for Computational Linguistics}, year = {2005}, url = {https://aclanthology.org/H05-1075/}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/naacl/FengH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nlucs/FengH05, author = {Donghui Feng and Eduard H. Hovy}, editor = {Bernadette Sharp}, title = {{MRE:} {A} Study on Evolutionary Language Understanding}, booktitle = {Natural Language Understanding and Cognitive Science, Proceedings of the 2nd International Workshop on Natural Language Understanding and Cognitive Science, {NLUCS} 2005, In conjunction with {ICEIS} 2005, Miami, FL, USA, May 2005}, pages = {45--54}, publisher = {{INSTICC} Press}, year = {2005}, timestamp = {Wed, 08 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/nlucs/FengH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigdial/TraumSGMKHNFMBR05, author = {David R. Traum and William R. Swartout and Jonathan Gratch and Stacy Marsella and Patrick G. Kenny and Eduard H. Hovy and Shri Narayanan and Ed Fast and Bilyana Martinovski and Rahul Baghat and Susan Robinson and Andrew Marshall and Dagen Wang and Sudeep Gandhe and Anton Leuski}, editor = {Laila Dybkj{\ae}r and Wolfgang Minker}, title = {Dealing with Doctors: {A} Virtual Human for Non-team Interaction}, booktitle = {Proceedings of the 6th SIGdial Workshop on Discourse and Dialogue, SIGdial 2005, Lisbon, Portugal, 2-3 September 2005}, pages = {232--236}, publisher = {Special Interest Group on Discourse and Dialogue (SIGdial)}, year = {2005}, url = {https://aclanthology.org/2005.sigdial-1.25/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sigdial/TraumSGMKHNFMBR05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ssdbm/PantelPH05, author = {Patrick Pantel and Andrew Philpot and Eduard H. Hovy}, editor = {James Frew}, title = {An Information Theoretic Model for Database Alignment}, booktitle = {17th International Conference on Scientific and Statistical Database Management, {SSDBM} 2005, 27-29 June 2005, University of California, Santa Barbara, CA, USA, Proceedings}, pages = {14--23}, year = {2005}, timestamp = {Tue, 18 Sep 2012 21:15:21 +0200}, biburl = {https://dblp.org/rec/conf/ssdbm/PantelPH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:books/ox/05/FilatovaH05, author = {Elena Filatova and Eduard H. Hovy}, editor = {Inderjeet Mani and James Pustejovsky and Robert J. Gaizauskas}, title = {Assigning Time-Stamps to Event-Clauses}, booktitle = {The Language of Time - {A} Reader}, pages = {523--532}, publisher = {Oxford University Press}, year = {2005}, timestamp = {Thu, 07 May 2020 14:58:21 +0200}, biburl = {https://dblp.org/rec/books/ox/05/FilatovaH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-cs-0501078, author = {Liang Zhou and Miruna Ticrea and Eduard H. Hovy}, title = {Multi-document Biography Summarization}, journal = {CoRR}, volume = {abs/cs/0501078}, year = {2005}, url = {http://arxiv.org/abs/cs/0501078}, eprinttype = {arXiv}, eprint = {cs/0501078}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-cs-0501078.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/vldb/KhanMH04, author = {Latifur Khan and Dennis McLeod and Eduard H. Hovy}, title = {Retrieval effectiveness of an ontology-based model for information selection}, journal = {{VLDB} J.}, volume = {13}, number = {1}, pages = {71--85}, year = {2004}, url = {https://doi.org/10.1007/s00778-003-0105-1}, doi = {10.1007/S00778-003-0105-1}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/vldb/KhanMH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaaifs/SwartoutGHHMRT04, author = {William R. Swartout and Jonathan Gratch and Randall W. Hill Jr. and Eduard H. Hovy and Stacy Marsella and Jeff Rickel and David R. Traum}, title = {Towards Virtual Humans}, booktitle = {Achieving Human-Level Intelligence through Integrated Systems and Research, Papers from the 2004 {AAAI} Fall Symposium. Arlington, VA, USA, October 22-24, 2004}, volume = {{FS-04-01}}, pages = {70--77}, publisher = {{AAAI} Press}, year = {2004}, url = {https://www.aaai.org/Library/Symposia/Fall/2004/fs04-01-012.php}, timestamp = {Fri, 04 Sep 2020 13:38:34 +0200}, biburl = {https://dblp.org/rec/conf/aaaifs/SwartoutGHHMRT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/ReederDFHHHLMMRS04, author = {Florence Reeder and Bonnie J. Dorr and David Farwell and Nizar Habash and Stephen Helmreich and Eduard H. Hovy and Lori S. Levin and Teruko Mitamura and Keith J. Miller and Owen Rambow and Advaith Siddharthan}, editor = {Robert E. Frederking and Kathryn Taylor}, title = {Interlingual Annotation for {MT} Development}, booktitle = {Machine Translation: From Real Users to Research, 6th Conference of the Association for Machine Translation in the Americas, {AMTA} 2004, Washington, DC, USA, September 28-October 2, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3265}, pages = {236--245}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-30194-3\_26}, doi = {10.1007/978-3-540-30194-3\_26}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/ReederDFHHHLMMRS04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/KimH04, author = {Soo{-}Min Kim and Eduard H. Hovy}, title = {Determining the Sentiment of Opinions}, booktitle = {{COLING} 2004, 20th International Conference on Computational Linguistics, Proceedings of the Conference, 23-27 August 2004, Geneva, Switzerland}, year = {2004}, url = {https://aclanthology.org/C04-1200/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/KimH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/KwonFH04, author = {Namhee Kwon and Michael Fleischman and Eduard H. Hovy}, title = {FrameNet-based Semantic Parsing using Maximum Entropy Models}, booktitle = {{COLING} 2004, 20th International Conference on Computational Linguistics, Proceedings of the Conference, 23-27 August 2004, Geneva, Switzerland}, year = {2004}, url = {https://aclanthology.org/C04-1179/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/KwonFH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/PantelRH04, author = {Patrick Pantel and Deepak Ravichandran and Eduard H. Hovy}, title = {Towards Terascale Semantic Acquisition}, booktitle = {{COLING} 2004, 20th International Conference on Computational Linguistics, Proceedings of the Conference, 23-27 August 2004, Geneva, Switzerland}, year = {2004}, url = {https://aclanthology.org/C04-1111/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/PantelRH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/HovyF04, author = {Eduard H. Hovy and Stefan Falke}, editor = {Sharon S. Dawes and Eduard H. Hovy and Lois M. L. Delcambre}, title = {Automating the Integration of Heterogeneous Databases}, booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government Research, {DG.O} 2004, Seattle, WA, USA, 2004}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2004}, url = {http://dl.acm.org/citation.cfm?id=1124199}, timestamp = {Sat, 07 Jul 2018 14:14:53 +0200}, biburl = {https://dblp.org/rec/conf/dgo/HovyF04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/HovyPD04, author = {Eduard H. Hovy and Andrew Philpot and Lei Ding}, editor = {Sharon S. Dawes and Eduard H. Hovy and Lois M. L. Delcambre}, title = {{DGRC} AskCal: {A} Multilingual Question Answering Agent for Heterogeneous Energy Databases}, booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government Research, {DG.O} 2004, Seattle, WA, USA, 2004}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2004}, url = {http://dl.acm.org/citation.cfm?id=1124216}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/HovyPD04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/HovyPD04a, author = {Eduard H. Hovy and Andrew Philpot and Lei Ding}, editor = {Sharon S. Dawes and Eduard H. Hovy and Lois M. L. Delcambre}, title = {Multilingual {DGRC} AskCal: Querying Energy Time Series in English, Spanish, and Mandarin Chinese}, booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government Research, {DG.O} 2004, Seattle, WA, USA, 2004}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2004}, url = {http://dl.acm.org/citation.cfm?id=1124280}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/HovyPD04a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/PhilpotHF04, author = {Andrew Philpot and Eduard H. Hovy and Stefan Falke}, editor = {Sharon S. Dawes and Eduard H. Hovy and Lois M. L. Delcambre}, title = {{EPA-AIR} SIfT: Air Quality Data Integration from Heterogeneous Sources}, booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government Research, {DG.O} 2004, Seattle, WA, USA, 2004}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2004}, url = {http://dl.acm.org/citation.cfm?id=1124229}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/PhilpotHF04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/ShulmanHZC04, author = {Stuart W. Shulman and Eduard H. Hovy and Stephen Zavestoski and Jamie Callan}, editor = {Sharon S. Dawes and Eduard H. Hovy and Lois M. L. Delcambre}, title = {{SGER} Collaborative: {A} Testbed for eRulemaking Data}, booktitle = {Proceedings of the 2004 Annual National Conference on Digital Government Research, {DG.O} 2004, Seattle, WA, USA, 2004}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2004}, url = {http://dl.acm.org/citation.cfm?id=1124305}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/ShulmanHZC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/ZhouTH04, author = {Liang Zhou and Miruna Ticrea and Eduard H. Hovy}, title = {Multi-Document Biography Summarization}, booktitle = {Proceedings of the 2004 Conference on Empirical Methods in Natural Language Processing , {EMNLP} 2004, {A} meeting of SIGDAT, a Special Interest Group of the ACL, held in conjunction with {ACL} 2004, 25-26 July 2004, Barcelona, Spain}, pages = {434--441}, publisher = {{ACL}}, year = {2004}, url = {https://aclanthology.org/W04-3256/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/ZhouTH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/HelmreichFDHLMR04, author = {Stephen Helmreich and David Farwell and Bonnie J. Dorr and Nizar Habash and Lori S. Levin and Teruko Mitamura and Florence Reeder and Keith J. Miller and Eduard H. Hovy and Owen Rambow and Advaith Siddharthan}, title = {Interlingual Annotation of Multilingual Text Corpora}, booktitle = {Proceedings of the Workshop Frontiers in Corpus Annotation@HLT-NAACL 2004, Boston, MA, USA, May 6, 2004}, year = {2004}, url = {https://aclanthology.org/W04-2709/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/HelmreichFDHLMR04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/semeval/KwonFH04, author = {Namhee Kwon and Michael Fleischman and Eduard H. Hovy}, title = {Senseval automatic labeling of semantic roles using Maximum Entropy models}, booktitle = {Proceedings of the Third International Workshop on the Evaluation of Systems for the Semantic Analysis of Text, SENSEVAL@ACL 2004, Barcelona, Spain, July 25-26, 2004}, publisher = {Association for Computational Linguistics}, year = {2004}, url = {https://aclanthology.org/W04-0832/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/semeval/KwonFH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trec/KimRH04, author = {Soo{-}Min Kim and Deepak Ravichandran and Eduard H. Hovy}, editor = {Ellen M. Voorhees and Lori P. Buckland}, title = {{ISI} Novelty Track System for {TREC} 2004}, booktitle = {Proceedings of the Thirteenth Text REtrieval Conference, {TREC} 2004, Gaithersburg, Maryland, USA, November 16-19, 2004}, series = {{NIST} Special Publication}, volume = {500-261}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2004}, url = {http://trec.nist.gov/pubs/trec13/papers/usc-isi.novelty.pdf}, timestamp = {Wed, 07 Jul 2021 16:44:22 +0200}, biburl = {https://dblp.org/rec/conf/trec/KimRH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/dgo/2004, editor = {Sharon S. Dawes and Eduard H. Hovy and Lois M. L. Delcambre}, title = {Proceedings of the 2004 Annual National Conference on Digital Government Research, {DG.O} 2004, Seattle, WA, USA, 2004}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2004}, url = {http://dl.acm.org/citation.cfm?id=1124191}, timestamp = {Sat, 07 Jul 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dgo/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cacm/Hovy03, author = {Eduard H. Hovy}, title = {Using an ontology to simplify data access}, journal = {Commun. {ACM}}, volume = {46}, number = {1}, pages = {47--49}, year = {2003}, url = {https://doi.org/10.1145/602421.602447}, doi = {10.1145/602421.602447}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cacm/Hovy03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03, author = {James Allan and Jay Aslam and Nicholas J. Belkin and Chris Buckley and James P. Callan and W. Bruce Croft and Susan T. Dumais and Norbert Fuhr and Donna Harman and David J. Harper and Djoerd Hiemstra and Thomas Hofmann and Eduard H. Hovy and Wessel Kraaij and John D. Lafferty and Victor Lavrenko and David D. Lewis and Liz Liddy and R. Manmatha and Andrew McCallum and Jay M. Ponte and John M. Prager and Dragomir R. Radev and Philip Resnik and Stephen E. Robertson and Ronald Rosenfeld and Salim Roukos and Mark Sanderson and Richard M. Schwartz and Amit Singhal and Alan F. Smeaton and Howard R. Turtle and Ellen M. Voorhees and Ralph M. Weischedel and Jinxi Xu and ChengXiang Zhai}, title = {Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002}, journal = {{SIGIR} Forum}, volume = {37}, number = {1}, pages = {31--47}, year = {2003}, url = {https://doi.org/10.1145/945546.945549}, doi = {10.1145/945546.945549}, timestamp = {Sun, 22 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/talip/LeuskiLZGOH03, author = {Anton Leuski and Chin{-}Yew Lin and Liang Zhou and Ulrich Germann and Franz Josef Och and Eduard H. Hovy}, title = {Cross-lingual C*ST*RD: English access to Hindi information}, journal = {{ACM} Trans. Asian Lang. Inf. Process.}, volume = {2}, number = {3}, pages = {245--269}, year = {2003}, url = {https://doi.org/10.1145/979872.979877}, doi = {10.1145/979872.979877}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/talip/LeuskiLZGOH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/FleischmanHE03, author = {Michael Fleischman and Eduard H. Hovy and Abdessamad Echihabi}, editor = {Erhard W. Hinrichs and Dan Roth}, title = {Offline Strategies for Online Question Answering: Answering Questions Before They Are Asked}, booktitle = {Proceedings of the 41st Annual Meeting of the Association for Computational Linguistics, 7-12 July 2003, Sapporo Convention Center, Sapporo, Japan}, pages = {1--7}, publisher = {{ACL}}, year = {2003}, url = {https://aclanthology.org/P03-1001/}, doi = {10.3115/1075096.1075097}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/FleischmanHE03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/LeuskiLH03, author = {Anton Leuski and Chin{-}Yew Lin and Eduard H. Hovy}, editor = {Kotaro Funakoshi and Sandra K{\"{u}}bler and Jahna Otterbacher}, title = {iNeATS: Interactive Multi-Document Summarization}, booktitle = {{ACL} 2003, 41st Annual Meeting of the Association for Computational Linguistics, Companion Volume to the Proceedings, 7-12 July 2003, Sapporo Convention Center, Sapporo, Japan}, pages = {125--128}, publisher = {The Association for Computer Linguistics}, year = {2003}, url = {https://aclanthology.org/P03-2021/}, doi = {10.3115/1075178.1075197}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/LeuskiLH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/HovyPKGD03, author = {Eduard