Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: Dragomir R. Radev
@inproceedings{DBLP:conf/aaai/WuRL23,
author = {Fang Wu and
Dragomir Radev and
Stan Z. Li},
editor = {Brian Williams and
Yiling Chen and
Jennifer Neville},
title = {Molformer: Motif-Based Transformer on 3D Heterogeneous Molecular Graphs},
booktitle = {Thirty-Seventh {AAAI} Conference on Artificial Intelligence, {AAAI}
2023, Thirty-Fifth Conference on Innovative Applications of Artificial
Intelligence, {IAAI} 2023, Thirteenth Symposium on Educational Advances
in Artificial Intelligence, {EAAI} 2023, Washington, DC, USA, February
7-14, 2023},
pages = {5312--5320},
publisher = {{AAAI} Press},
year = {2023},
url = {https://doi.org/10.1609/aaai.v37i4.25662},
doi = {10.1609/AAAI.V37I4.25662},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/WuRL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiFRY23,
author = {Irene Li and
Aosong Feng and
Dragomir Radev and
Rex Ying},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {HiPool: Modeling Long Documents Using Graph Neural Networks},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 2: Short Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {161--171},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-short.16},
doi = {10.18653/V1/2023.ACL-SHORT.16},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LiFRY23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhaoMQNGCR23,
author = {Yilun Zhao and
Boyu Mi and
Zhenting Qi and
Linyong Nan and
Minghao Guo and
Arman Cohan and
Dragomir Radev},
editor = {Danushka Bollegala and
Ruihong Huang and
Alan Ritter},
title = {OpenRT: An Open-source Framework for Reasoning Over Tabular Data},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics: System Demonstrations, {ACL} 2023, Toronto, Canada, July
10-12, 2023},
pages = {336--347},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-demo.32},
doi = {10.18653/V1/2023.ACL-DEMO.32},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhaoMQNGCR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/WangHDHSMARG23,
author = {Borui Wang and
Qiuyuan Huang and
Budhaditya Deb and
Aaron Halfaker and
Liqun Shao and
Daniel McDuff and
Ahmed Hassan Awadallah and
Dragomir Radev and
Jianfeng Gao},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {Logical Transformers: Infusing Logical Structures into Pre-Trained
Language Models},
booktitle = {Findings of the Association for Computational Linguistics: {ACL} 2023,
Toronto, Canada, July 9-14, 2023},
pages = {1762--1773},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-acl.111},
doi = {10.18653/V1/2023.FINDINGS-ACL.111},
timestamp = {Thu, 11 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/WangHDHSMARG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiuFLZNHHJWXR23,
author = {Yixin Liu and
Alexander R. Fabbri and
Pengfei Liu and
Yilun Zhao and
Linyong Nan and
Ruilin Han and
Simeng Han and
Shafiq Joty and
Chien{-}Sheng Wu and
Caiming Xiong and
Dragomir Radev},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {Revisiting the Gold Standard: Grounding Summarization Evaluation with
Robust Human Evaluation},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {4140--4170},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.228},
doi = {10.18653/V1/2023.ACL-LONG.228},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LiuFLZNHHJWXR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhaoZNQZTMR23,
author = {Yilun Zhao and
Chen Zhao and
Linyong Nan and
Zhenting Qi and
Wenlin Zhang and
Xiangru Tang and
Boyu Mi and
Dragomir Radev},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {RobuT: {A} Systematic Study of Table {QA} Robustness Against Human-Annotated
Adversarial Perturbations},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {6064--6081},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.334},
doi = {10.18653/V1/2023.ACL-LONG.334},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhaoZNQZTMR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HardalovAMASOSK23,
author = {Momchil Hardalov and
Pepa Atanasova and
Todor Mihaylov and
Galia Angelova and
Kiril Simov and
Petya Osenova and
Veselin Stoyanov and
Ivan Koychev and
Preslav Nakov and
Dragomir Radev},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {bgGLUE: {A} Bulgarian General Language Understanding Evaluation Benchmark},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {8733--8759},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.487},
doi = {10.18653/V1/2023.ACL-LONG.487},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HardalovAMASOSK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/YongSMAAABSKBWB23,
author = {Zheng Xin Yong and
Hailey Schoelkopf and
Niklas Muennighoff and
Alham Fikri Aji and
David Ifeoluwa Adelani and
Khalid Almubarak and
M. Saiful Bari and
Lintang Sutawika and
Jungo Kasai and
Ahmed Baruwa and
Genta Indra Winata and
Stella Biderman and
Edward Raff and
Dragomir Radev and
Vassilina Nikoulina},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {{BLOOM+1:} Adding Language Support to {BLOOM} for Zero-Shot Prompting},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {11682--11703},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.653},
doi = {10.18653/V1/2023.ACL-LONG.653},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/YongSMAAABSKBWB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiuDTHRA23,
author = {Yixin Liu and
Budhaditya Deb and
Milagro Teruel and
Aaron Halfaker and
Dragomir Radev and
Ahmed Hassan Awadallah},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {On Improving Summarization Factual Consistency from Natural Language
Feedback},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {15144--15161},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.844},
doi = {10.18653/V1/2023.ACL-LONG.844},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LiuDTHRA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/MuennighoffWSRB23,
author = {Niklas Muennighoff and
Thomas Wang and
Lintang Sutawika and
Adam Roberts and
Stella Biderman and
Teven Le Scao and
M. Saiful Bari and
Sheng Shen and
Zheng Xin Yong and
Hailey Schoelkopf and
Xiangru Tang and
Dragomir Radev and
Alham Fikri Aji and
Khalid Almubarak and
Samuel Albanie and
Zaid Alyafeai and
Albert Webson and
Edward Raff and
Colin Raffel},
editor = {Anna Rogers and
Jordan L. Boyd{-}Graber and
Naoaki Okazaki},
title = {Crosslingual Generalization through Multitask Finetuning},
booktitle = {Proceedings of the 61st Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2023, Toronto, Canada,
July 9-14, 2023},
pages = {15991--16111},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.acl-long.891},
doi = {10.18653/V1/2023.ACL-LONG.891},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/MuennighoffWSRB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bea/LiGFLCKZYHR23,
author = {Irene Li and
Thomas George and
Alexander R. Fabbri and
Tammy Liao and
Benjamin Chen and
Rina Kawamura and
Richard Zhou and
Vanessa Yan and
Swapnil Hingmire and
Dragomir Radev},
editor = {Ekaterina Kochmar and
Jill Burstein and
Andrea Horbach and
Ronja Laarmann{-}Quante and
Nitin Madnani and
Ana{\"{\i}}s Tack and
Victoria Yaneva and
Zheng Yuan and
Torsten Zesch},
title = {A Transfer Learning Pipeline for Educational Resource Discovery with
Application in Survey Generation},
booktitle = {Proceedings of the 18th Workshop on Innovative Use of {NLP} for Building
Educational Applications, BEA@ACL 2023, Toronto, Canada, 13 July 2023},
pages = {29--43},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.bea-1.3},
doi = {10.18653/V1/2023.BEA-1.3},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bea/LiGFLCKZYHR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eacl/ZhaoQNFR23,
author = {Yilun Zhao and
Zhenting Qi and
Linyong Nan and
Lorenzo Jaime Yu Flores and
Dragomir Radev},
editor = {Andreas Vlachos and
Isabelle Augenstein},
title = {LoFT: Enhancing Faithfulness and Diversity for Table-to-Text Generation
via Logic Form Control},
booktitle = {Proceedings of the 17th Conference of the European Chapter of the
Association for Computational Linguistics, {EACL} 2023, Dubrovnik,
Croatia, May 2-6, 2023},
pages = {554--561},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.eacl-main.40},
doi = {10.18653/V1/2023.EACL-MAIN.40},
timestamp = {Thu, 05 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/eacl/ZhaoQNFR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/0001QNMLZHCTXRC23,