H. Hovy and Andrew Philpot and Judith Klavans and Ulrich Germann and Peter T. Davis}, editor = {Yigal Arens and Eduard H. Hovy and Peggy Agouris}, title = {Extending Metadata Definitions by Automatically Extracting and Organizing Glossary Definitions}, booktitle = {Proceedings of the 2003 Annual National Conference on Digital Government Research, {DG.O} 2003, Boston, MA, USA, 2003}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2003}, url = {http://dl.acm.org/citation.cfm?id=1123248}, timestamp = {Sat, 07 Jul 2018 14:14:28 +0200}, biburl = {https://dblp.org/rec/conf/dgo/HovyPKGD03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emnlp/FleischmanKH03, author = {Michael Fleischman and Namhee Kwon and Eduard H. Hovy}, title = {Maximum Entropy Models for FrameNet Classification}, booktitle = {Proceedings of the Conference on Empirical Methods in Natural Language Processing, {EMNLP} 2003, Sapporo, Japan, July 11-12, 2003}, year = {2003}, url = {https://aclanthology.org/W03-1007/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/emnlp/FleischmanKH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iui/FleischmanH03, author = {Michael Fleischman and Eduard H. Hovy}, editor = {David B. Leake and W. Lewis Johnson and Elisabeth Andr{\'{e}}}, title = {Recommendations without user preferences: a natural language processing approach}, booktitle = {Proceedings of the 8th International Conference on Intelligent User Interfaces, {IUI} 2003, Miami, FL, USA, January 12-15, 2003}, pages = {242--244}, publisher = {{ACM}}, year = {2003}, url = {https://doi.org/10.1145/604045.604087}, doi = {10.1145/604045.604087}, timestamp = {Sat, 30 Sep 2023 09:51:13 +0200}, biburl = {https://dblp.org/rec/conf/iui/FleischmanH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mtsummit/DienHH03, author = {Dinh Dien and Kiem Hoang and Eduard H. Hovy}, title = {{BTL:} a hybrid model for English-Vietnamese machine translation}, booktitle = {Proceedings of Machine Translation Summit {IX:} Papers, MTSummit 2003, New Orleans, USA, September 18-22, 2003}, year = {2003}, url = {https://aclanthology.org/2003.mtsummit-papers.12}, timestamp = {Mon, 20 Sep 2021 17:44:13 +0200}, biburl = {https://dblp.org/rec/conf/mtsummit/DienHH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mtsummit/KingPH03, author = {Margaret King and Andrei Popescu{-}Belis and Eduard H. Hovy}, title = {{FEMTI:} creating and using a framework for {MT} evaluation}, booktitle = {Proceedings of Machine Translation Summit {IX:} Papers, MTSummit 2003, New Orleans, USA, September 18-22, 2003}, year = {2003}, url = {https://aclanthology.org/2003.mtsummit-papers.30}, timestamp = {Mon, 20 Sep 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mtsummit/KingPH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/FleischmanH03, author = {Michael Fleischman and Eduard H. Hovy}, editor = {Marti A. Hearst and Mari Ostendorf}, title = {A Maximum Entropy Approach to FrameNet Tagging}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association for Computational Linguistics, {HLT-NAACL} 2003, Edmonton, Canada, May 27 - June 1, 2003}, publisher = {The Association for Computational Linguistics}, year = {2003}, url = {https://aclanthology.org/N03-2008/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/FleischmanH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/LinH03, author = {Chin{-}Yew Lin and Eduard H. Hovy}, editor = {Marti A. Hearst and Mari Ostendorf}, title = {Automatic Evaluation of Summaries Using N-gram Co-occurrence Statistics}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association for Computational Linguistics, {HLT-NAACL} 2003, Edmonton, Canada, May 27 - June 1, 2003}, publisher = {The Association for Computational Linguistics}, year = {2003}, url = {https://aclanthology.org/N03-1020/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/LinH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/ZhouH03, author = {Liang Zhou and Eduard H. Hovy}, editor = {Marti A. Hearst and Mari Ostendorf}, title = {A Web-Trained Extraction Summarization System}, booktitle = {Human Language Technology Conference of the North American Chapter of the Association for Computational Linguistics, {HLT-NAACL} 2003, Edmonton, Canada, May 27 - June 1, 2003}, publisher = {The Association for Computational Linguistics}, year = {2003}, url = {https://aclanthology.org/N03-1037/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/ZhouH03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trec/EchihabiHHMMR03, author = {Abdessamad Echihabi and Ulf Hermjakob and Eduard H. Hovy and Daniel Marcu and Eric Melz and Deepak Ravichandran}, editor = {Ellen M. Voorhees and Lori P. Buckland}, title = {Multiple-Engine Question Answering in TextMap}, booktitle = {Proceedings of The Twelfth Text REtrieval Conference, {TREC} 2003, Gaithersburg, Maryland, USA, November 18-21, 2003}, series = {{NIST} Special Publication}, volume = {500-255}, pages = {772--781}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2003}, url = {http://trec.nist.gov/pubs/trec12/papers/usc-isi.qa.pdf}, timestamp = {Wed, 07 Jul 2021 16:44:22 +0200}, biburl = {https://dblp.org/rec/conf/trec/EchihabiHHMMR03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/dgo/2003, editor = {Yigal Arens and Eduard H. Hovy and Peggy Agouris}, title = {Proceedings of the 2003 Annual National Conference on Digital Government Research, {DG.O} 2003, Boston, MA, USA, 2003}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2003}, url = {http://dl.acm.org/citation.cfm?id=1123196}, timestamp = {Sat, 07 Jul 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dgo/2003.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/coling/RadevHM02, author = {Dragomir R. Radev and Eduard H. Hovy and Kathleen R. McKeown}, title = {Introduction to the Special Issue on Summarization}, journal = {Comput. Linguistics}, volume = {28}, number = {4}, pages = {399--408}, year = {2002}, url = {https://doi.org/10.1162/089120102762671927}, doi = {10.1162/089120102762671927}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/coling/RadevHM02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mt/HovyKP02, author = {Eduard H. Hovy and Margaret King and Andrei Popescu{-}Belis}, title = {Principles of Context-Based Machine Translation Evaluation}, journal = {Mach. Transl.}, volume = {17}, number = {1}, pages = {43--75}, year = {2002}, url = {https://doi.org/10.1023/A:1025510524115}, doi = {10.1023/A:1025510524115}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/mt/HovyKP02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/RavichandranH02, author = {Deepak Ravichandran and Eduard H. Hovy}, title = {Learning surface text patterns for a Question Answering System}, booktitle = {Proceedings of the 40th Annual Meeting of the Association for Computational Linguistics, July 6-12, 2002, Philadelphia, PA, {USA}}, pages = {41--47}, publisher = {{ACL}}, year = {2002}, url = {https://aclanthology.org/P02-1006/}, doi = {10.3115/1073083.1073092}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/RavichandranH02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/LinH02, author = {Chin{-}Yew Lin and Eduard H. Hovy}, title = {From Single to Multi-document Summarization}, booktitle = {Proceedings of the 40th Annual Meeting of the Association for Computational Linguistics, July 6-12, 2002, Philadelphia, PA, {USA}}, pages = {457--464}, publisher = {{ACL}}, year = {2002}, url = {https://aclanthology.org/P02-1058/}, doi = {10.3115/1073083.1073160}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/LinH02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/FleischmanH02, author = {Michael Fleischman and Eduard H. Hovy}, title = {Fine Grained Classification of Named Entities}, booktitle = {19th International Conference on Computational Linguistics, {COLING} 2002, Howard International House and Academia Sinica, Taipei, Taiwan, August 24 - September 1, 2002}, year = {2002}, url = {https://aclanthology.org/C02-1130/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/FleischmanH02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/HovyHLR02, author = {Eduard H. Hovy and Ulf Hermjakob and Chin{-}Yew Lin and Deepak Ravichandran}, title = {Using Knowledge to Facilitate Factoid Answer Pinpointing}, booktitle = {19th International Conference on Computational Linguistics, {COLING} 2002, Howard International House and Academia Sinica, Taipei, Taiwan, August 24 - September 1, 2002}, year = {2002}, url = {https://aclanthology.org/C02-1042/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/HovyHLR02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/AmbiteABDHKPPRSSTZ02, author = {Jos{\'{e}} Luis Ambite and Yigal Arens and Walter Bourne and Peter T. Davis and Eduard H. Hovy and Judith L. Klavans and Andrew Philpot and Samuel D. Popper and Kenneth A. Ross and Ju{-}Ling Shih and Peter Sommer and Surabhan Temiyabutr and Laura Zadoff}, title = {A Portal for Access to Complex Distributed Information about Energy}, booktitle = {Proceedings of the 2002 Annual National Conference on Digital Government Research, {DG.O} 2002, Los Angeles, CA, USA, 2002}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2002}, url = {http://dl.acm.org/citation.cfm?id=1123161}, timestamp = {Sat, 07 Jul 2018 14:13:59 +0200}, biburl = {https://dblp.org/rec/conf/dgo/AmbiteABDHKPPRSSTZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/PhilpotAH02, author = {Andrew Philpot and Jos{\'{e}} Luis Ambite and Eduard H. Hovy}, title = {{DGRC} AskCal: Natural Language Question Answering for Energy Time Series}, booktitle = {Proceedings of the 2002 Annual National Conference on Digital Government Research, {DG.O} 2002, Los Angeles, CA, USA, 2002}, series = {{ACM} International Conference Proceeding Series}, publisher = {Digital Government Research Center}, year = {2002}, url = {http://dl.acm.org/citation.cfm?id=1123122}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/PhilpotAH02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/inlg/FleischmanH02, author = {Michael Fleischman and Eduard H. Hovy}, title = {Towards Emotional Variation in Speech-Based Natural Language Processing}, booktitle = {Proceedings of the International Natural Language Generation Conference, Harriman, New York, USA, July 2002}, pages = {57--64}, publisher = {Association for Computational Linguistics}, year = {2002}, url = {https://aclanthology.org/W02-2108/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/inlg/FleischmanH02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/HovyKP02, author = {Eduard H. Hovy and Margaret King and Andrei Popescu{-}Belis}, title = {Computer-Aided Specification of Quality Models for Machine Translation Evaluation}, booktitle = {Proceedings of the Third International Conference on Language Resources and Evaluation, {LREC} 2002, May 29-31, 2002, Las Palmas, Canary Islands, Spain}, publisher = {European Language Resources Association}, year = {2002}, url = {http://www.lrec-conf.org/proceedings/lrec2002/sumarios/5.htm}, timestamp = {Mon, 19 Aug 2019 15:23:48 +0200}, biburl = {https://dblp.org/rec/conf/lrec/HovyKP02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pricai/Hovy02, author = {Eduard H. Hovy}, editor = {Mitsuru Ishizuka and Abdul Sattar}, title = {Learning, Collecting, and Using Ontological Knowledge for {NLP}}, booktitle = {{PRICAI} 2002: Trends in Artificial Intelligence, 7th Pacific Rim International Conference on Artificial Intelligence, Tokyo, Japan, August 18-22, 2002, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {2417}, pages = {6}, publisher = {Springer}, year = {2002}, url = {https://doi.org/10.1007/3-540-45683-X\_2}, doi = {10.1007/3-540-45683-X\_2}, timestamp = {Tue, 14 May 2019 10:00:46 +0200}, biburl = {https://dblp.org/rec/conf/pricai/Hovy02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/ads/AmbiteABFGHHKPRRSSSSSTWZ02, author = {Jos{\'{e}} Luis Ambite and Yigal Arens and Walter Bourne and Steven Feiner and Luis Gravano and Vasileios Hatzivassiloglou and Eduard H. Hovy and Judith Klavans and Andrew Philpot and Usha Ramachandran and Kenneth A. Ross and Jay Sandhaus and Deniz Sari{\"{o}}z and Rolfe R. Schmidt and Cyrus Shahabi and Anurag Singla and Surabhan Temiyabutr and Brian Whitman and Kazi A. Zaman}, editor = {William J. McIver Jr. and Ahmed K. Elmagarmid}, title = {Data Integration and Access - The Digital Government Research Center's Energy Data Collection {(EDC)} Project}, booktitle = {Advances in Digital Government - Technology, Human Factors, and Policy}, series = {Advances in Database Systems}, volume = {26}, pages = {85--106}, publisher = {Springer}, year = {2002}, url = {https://doi.org/10.1007/0-306-47374-7\_5}, doi = {10.1007/0-306-47374-7\_5}, timestamp = {Tue, 16 May 2017 14:24:24 +0200}, biburl = {https://dblp.org/rec/series/ads/AmbiteABFGHHKPRRSSSSSTWZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/computer/AmbiteAHPGHK01, author = {Jos{\'{e}} Luis Ambite and Yigal Arens and Eduard H. Hovy and Andrew Philpot and Luis Gravano and Vasileios Hatzivassiloglou and Judith Klavans}, title = {Simplifying Data Access: The Energy Data Collection Project}, journal = {Computer}, volume = {34}, number = {2}, pages = {47--54}, year = {2001}, url = {https://doi.org/10.1109/2.901167}, doi = {10.1109/2.901167}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/computer/AmbiteAHPGHK01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/lre/FrederkingHI01, author = {Robert E. Frederking and Eduard H. Hovy and Nancy Ide}, title = {Introduction to the Special Issue on Multi-Lingual Information Management}, journal = {Comput. Humanit.}, volume = {35}, number = {4}, pages = {369--370}, year = {2001}, url = {https://doi.org/10.1023/A:1011854206510}, doi = {10.1023/A:1011854206510}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/lre/FrederkingHI01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/HovyGHLR01, author = {Eduard H. Hovy and Laurie Gerber and Ulf Hermjakob and Chin{-}Yew Lin and Deepak Ravichandran}, title = {Toward Semantics-Based Answer Pinpointing}, booktitle = {Proceedings of the First International Conference on Human Language Technology Research, {HLT} 2001, San Diego, California, USA, March 18-21, 2001}, publisher = {Morgan Kaufmann}, year = {2001}, url = {https://aclanthology.org/H01-1069/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/HovyGHLR01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trec/HovyHL01, author = {Eduard H. Hovy and Ulf Hermjakob and Chin{-}Yew Lin}, editor = {Ellen M. Voorhees and Donna K. Harman}, title = {The Use of External Knowledge of Factoid {QA}}, booktitle = {Proceedings of The Tenth Text REtrieval Conference, {TREC} 2001, Gaithersburg, Maryland, USA, November 13-16, 2001}, series = {{NIST} Special Publication}, volume = {500-250}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2001}, url = {http://trec.nist.gov/pubs/trec10/papers/TREC10-webclopedia.pdf}, timestamp = {Wed, 07 Jul 2021 16:44:22 +0200}, biburl = {https://dblp.org/rec/conf/trec/HovyHL01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/ijcai/2001ol, editor = {Alexander Maedche and Steffen Staab and Claire Nedellec and Eduard H. Hovy}, title = {IJCAI'2001 Workshop on Ontology Learning, Proceedings of the Second Workshop on Ontology Learning OL'2001, Seattle, USA, August 4, 2001 (Held in conjunction with the 17th International Conference on Artificial Intelligence IJCAI'2001)}, series = {{CEUR} Workshop Proceedings}, volume = {38}, publisher = {CEUR-WS.org}, year = {2001}, url = {https://ceur-ws.org/Vol-38}, urn = {urn:nbn:de:0074-38-3}, timestamp = {Fri, 10 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ijcai/2001ol.