author = {Yilun Zhao and
Zhenting Qi and
Linyong Nan and
Boyu Mi and
Yixin Liu and
Weijin Zou and
Simeng Han and
Ruizhe Chen and
Xiangru Tang and
Yumo Xu and
Dragomir Radev and
Arman Cohan},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {QTSumm: Query-Focused Summarization over Tabular Data},
booktitle = {Proceedings of the 2023 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2023, Singapore, December 6-10, 2023},
pages = {1157--1172},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.emnlp-main.74},
doi = {10.18653/V1/2023.EMNLP-MAIN.74},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/0001QNMLZHCTXRC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiuYMRXJZ23,
author = {Ye Liu and
Semih Yavuz and
Rui Meng and
Dragomir Radev and
Caiming Xiong and
Shafiq Joty and
Yingbo Zhou},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {{HPE:} Answering Complex Questions over Text by Hybrid Question Parsing
and Execution},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {4437--4451},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.293},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.293},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LiuYMRXJZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/Nan0ZRTZCR23,
author = {Linyong Nan and
Yilun Zhao and
Weijin Zou and
Narutatsu Ri and
Jaesung Tae and
Ellen Zhang and
Arman Cohan and
Dragomir Radev},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Enhancing Text-to-SQL Capabilities of Large Language Models: {A} Study
on Prompt Design Strategies},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2023, Singapore, December 6-10, 2023},
pages = {14935--14956},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.findings-emnlp.996},
doi = {10.18653/V1/2023.FINDINGS-EMNLP.996},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/Nan0ZRTZCR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiuF0LJWXR23,
author = {Yixin Liu and
Alexander R. Fabbri and
Yilun Zhao and
Pengfei Liu and
Shafiq Joty and
Chien{-}Sheng Wu and
Caiming Xiong and
Dragomir Radev},
editor = {Houda Bouamor and
Juan Pino and
Kalika Bali},
title = {Towards Interpretable and Efficient Automatic Reference-Based Summarization
Evaluation},
booktitle = {Proceedings of the 2023 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2023, Singapore, December 6-10, 2023},
pages = {16360--16368},
publisher = {Association for Computational Linguistics},
year = {2023},
url = {https://doi.org/10.18653/v1/2023.emnlp-main.1018},
doi = {10.18653/V1/2023.EMNLP-MAIN.1018},
timestamp = {Fri, 12 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LiuF0LJWXR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/ChengX0LNHXROZS23,
author = {Zhoujun Cheng and
Tianbao Xie and
Peng Shi and
Chengzu Li and
Rahul Nadkarni and
Yushi Hu and
Caiming Xiong and
Dragomir Radev and
Mari Ostendorf and
Luke Zettlemoyer and
Noah A. Smith and
Tao Yu},
title = {Binding Language Models in Symbolic Languages},
booktitle = {The Eleventh International Conference on Learning Representations,
{ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/pdf?id=lH1PV42cbF},
timestamp = {Fri, 30 Jun 2023 14:38:38 +0200},
biburl = {https://dblp.org/rec/conf/iclr/ChengX0LNHXROZS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/NiIWPMRG23,
author = {Ansong Ni and
Jeevana Priya Inala and
Chenglong Wang and
Alex Polozov and
Christopher Meek and
Dragomir Radev and
Jianfeng Gao},
title = {Learning Math Reasoning from Self-Sampled Correct and Partially-Correct
Solutions},
booktitle = {The Eleventh International Conference on Learning Representations,
{ICLR} 2023, Kigali, Rwanda, May 1-5, 2023},
publisher = {OpenReview.net},
year = {2023},
url = {https://openreview.net/pdf?id=4D4TSJE6-K},
timestamp = {Thu, 11 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iclr/NiIWPMRG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/Ni0RSYWL23,
author = {Ansong Ni and
Srini Iyer and
Dragomir Radev and
Veselin Stoyanov and
Wen{-}Tau Yih and
Sida I. Wang and
Xi Victoria Lin},
editor = {Andreas Krause and
Emma Brunskill and
Kyunghyun Cho and
Barbara Engelhardt and
Sivan Sabato and
Jonathan Scarlett},
title = {{LEVER:} Learning to Verify Language-to-Code Generation with Execution},
booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
2023, Honolulu, Hawaii, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {202},
pages = {26106--26128},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v202/ni23b.html},
timestamp = {Mon, 28 Aug 2023 17:23:08 +0200},
biburl = {https://dblp.org/rec/conf/icml/Ni0RSYWL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icml/WuLJJRNL23,
author = {Fang Wu and
Siyuan Li and
Xurui Jin and
Yinghui Jiang and
Dragomir Radev and
Zhangming Niu and
Stan Z. Li},
editor = {Andreas Krause and
Emma Brunskill and
Kyunghyun Cho and
Barbara Engelhardt and
Sivan Sabato and
Jonathan Scarlett},
title = {Rethinking Explaining Graph Neural Networks via Non-parametric Subgraph
Matching},
booktitle = {International Conference on Machine Learning, {ICML} 2023, 23-29 July
2023, Honolulu, Hawaii, {USA}},
series = {Proceedings of Machine Learning Research},
volume = {202},
pages = {37511--37523},
publisher = {{PMLR}},
year = {2023},
url = {https://proceedings.mlr.press/v202/wu23j.html},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/icml/WuLJJRNL23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/KasaiST0A0RS0I23,
author = {Jungo Kasai and
Keisuke Sakaguchi and
Yoichi Takahashi and
Ronan Le Bras and
Akari Asai and
Xinyan Yu and
Dragomir Radev and
Noah A. Smith and
Yejin Choi and
Kentaro Inui},
editor = {Alice Oh and
Tristan Naumann and
Amir Globerson and
Kate Saenko and
Moritz Hardt and
Sergey Levine},
title = {RealTime {QA:} What's the Answer Right Now?},
booktitle = {Advances in Neural Information Processing Systems 36: Annual Conference
on Neural Information Processing Systems 2023, NeurIPS 2023, New Orleans,
LA, USA, December 10 - 16, 2023},
year = {2023},
url = {http://papers.nips.cc/paper\_files/paper/2023/hash/9941624ef7f867a502732b5154d30cb7-Abstract-Datasets\_and\_Benchmarks.html},
timestamp = {Fri, 01 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/nips/KasaiST0A0RS0I23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2301-02780,
author = {Fang Wu and
Siyuan Li and
Lirong Wu and
Dragomir Radev and
Yinghui Jiang and
Xurui Jin and
Zhangming Niu and
Stan Z. Li},
title = {Explaining Graph Neural Networks via Non-parametric Subgraph Matching},
journal = {CoRR},
volume = {abs/2301.02780},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2301.02780},
doi = {10.48550/ARXIV.2301.02780},
eprinttype = {arXiv},
eprint = {2301.02780},
timestamp = {Tue, 10 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2301-02780.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-02962,
author = {Yilun Zhao and
Zhenting Qi and
Linyong Nan and
Lorenzo Jaime Yu Flores and
Dragomir Radev},
title = {LoFT: Enhancing Faithfulness and Diversity for Table-to-Text Generation
via Logic Form Control},
journal = {CoRR},
volume = {abs/2302.02962},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.02962},
doi = {10.48550/ARXIV.2302.02962},
eprinttype = {arXiv},
eprint = {2302.02962},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-02962.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-08468,
author = {Ansong Ni and
Srini Iyer and
Dragomir Radev and
Ves Stoyanov and
Wen{-}tau Yih and
Sida I. Wang and
Xi Victoria Lin},
title = {{LEVER:} Learning to Verify Language-to-Code Generation with Execution},
journal = {CoRR},
volume = {abs/2302.08468},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.08468},
doi = {10.48550/ARXIV.2302.08468},
eprinttype = {arXiv},
eprint = {2302.08468},
timestamp = {Tue, 09 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-08468.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-12433,
author = {Zhangir Azerbayev and
Bartosz Piotrowski and
Hailey Schoelkopf and
Edward W. Ayers and
Dragomir Radev and
Jeremy Avigad},
title = {ProofNet: Autoformalizing and Formally Proving Undergraduate-Level
Mathematics},
journal = {CoRR},
volume = {abs/2302.12433},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2302.12433},
doi = {10.48550/ARXIV.2302.12433},
eprinttype = {arXiv},
eprint = {2302.12433},
timestamp = {Tue, 28 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2302-12433.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-03608,
author = {Yixin Liu and
Alexander R. Fabbri and
Yilun Zhao and
Pengfei Liu and
Shafiq R. Joty and
Chien{-}Sheng Wu and
Caiming Xiong and
Dragomir Radev},
title = {Towards Interpretable and Efficient Automatic Reference-Based Summarization
Evaluation},
journal = {CoRR},
volume = {abs/2303.03608},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.03608},
doi = {10.48550/ARXIV.2303.03608},
eprinttype = {arXiv},
eprint = {2303.03608},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-03608.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-18027,
author = {Jungo Kasai and
Yuhei Kasai and
Keisuke Sakaguchi and
Yutaro Yamada and
Dragomir Radev},
title = {Evaluating {GPT-4} and ChatGPT on Japanese Medical Licensing Examinations},
journal = {CoRR},
volume = {abs/2303.18027},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2303.18027},
doi = {10.48550/ARXIV.2303.18027},
eprinttype = {arXiv},
eprint = {2303.18027},
timestamp = {Mon, 17 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2303-18027.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-03319,
author = {Irene Li and
Aosong Feng and
Dragomir Radev and
Rex Ying},
title = {HiPool: Modeling Long Documents Using Graph Neural Networks},
journal = {CoRR},
volume = {abs/2305.03319},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.03319},
doi = {10.48550/ARXIV.2305.03319},
eprinttype = {arXiv},
eprint = {2305.03319},
timestamp = {Wed, 10 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-03319.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-07789,
author = {Ye Liu and
Semih Yavuz and
Rui Meng and
Dragomir Radev and
Caiming Xiong and
Yingbo Zhou},
title = {Answering Complex Questions over Text by Hybrid Question Parsing and
Execution},
journal = {CoRR},
volume = {abs/2305.07789},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.07789},
doi = {10.48550/ARXIV.2305.07789},
eprinttype = {arXiv},
eprint = {2305.07789},
timestamp = {Wed, 17 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-07789.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-12586,
author = {Linyong Nan and
Yilun Zhao and
Weijin Zou and
Narutatsu Ri and
Jaesung Tae and
Ellen Zhang and
Arman Cohan and
Dragomir Radev},
title = {Enhancing Few-shot Text-to-SQL Capabilities of Large Language Models:
{A} Study on Prompt Design Strategies},
journal = {CoRR},
volume = {abs/2305.12586},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.12586},
doi = {10.48550/ARXIV.2305.12586},
eprinttype = {arXiv},
eprint = {2305.12586},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-12586.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-14239,
author = {Yixin Liu and
Alexander R. Fabbri and
Pengfei Liu and
Dragomir Radev and
Arman Cohan},
title = {On Learning to Summarize with Large Language Models as References},
journal = {CoRR},
volume = {abs/2305.14239},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.14239},
doi = {10.48550/ARXIV.2305.14239},
eprinttype = {arXiv},
eprint = {2305.14239},
timestamp = {Mon, 05 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-14239.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2305-14303,
author = {Yilun Zhao and
Zhenting Qi and
Linyong Nan and
Boyu Mi and
Yixin Liu and
Weijin Zou and
Simeng Han and
Xiangru Tang and
Yumo Xu and
Arman Cohan and
Dragomir Radev},
title = {QTSumm: {A} New Benchmark for Query-Focused Table Summarization},
journal = {CoRR},
volume = {abs/2305.14303},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2305.14303},
doi = {10.48550/ARXIV.2305.14303},
eprinttype = {arXiv},
eprint = {2305.14303},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2305-14303.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-02349,
author = {Momchil Hardalov and
Pepa Atanasova and
Todor Mihaylov and
Galia Angelova and
Kiril Simov and
Petya Osenova and
Ves Stoyanov and
Ivan Koychev and
Preslav Nakov and
Dragomir Radev},
title = {bgGLUE: {A} Bulgarian General Language Understanding Evaluation Benchmark},
journal = {CoRR},
volume = {abs/2306.02349},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.02349},
doi = {10.48550/ARXIV.2306.02349},
eprinttype = {arXiv},
eprint = {2306.02349},
timestamp = {Tue, 13 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-02349.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-14321,