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/cs-CL-0109031, author = {Eneko Agirre and Olatz Ansa and Eduard H. Hovy and David Mart{\'{\i}}nez}, title = {Enriching WordNet concepts with topic signatures}, journal = {CoRR}, volume = {cs.CL/0109031}, year = {2001}, url = {https://arxiv.org/abs/cs/0109031}, timestamp = {Fri, 10 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/cs-CL-0109031.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/coling/LinH00, author = {Chin{-}Yew Lin and Eduard H. Hovy}, title = {The Automated Acquisition of Topic Signatures for Text Summarization}, booktitle = {{COLING} 2000, 18th International Conference on Computational Linguistics, Proceedings of the Conference, 2 Volumes, July 31 - August 4, 2000, Universit{\"{a}}t des Saarlandes, Saarbr{\"{u}}cken, Germany}, pages = {495--501}, publisher = {Morgan Kaufmann}, year = {2000}, url = {https://aclanthology.org/C00-1072/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/coling/LinH00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/AmbiteAGHHKPRSSW00, author = {Jos{\'{e}} Luis Ambite and Yigal Arens and Luis Gravano and Vasileios Hatzivassiloglou and Eduard H. Hovy and Judith L. Klavans and Andrew Philpot and Usha Ramachandran and Jay Sandhaus and Anurag Singla and Brian Whitman}, title = {Simplifying data access: the energy data collection {(EDC)} project}, booktitle = {Proceedings of the 2000 National Conference on Digital Government Research, {DG.O} 2000, Los Angeles, CA, USA, May 15-17, 2000}, series = {{ACM} International Conference Proceeding Series}, volume = {128}, publisher = {Digital Government Research Center}, year = {2000}, url = {http://dl.acm.org/citation.cfm?id=1123091}, timestamp = {Sat, 07 Jul 2018 14:17:09 +0200}, biburl = {https://dblp.org/rec/conf/dgo/AmbiteAGHHKPRSSW00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dgo/HovyK00, author = {Eduard H. Hovy and Judith L. Klavans}, title = {The energy data collection project}, booktitle = {Proceedings of the 2000 National Conference on Digital Government Research, {DG.O} 2000, Los Angeles, CA, USA, May 15-17, 2000}, series = {{ACM} International Conference Proceeding Series}, volume = {128}, publisher = {Digital Government Research Center}, year = {2000}, url = {http://dl.acm.org/citation.cfm?id=1123080}, timestamp = {Fri, 20 Nov 2015 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dgo/HovyK00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ecai/AgirreAHM00, author = {Eneko Agirre and Olatz Ansa and Eduard H. Hovy and David Mart{\'{\i}}nez}, editor = {Steffen Staab and Alexander Maedche and Claire Nedellec and Peter M. Wiemer{-}Hastings}, title = {Enriching very large ontologies using the {WWW}}, booktitle = {ECAI'2000 Workshop on Ontology Learning, Proceedings of the First Workshop on Ontology Learning OL'2000, Berlin, Germany, August 25, 2000. Held in conjunction with the 14th European Conference on Artificial Intelligence ECAI'2000, Berlin, Germany}, series = {{CEUR} Workshop Proceedings}, volume = {31}, publisher = {CEUR-WS.org}, year = {2000}, url = {https://ceur-ws.org/Vol-31/EAgirre\_14.pdf}, timestamp = {Fri, 10 Mar 2023 16:22:14 +0100}, biburl = {https://dblp.org/rec/conf/ecai/AgirreAHM00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trec/HovyGHJL00, author = {Eduard H. Hovy and Laurie Gerber and Ulf Hermjakob and Michael Junk and Chin{-}Yew Lin}, editor = {Ellen M. Voorhees and Donna K. Harman}, title = {Question Answering in Webclopedia}, booktitle = {Proceedings of The Ninth Text REtrieval Conference, {TREC} 2000, Gaithersburg, Maryland, USA, November 13-16, 2000}, series = {{NIST} Special Publication}, volume = {500-249}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2000}, url = {http://trec.nist.gov/pubs/trec9/papers/webclopedia.pdf}, timestamp = {Wed, 07 Jul 2021 16:44:22 +0200}, biburl = {https://dblp.org/rec/conf/trec/HovyGHJL00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/cs-CL-0010026, author = {Eneko Agirre and Olatz Ansa and Eduard H. Hovy and David Mart{\'{\i}}nez}, title = {Enriching very large ontologies using the {WWW}}, journal = {CoRR}, volume = {cs.CL/0010026}, year = {2000}, url = {https://arxiv.org/abs/cs/0010026}, timestamp = {Fri, 10 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/cs-CL-0010026.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/GreenCKSCRHHHFOS99, author = {Nancy L. Green and Jennifer Chu{-}Carroll and David Kortenkamp and Alan C. Schultz and Michael H. Coen and Dragomir R. Radev and Eduard H. Hovy and Peter Haddawy and Steve Hanks and Eugene C. Freuder and Charlie Ortiz and Sandip Sen}, title = {The {AAAI} Spring Symposia}, journal = {{AI} Mag.}, volume = {20}, number = {3}, pages = {83--86}, year = {1999}, url = {https://doi.org/10.1609/aimag.v20i3.1469}, doi = {10.1609/AIMAG.V20I3.1469}, timestamp = {Mon, 22 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/aim/GreenCKSCRHHHFOS99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mtsummit/KingHTWZ99, author = {Margaret King and Eduard H. Hovy and Benjamin K. Tsou and John White and Yusoff Zaharin}, title = {{MT} evaluation}, booktitle = {Proceedings of Machine Translation Summit VII, MTSummit 1999, Singapore, September 13-17, 1999}, pages = {197--207}, year = {1999}, url = {https://aclanthology.org/1999.mtsummit-1.31}, timestamp = {Mon, 20 Sep 2021 17:44:14 +0200}, biburl = {https://dblp.org/rec/conf/mtsummit/KingHTWZ99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/GerberH98, author = {Laurie Gerber and Eduard H. Hovy}, editor = {David Farwell and Laurie Gerber and Eduard H. Hovy}, title = {Improving Translation Quality by Manipulating Sentence Length}, booktitle = {Machine Translation and the Information Soup, Third Conference of the Association for Machine Translation in the Americas, {AMTA} '98, Langhorne, PA, USA, October 28-31, 1998, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1529}, pages = {448--460}, publisher = {Springer}, year = {1998}, url = {https://doi.org/10.1007/3-540-49478-2\_40}, doi = {10.1007/3-540-49478-2\_40}, timestamp = {Tue, 14 May 2019 10:00:54 +0200}, biburl = {https://dblp.org/rec/conf/amta/GerberH98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/lrec/Hovy98, author = {Eduard H. Hovy}, title = {Combining and standardizing large- scale, practical ontologies for machine tranlation and other uses}, booktitle = {Proceedings of the First International Conference on Language Resources and Evaluation, {LREC} 1998, May 28-30, 1998, Granada, Spain}, pages = {535--542}, publisher = {European Language Resources Association}, year = {1998}, timestamp = {Fri, 25 Jun 2021 14:29:28 +0200}, biburl = {https://dblp.org/rec/conf/lrec/Hovy98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/tipster/HovyL98, author = {Eduard H. Hovy and Chin{-}Yew Lin}, title = {Automated Text Summarization and the {SUMMARIST} System}, booktitle = {{TIPSTER} {TEXT} {PROGRAM} {PHASE} {III:} Proceedings of a Workshop held at Baltimore, MD, USA, October 13-15, 1998}, pages = {197--214}, publisher = {Morgan Kaufmann}, year = {1998}, url = {https://aclanthology.org/X98-1026/}, doi = {10.3115/1119089.1119121}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/tipster/HovyL98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/amta/1998, editor = {David Farwell and Laurie Gerber and Eduard H. Hovy}, title = {Machine Translation and the Information Soup, Third Conference of the Association for Machine Translation in the Americas, {AMTA} '98, Langhorne, PA, USA, October 28-31, 1998, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1529}, publisher = {Springer}, year = {1998}, url = {https://doi.org/10.1007/3-540-49478-2}, doi = {10.1007/3-540-49478-2}, isbn = {3-540-65259-0}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/1998.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/anlp/LinH97, author = {Chin{-}Yew Lin and Eduard H. Hovy}, title = {Identifying Topics by Position}, booktitle = {5th Applied Natural Language Processing Conference, {ANLP} 1997, Marriott Hotel, Washington, USA, March 31 - April 3, 1997}, pages = {283--290}, publisher = {{ACL}}, year = {1997}, url = {https://aclanthology.org/A97-1042/}, doi = {10.3115/974557.974599}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/anlp/LinH97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/HovyCGLMNW96, author = {Eduard H. Hovy and Kenneth Church and Denis Gachot and Marge Leon and Alan K. Melby and Sergei Nirenburg and Yorick Wilks}, title = {Panel: The limits of automation: optimists vs skeptics}, booktitle = {Conference of the Association for Machine Translation in the Americas, {AMTA} 1996, Montreal, Canada, October 2-5, 1996}, year = {1996}, url = {https://aclanthology.org/1996.amta-1.24/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/HovyCGLMNW96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/KnightACHLWY96, author = {Kevin Knight and Yaser Al{-}Onaizan and Ishwar Chander and Eduard H. Hovy and Irene Langkilde and Richard Whitney and Kenji Yamada}, title = {{JAPANGLOSS:} using statistics to fill knowledge gaps}, booktitle = {Conference of the Association for Machine Translation in the Americas, {AMTA} 1996, Montreal, Canada, October 2-5, 1996}, year = {1996}, url = {https://aclanthology.org/1996.amta-1.31/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/KnightACHLWY96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/inlg/DalianisH96, author = {Hercules Dalianis and Eduard H. Hovy}, title = {On Lexical Aggregation and Ordering}, booktitle = {Eighth International Natural Language Generation Workshop, {INLG} 1996, Herstmonceux Castle, Sussex, UK, June 12-15, 1996 - Posters and Demonstrations}, year = {1996}, url = {https://aclanthology.org/W96-0508/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/inlg/DalianisH96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/inlg/WannerH96, author = {Leo Wanner and Eduard H. Hovy}, title = {The HealthDoc Sentence Planner}, booktitle = {Eighth International Natural Language Generation Workshop, {INLG} 1996, Herstmonceux Castle, Sussex, UK, June 12-15, 1996}, year = {1996}, url = {https://aclanthology.org/W96-0401/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/inlg/WannerH96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/SmedtHMM95, author = {Koenraad De Smedt and Eduard H. Hovy and David D. McDonald and Marie Meteer}, title = {The Seventh International Workshop on Natural Language Generation}, journal = {{AI} Mag.}, volume = {16}, number = {3}, pages = {67--68}, year = {1995}, url = {https://doi.org/10.1609/aimag.v16i3.1150}, doi = {10.1609/AIMAG.V16I3.1150}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aim/SmedtHMM95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/air/ArensH95, author = {Yigal Arens and Eduard H. Hovy}, title = {The Design of a Model-Based Multimedia Interaction Manager}, journal = {Artif. Intell. Rev.}, volume = {9}, number = {2-3}, pages = {167--188}, year = {1995}, url = {https://doi.org/10.1007/BF00849178}, doi = {10.1007/BF00849178}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/air/ArensH95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/KnightCHHHILWY95, author = {Kevin Knight and Ishwar Chander and Matthew Haines and Vasileios Hatzivassiloglou and Eduard H. Hovy and Masayo Iida and Steve K. Luk and Richard Whitney and Kenji Yamada}, title = {Filling Knowledge Gaps in a Broad-Coverage Machine Translation System}, booktitle = {Proceedings of the Fourteenth International Joint Conference on Artificial Intelligence, {IJCAI} 95, Montr{\'{e}}al Qu{\'{e}}bec, Canada, August 20-25 1995, 2 Volumes}, pages = {1390--1397}, publisher = {Morgan Kaufmann}, year = {1995}, url = {http://ijcai.org/Proceedings/95-2/Papers/048.pdf}, timestamp = {Tue, 20 Aug 2019 16:17:30 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/KnightCHHHILWY95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-cmp-lg-9506009, author = {Kevin Knight and Ishwar Chander and Matthew Haines and Vasileios Hatzivassiloglou and Eduard H. Hovy and Masayo Iida and Steve K. Luk and Richard Whitney and Kenji Yamada}, title = {Filling Knowledge Gaps in a Broad-Coverage Machine Translation System}, journal = {CoRR}, volume = {abs/cmp-lg/9506009}, year = {1995}, url = {http://arxiv.org/abs/cmp-lg/9506009}, eprinttype = {arXiv}, eprint = {cmp-lg/9506009}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-cmp-lg-9506009.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/CarbonellFFHHKL94, author = {Jaime G. Carbonell and David Farwell and Robert E. Frederking and Stephen Helmreich and Eduard H. Hovy and Kevin Knight and Lori S. Levin and Sergei Nirenburg}, title = {{PANGLOSS}}, booktitle = {Proceedings of the First Conference of the Association for Machine Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA, October 5-8, 1994}, year = {1994}, url = {https://aclanthology.org/1994.amta-1.41/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/CarbonellFFHHKL94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/ChurchDHNST94, author = {Kenneth Church and Bonnie J. Dorr and Eduard H. Hovy and Sergei Nirenburg and Bernard Scott and Virginia Teller}, title = {Is {MT} Research Doing Any Good?}, booktitle = {Proceedings of the First Conference of the Association for Machine Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA, October 5-8, 1994}, year = {1994}, url = {https://aclanthology.org/1994.amta-1.27/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/ChurchDHNST94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/FrederkingNFHHK94, author = {Robert E. Frederking and Sergei Nirenburg and David Farwell and Stephen Helmreich and Eduard H. Hovy and Kevin Knight and Stephen Beale and Constantino Domashnev and Donalee Attardo and Dean Grannes and Ralf D. Brown}, title = {Integrating Translations from Multiple Sources within the {PANGLOSS} Mark {III} Machine Translation System}, booktitle = {Proceedings of the First Conference of the Association for Machine Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA, October 5-8, 1994}, year = {1994}, url = {https://aclanthology.org/1994.amta-1.10/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/FrederkingNFHHK94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/KnightCHHHILOWY94, author = {Kevin Knight and Ishwar Chander and Matthew Haines and Vasileios Hatzivassiloglou and Eduard H. Hovy and Masayo Iida and Steve K. Luk and Akitoshi Okumura and Richard Whitney and Kenji Yamada}, title = {Integrating Knowledge Bases and Statistics in {MT}}, booktitle = {Proceedings of the First Conference of the Association for Machine Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA, October 5-8, 1994}, year = {1994}, url = {https://aclanthology.org/1994.amta-1.18/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/KnightCHHHILOWY94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amta/OkumuraH94, author = {Akitoshi Okumura and Eduard H. Hovy}, title = {Lexicon-to-Ontology Concept Association Using a Bilingual Dictionary}, booktitle = {Proceedings of the First Conference of the Association for Machine Translation in the Americas, {AMTA} 1994, Columbia, Maryland, USA, October 5-8, 1994}, year = {1994}, url = {https://aclanthology.org/1994.amta-1.23/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/amta/OkumuraH94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/inlg/LavidH94, author = {Julia Lavid and Eduard H. Hovy}, title = {Toward a Multidimensional Framework to Guide the Automated Generation of Text Types}, booktitle = {Proceedings of the Seventh International Workshop on Natural Language Generation, {INLG} 1994, Kennebunkport, Maine, USA, June 21-24, 1994}, year = {1994}, url = {https://aclanthology.org/W94-0328/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/inlg/LavidH94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Hovy94, author = {Eduard H. Hovy}, title = {Session 4: Machine Translation}, booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro, New Jerey, USA, March 8-11, 1994}, publisher = {Morgan Kaufmann}, year = {1994}, url = {https://aclanthology.org/H94-1023/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Hovy94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Hovy94a, author = {Eduard H. Hovy}, title = {{PANGLOSS:} Knowledge-Based Machine Translation}, booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro, New Jerey, USA, March 8-11, 1994}, publisher = {Morgan Kaufmann}, year = {1994}, url = {https://aclanthology.org/H94-1121/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Hovy94a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/OkumuraH94, author = {Akitoshi Okumura and Eduard H. Hovy}, title = {Building Japanese-English Dictionary based on Ontology for Machine Translation}, booktitle = {Human Language Technology, Proceedings of a Workshop held at Plainsboro, New Jerey, USA, March 8-11, 1994}, publisher = {Morgan Kaufmann}, year = {1994}, url = {https://aclanthology.org/H94-1025/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/OkumuraH94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/KnightCHHHILOWY94, author = {Kevin Knight and Ishwar Chander and Matthew Haines and Vasileios Hatzivassiloglou and Eduard H. Hovy and Masayo Iida and Steve K. Luk and Akitoshi Okumura and Richard Whitney and Kenji Yamada}, title = {Integrating Knowledge Bases and Statistics in {MT}}, journal = {CoRR}, volume = {abs/cmp-lg/9409001}, year = {1994}, url = {http://arxiv.org/abs/cmp-lg/9409001}, eprinttype = {arXiv}, eprint = {cmp-lg/9409001}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/KnightCHHHILOWY94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ai/Hovy93, author = {Eduard H. Hovy}, title = {Automated Discourse Generation Using Discourse Structure Relations}, journal = {Artif. Intell.}, volume = {63}, number = {1-2}, pages = {341--385}, year = {1993}, url = {https://doi.org/10.1016/0004-3702(93)90021-3}, doi = {10.1016/0004-3702(93)90021-3}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ai/Hovy93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mt/ChurchH93, author = {Kenneth Ward Church and Eduard H. Hovy}, title = {Good applications for crummy machine translation}, journal = {Mach. Transl.}, volume = {8}, number = {4}, pages = {239--258}, year = {1993}, url = {https://doi.org/10.1007/BF00981759}, doi = {10.1007/BF00981759}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/mt/ChurchH93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ewnlg/DalianisH93, author = {Hercules Dalianis and Eduard H. Hovy}, editor = {Giovanni Adorni and Michael Zock}, title = {Aggregation in Natural Language Generation}, booktitle = {Trends in Natural Language Generation, An Artificial Intelligence Perspective, Fourth European Workshop, {EWNLG} '93, Pisa, Italy, April 28-30, 1993, Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {1036}, pages = {88--105}, publisher = {Springer}, year = {1993}, url = {https://doi.org/10.1007/3-540-60800-1\_25}, doi = {10.1007/3-540-60800-1\_25}, timestamp = {Tue, 14 May 2019 10:00:49 +0200}, biburl = {https://dblp.org/rec/conf/ewnlg/DalianisH93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/ArensHM93, author = {Yigal Arens and Eduard H. Hovy and Susanne van Mulken}, editor = {Ruzena Bajcsy}, title = {Structure and Rules in Automated Multimedia Presentation Planning}, booktitle = {Proceedings of the 13th International Joint Conference on Artificial Intelligence. Chamb{\'{e}}ry, France, August 28 - September 3, 1993}, pages = {1253--1261}, publisher = {Morgan Kaufmann}, year = {1993}, timestamp = {Tue, 20 Aug 2019 16:18:33 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/ArensHM93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Hovy93, author = {Eduard H. Hovy}, title = {The {PENMAN} Project on Knowledge-Based Machine Translation}, booktitle = {Human Language Technology: Proceedings of a Workshop Held at Plainsboro, New Jersey, USA, March 21-24, 1993}, publisher = {Morgan Kaufmann}, year = {1993}, url = {https://aclanthology.org/H93-1115/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Hovy93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/expert/Hovy92, author = {Eduard H. Hovy}, title = {A New Level of Language Generation Technology: Capabilities and Possibilities}, journal = {{IEEE} Expert}, volume = {7}, number = {2}, pages = {12--17}, year = {1992}, url = {https://doi.org/10.1109/64.129278}, doi = {10.1109/64.129278}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/expert/Hovy92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Hovy92, author = {Eduard H. Hovy}, title = {In-Depth Knowledge-Based Machine Translation}, booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman, New York, USA, February 23-26, 1992}, publisher = {Morgan Kaufmann}, year = {1992}, url = {https://aclanthology.org/H92-1124/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Hovy92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/HovyN92, author = {Eduard H. Hovy and Sergei Nirenburg}, title = {Approximating an Interlingua in a Principled Way}, booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Harriman, New York, USA, February 23-26, 1992}, publisher = {Morgan Kaufmann}, year = {1992}, url = {https://aclanthology.org/H92-1052/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/HovyN92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nlg/HovyLMMP92, author = {Eduard H. Hovy and Julia Lavid and Elisabeth Maier and Vibhu O. Mittal and C{\'{e}}cile Paris}, editor = {Robert Dale and Eduard H. Hovy and Dietmar F. R{\"{o}}sner and Oliviero Stock}, title = {Employing Knowledge Resources in a New Text Planner Architecture}, booktitle = {Aspects of Automated Natural Language Generation, 6th International Workshop on Natural Language Generation, Trento, Italy, April 5-7, 1992, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {587}, pages = {57--72}, publisher = {Springer}, year = {1992}, url = {https://doi.org/10.1007/3-540-55399-1\_5}, doi = {10.1007/3-540-55399-1\_5}, timestamp = {Tue, 14 May 2019 10:00:54 +0200}, biburl = {https://dblp.org/rec/conf/nlg/HovyLMMP92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nlg/HovyKMNR92, author = {Eduard H. Hovy and Richard I. Kittredge and Christian Matthiessen and Sergei Nirenburg and Dietmar F. R{\"{o}}sner}, editor = {Robert Dale and Eduard H. Hovy and Dietmar F. R{\"{o}}sner and Oliviero Stock}, title = {Multilinguality and Generation}, booktitle = {Aspects of Automated Natural Language Generation, 6th International Workshop on Natural Language Generation, Trento, Italy, April 5-7, 1992, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {587}, pages = {293--308}, publisher = {Springer}, year = {1992}, url = {https://doi.org/10.1007/3-540-55399-1\_24}, doi = {10.1007/3-540-55399-1\_24}, timestamp = {Sat, 20 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/nlg/HovyKMNR92.