author = {Yilun Zhao and
Chen Zhao and
Linyong Nan and
Zhenting Qi and
Wenlin Zhang and
Xiangru Tang and
Boyu Mi and
Dragomir Radev},
title = {RobuT: {A} Systematic Study of Table {QA} Robustness Against Human-Annotated
Adversarial Perturbations},
journal = {CoRR},
volume = {abs/2306.14321},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2306.14321},
doi = {10.48550/ARXIV.2306.14321},
eprinttype = {arXiv},
eprint = {2306.14321},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2306-14321.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2309-17446,
author = {Ansong Ni and
Pengcheng Yin and
Yilun Zhao and
Martin Riddell and
Troy Feng and
Rui Shen and
Stephen Yin and
Ye Liu and
Semih Yavuz and
Caiming Xiong and
Shafiq Joty and
Yingbo Zhou and
Dragomir Radev and
Arman Cohan},
title = {L2CEval: Evaluating Language-to-Code Generation Capabilities of Large
Language Models},
journal = {CoRR},
volume = {abs/2309.17446},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2309.17446},
doi = {10.48550/ARXIV.2309.17446},
eprinttype = {arXiv},
eprint = {2309.17446},
timestamp = {Tue, 17 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2309-17446.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-07884,
author = {Yusen Zhang and
Nan Zhang and
Yixin Liu and
Alexander R. Fabbri and
Junru Liu and
Ryo Kamoi and
Xiaoxin Lu and
Caiming Xiong and
Jieyu Zhao and
Dragomir Radev and
Kathleen R. McKeown and
Rui Zhang},
title = {Fair Abstractive Summarization of Diverse Perspectives},
journal = {CoRR},
volume = {abs/2311.07884},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.07884},
doi = {10.48550/ARXIV.2311.07884},
eprinttype = {arXiv},
eprint = {2311.07884},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-07884.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-09184,
author = {Yixin Liu and
Alexander R. Fabbri and
Jiawen Chen and
Yilun Zhao and
Simeng Han and
Shafiq Joty and
Pengfei Liu and
Dragomir Radev and
Chien{-}Sheng Wu and
Arman Cohan},
title = {Benchmarking Generation and Evaluation Capabilities of Large Language
Models for Instruction Controllable Summarization},
journal = {CoRR},
volume = {abs/2311.09184},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.09184},
doi = {10.48550/ARXIV.2311.09184},
eprinttype = {arXiv},
eprint = {2311.09184},
timestamp = {Tue, 21 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-09184.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-16588,
author = {Rui Yang and
Qingcheng Zeng and
Keen You and
Yujie Qiao and
Lucas Huang and
Chiachun Hsieh and
Benjamin Rosand and
Jeremy Goldwasser and
Amisha D. Dave and
Tiarnan D. L. Keenan and
Emily Y. Chew and
Dragomir Radev and
Zhiyong Lu and
Hua Xu and
Qingyu Chen and
Irene Li},
title = {MedGen: {A} Python Natural Language Processing Toolkit for Medical
Text Processing},
journal = {CoRR},
volume = {abs/2311.16588},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2311.16588},
doi = {10.48550/ARXIV.2311.16588},
eprinttype = {arXiv},
eprint = {2311.16588},
timestamp = {Mon, 04 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2311-16588.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csr/LiPGVWNRLZCTKR22,
author = {Irene Li and
Jessica Pan and
Jeremy Goldwasser and
Neha Verma and
Wai Pan Wong and
Muhammed Yavuz Nuzumlali and
Benjamin Rosand and
Yixin Li and
Matthew Zhang and
David Chang and
Richard Andrew Taylor and
Harlan M. Krumholz and
Dragomir Radev},
title = {Neural Natural Language Processing for unstructured data in electronic
health records: {A} review},
journal = {Comput. Sci. Rev.},
volume = {46},
pages = {100511},
year = {2022},
url = {https://doi.org/10.1016/j.cosrev.2022.100511},
doi = {10.1016/J.COSREV.2022.100511},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/csr/LiPGVWNRLZCTKR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/NanHMLVZKSKTMRT22,
author = {Linyong Nan and
Chiachun Hsieh and
Ziming Mao and
Xi Victoria Lin and
Neha Verma and
Rui Zhang and
Wojciech Kryscinski and
Hailey Schoelkopf and
Riley Kong and
Xiangru Tang and
Mutethia Mutuma and
Ben Rosand and
Isabel Trindade and
Renusree Bandaru and
Jacob Cunningham and
Caiming Xiong and
Dragomir R. Radev},
title = {FeTaQA: Free-form Table Question Answering},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {10},
pages = {35--49},
year = {2022},
url = {https://doi.org/10.1162/tacl\_a\_00446},
doi = {10.1162/TACL\_A\_00446},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tacl/NanHMLVZKSKTMRT22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/BachSYWRNSKBFAD22,
author = {Stephen H. Bach and
Victor Sanh and
Zheng Xin Yong and
Albert Webson and
Colin Raffel and
Nihal V. Nayak and
Abheesht Sharma and
Taewoon Kim and
M. Saiful Bari and
Thibault F{\'{e}}vry and
Zaid Alyafeai and
Manan Dey and
Andrea Santilli and
Zhiqing Sun and
Srulik Ben{-}David and
Canwen Xu and
Gunjan Chhablani and
Han Wang and
Jason Alan Fries and
Maged Saeed AlShaibani and
Shanya Sharma and
Urmish Thakker and
Khalid Almubarak and
Xiangru Tang and
Dragomir R. Radev and
Mike Tian{-}Jian Jiang and
Alexander M. Rush},
editor = {Valerio Basile and
Zornitsa Kozareva and
Sanja Stajner},
title = {PromptSource: An Integrated Development Environment and Repository
for Natural Language Prompts},
booktitle = {Proceedings of the 60th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2022 - System Demonstrations, Dublin, Ireland,
May 22-27, 2022},
pages = {93--104},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.acl-demo.9},
doi = {10.18653/V1/2022.ACL-DEMO.9},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/BachSYWRNSKBFAD22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/0001NMWZDARZ22,
author = {Yusen Zhang and
Ansong Ni and
Ziming Mao and
Chen Henry Wu and
Chenguang Zhu and
Budhaditya Deb and
Ahmed Hassan Awadallah and
Dragomir R. Radev and
Rui Zhang},
editor = {Smaranda Muresan and
Preslav Nakov and
Aline Villavicencio},
title = {Summ{\textdollar}{\^{}}N{\textdollar}: {A} Multi-Stage Summarization
Framework for Long Input Dialogues and Documents},
booktitle = {Proceedings of the 60th Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2022, Dublin, Ireland,
May 22-27, 2022},
pages = {1592--1604},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.acl-long.112},
doi = {10.18653/V1/2022.ACL-LONG.112},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/0001NMWZDARZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/MaoWN0Z0DZAR22,
author = {Ziming Mao and
Chen Henry Wu and
Ansong Ni and
Yusen Zhang and
Rui Zhang and
Tao Yu and
Budhaditya Deb and
Chenguang Zhu and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
editor = {Smaranda Muresan and
Preslav Nakov and
Aline Villavicencio},
title = {{DYLE:} Dynamic Latent Extraction for Abstractive Long-Input Summarization},
booktitle = {Proceedings of the 60th Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2022, Dublin, Ireland,
May 22-27, 2022},
pages = {1687--1698},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.acl-long.118},
doi = {10.18653/V1/2022.ACL-LONG.118},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/MaoWN0Z0DZAR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiuLRN22,
author = {Yixin Liu and
Pengfei Liu and
Dragomir R. Radev and
Graham Neubig},
editor = {Smaranda Muresan and
Preslav Nakov and
Aline Villavicencio},
title = {{BRIO:} Bringing Order to Abstractive Summarization},
booktitle = {Proceedings of the 60th Annual Meeting of the Association for Computational
Linguistics (Volume 1: Long Papers), {ACL} 2022, Dublin, Ireland,
May 22-27, 2022},
pages = {2890--2903},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.acl-long.207},
doi = {10.18653/V1/2022.ACL-LONG.207},
timestamp = {Mon, 29 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/LiuLRN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/XieW0ZSYWZYWZWL22,
author = {Tianbao Xie and
Chen Henry Wu and
Peng Shi and
Ruiqi Zhong and
Torsten Scholak and
Michihiro Yasunaga and
Chien{-}Sheng Wu and
Ming Zhong and
Pengcheng Yin and
Sida I. Wang and
Victor Zhong and
Bailin Wang and
Chengzu Li and
Connor Boyle and
Ansong Ni and
Ziyu Yao and
Dragomir Radev and
Caiming Xiong and
Lingpeng Kong and
Rui Zhang and
Noah A. Smith and
Luke Zettlemoyer and
Tao Yu},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {UnifiedSKG: Unifying and Multi-Tasking Structured Knowledge Grounding