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/nlg/1992, editor = {Robert Dale and Eduard H. Hovy and Dietmar F. R{\"{o}}sner and Oliviero Stock}, title = {Aspects of Automated Natural Language Generation, 6th International Workshop on Natural Language Generation, Trento, Italy, April 5-7, 1992, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {587}, publisher = {Springer}, year = {1992}, url = {https://doi.org/10.1007/3-540-55399-1}, doi = {10.1007/3-540-55399-1}, isbn = {3-540-55399-1}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/nlg/1992.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/HovyA91, author = {Eduard H. Hovy and Yigal Arens}, editor = {Thomas L. Dean and Kathleen R. McKeown}, title = {Automatic Generation of Formatted Text}, booktitle = {Proceedings of the 9th National Conference on Artificial Intelligence, Anaheim, CA, USA, July 14-19, 1991, Volume 1}, pages = {92--97}, publisher = {{AAAI} Press / The {MIT} Press}, year = {1991}, url = {http://www.aaai.org/Library/AAAI/1991/aaai91-015.php}, timestamp = {Mon, 04 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aaai/HovyA91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/ArensHV91, author = {Yigal Arens and Eduard H. Hovy and Mira Vossers}, editor = {Mark T. Maybury}, title = {On the Knowledge Underlying Multimedia Presentations}, booktitle = {Intelligent Multimedia Interfaces, the book is an outgrowth of the {AAAI} Workshop on Intelligent Multimedia Interfaces, Anaheim, CA, USA, August, 1991}, pages = {280--306}, publisher = {{AAAI} Press / The {MIT} Press}, year = {1991}, timestamp = {Fri, 23 Dec 2011 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/aaai/ArensHV91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Hovy91, author = {Eduard H. Hovy}, title = {The Penman Natural Language Project Systemics-Based Machine Translation}, booktitle = {Speech and Natural Language, Proceedings of a Workshop held at Pacific Grove, California, USA, February 19-22. 1991}, publisher = {Morgan Kaufmann}, year = {1991}, url = {https://aclanthology.org/H91-1106/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Hovy91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ai/Hovy90, author = {Eduard H. Hovy}, title = {Pragmatics and Natural Language Generation}, journal = {Artif. Intell.}, volume = {43}, number = {2}, pages = {153--197}, year = {1990}, url = {https://doi.org/10.1016/0004-3702(90)90084-D}, doi = {10.1016/0004-3702(90)90084-D}, timestamp = {Wed, 07 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ai/Hovy90.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/inlg/Hovy90, author = {Eduard H. Hovy}, title = {Parsimonious and Profligate Approaches to the Question of Discourse Structure Relations}, booktitle = {Proceedings of the Fifth International Workshop on Natural Language Generation, {INLG} 1990, Dawson, Pennsylvania, USA, June 3-6, 1990}, publisher = {{ACL}}, year = {1990}, url = {https://aclanthology.org/W90-0117/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/inlg/Hovy90.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/KasperH90, author = {Robert T. Kasper and Eduard H. Hovy}, title = {Performing Integrated Syntactic and Semantic Parsing Using Classification}, booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Hidden Valley, Pennsylvania, USA, June 24-27, 1990}, publisher = {Morgan Kaufmann}, year = {1990}, url = {https://aclanthology.org/H90-1011/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/KasperH90.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/WilksCFHN90, author = {Yorick Wilks and Jaime G. Carbonell and David Farwell and Eduard H. Hovy and Sergei Nirenburg}, title = {Machine Translation Again?}, booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Hidden Valley, Pennsylvania, USA, June 24-27, 1990}, publisher = {Morgan Kaufmann}, year = {1990}, url = {https://aclanthology.org/H90-1072/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/WilksCFHN90.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/aim/HovyMY89, author = {Eduard H. Hovy and David D. McDonald and Sheryl R. Young}, title = {Current Issues in Natural Language Generation: An Overview of the {AAAI} Workshop on Text Planning and Realization}, journal = {{AI} Mag.}, volume = {10}, number = {3}, pages = {27--29}, year = {1989}, url = {https://doi.org/10.1609/aimag.v10i3.760}, doi = {10.1609/AIMAG.V10I3.760}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/aim/HovyMY89.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Hovy89, author = {Eduard H. Hovy}, title = {New Possibilities in Machine Translation}, booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Cape Cod, Massachusetts, USA, {HLT} 1989, October 15-18, 1989}, publisher = {{ACL}}, year = {1989}, url = {https://aclanthology.org/H89-2015/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Hovy89.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/Hovy89a, author = {Eduard H. Hovy}, title = {The Current Status of the Penman Language Generation System}, booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Cape Cod, Massachusetts, USA, {HLT} 1989, October 15-18, 1989}, publisher = {{ACL}}, year = {1989}, url = {https://aclanthology.org/H89-2065/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/Hovy89a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/MannH89, author = {William C. Mann and Eduard H. Hovy}, title = {The Penman Language Generation Project}, booktitle = {Speech and Natural Language: Proceedings of a Workshop Held at Philadelphia, USA, {HLT} 1989, February 21-23, 1989}, publisher = {{ACL}}, year = {1989}, url = {https://aclanthology.org/H89-1021/}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/naacl/MannH89.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/Hovy88, author = {Eduard H. Hovy}, editor = {Jerry R. Hobbs}, title = {Planning Coherent Multisentential Text}, booktitle = {26th Annual Meeting of the Association for Computational Linguistics, 7-10 June 1988, State Univerity of New York at Buffalo, Buffalo, New York, USA, Proceedings}, pages = {163--169}, publisher = {{ACL}}, year = {1988}, url = {https://aclanthology.org/P88-1020/}, doi = {10.3115/982023.982043}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/Hovy88.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acl/Hovy88a, author = {Eduard H. Hovy}, editor = {Jerry R. Hobbs}, title = {Two Types of Planning in Language Generation}, booktitle = {26th Annual Meeting of the Association for Computational Linguistics, 7-10 June 1988, State Univerity of New York at Buffalo, Buffalo, New York, USA, Proceedings}, pages = {179--186}, publisher = {{ACL}}, year = {1988}, url = {https://aclanthology.org/P88-1022/}, doi = {10.3115/982023.982045}, timestamp = {Fri, 06 Aug 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acl/Hovy88a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/Hovy87, author = {Eduard H. Hovy}, editor = {Kenneth D. Forbus and Howard E. Shrobe}, title = {Interpretation in Generation}, booktitle = {Proceedings of the 6th National Conference on Artificial Intelligence. Seattle, WA, USA, July 1987}, pages = {545--549}, publisher = {Morgan Kaufmann}, year = {1987}, url = {http://www.aaai.org/Library/AAAI/1987/aaai87-097.php}, timestamp = {Mon, 04 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aaai/Hovy87.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ijcai/Hovy85, author = {Eduard H. Hovy}, editor = {Aravind K. Joshi}, title = {Integrating Text Planning and Production in Generation}, booktitle = {Proceedings of the 9th International Joint Conference on Artificial Intelligence. Los Angeles, CA, USA, August 1985}, pages = {848--851}, publisher = {Morgan Kaufmann}, year = {1985}, url = {http://ijcai.org/Proceedings/85-2/Papers/032.pdf}, timestamp = {Tue, 20 Aug 2019 16:19:04 +0200}, biburl = {https://dblp.org/rec/conf/ijcai/Hovy85.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.