with Text-to-Text Language Models},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {602--631},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.39},
doi = {10.18653/V1/2022.EMNLP-MAIN.39},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/XieW0ZSYWZYWZWL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KasaiS0PLRCS22,
author = {Jungo Kasai and
Keisuke Sakaguchi and
Ronan Le Bras and
Hao Peng and
Ximing Lu and
Dragomir Radev and
Yejin Choi and
Noah A. Smith},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {Twist Decoding: Diverse Generators Guide Each Other},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {4909--4923},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.326},
doi = {10.18653/V1/2022.EMNLP-MAIN.326},
timestamp = {Wed, 21 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/KasaiS0PLRCS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/WangFNMDCLMR22,
author = {Borui Wang and
Chengcheng Feng and
Arjun Nair and
Madelyn Mao and
Jai Desai and
Asli Celikyilmaz and
Haoran Li and
Yashar Mehdad and
Dragomir Radev},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {{STRUDEL:} Structured Dialogue Summarization for Dialogue Comprehension},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {4949--4958},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.329},
doi = {10.18653/V1/2022.EMNLP-MAIN.329},
timestamp = {Wed, 25 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/WangFNMDCLMR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiuNNDZAR22,
author = {Yixin Liu and
Ansong Ni and
Linyong Nan and
Budhaditya Deb and
Chenguang Zhu and
Ahmed Hassan Awadallah and
Dragomir Radev},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {Leveraging Locality in Abstractive Text Summarization},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {6081--6093},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.408},
doi = {10.18653/V1/2022.EMNLP-MAIN.408},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LiuNNDZAR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/KryscinskiRAXR22,
author = {Wojciech Kryscinski and
Nazneen Rajani and
Divyansh Agarwal and
Caiming Xiong and
Dragomir Radev},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {{BOOKSUM:} {A} Collection of Datasets for Long-form Narrative Summarization},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2022, Abu Dhabi, United Arab Emirates, December 7-11, 2022},
pages = {6536--6558},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.findings-emnlp.488},
doi = {10.18653/V1/2022.FINDINGS-EMNLP.488},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/KryscinskiRAXR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/NanFZLBZR22,
author = {Linyong Nan and
Lorenzo Jaime Yu Flores and
Yilun Zhao and
Yixin Liu and
Luke Benson and
Weijin Zou and
Dragomir Radev},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {{R2D2:} Robust Data-to-Text with Replacement Detection},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {6903--6917},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.464},
doi = {10.18653/V1/2022.EMNLP-MAIN.464},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/NanFZLBZR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/LiuYMRXZ22,
author = {Ye Liu and
Semih Yavuz and
Rui Meng and
Dragomir Radev and
Caiming Xiong and
Yingbo Zhou},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {Uni-Parser: Unified Semantic Parser for Question Answering on Knowledge
Base and Database},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {8858--8869},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.605},
doi = {10.18653/V1/2022.EMNLP-MAIN.605},
timestamp = {Thu, 10 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/LiuYMRXZ22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhaoNQ0R22,
author = {Yilun Zhao and
Linyong Nan and
Zhenting Qi and
Rui Zhang and
Dragomir Radev},
editor = {Yoav Goldberg and
Zornitsa Kozareva and
Yue Zhang},
title = {ReasTAP: Injecting Table Reasoning Skills During Pre-training via
Synthetic Reasoning Examples},
booktitle = {Proceedings of the 2022 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2022, Abu Dhabi, United Arab Emirates,
December 7-11, 2022},
pages = {9006--9018},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.emnlp-main.615},
doi = {10.18653/V1/2022.EMNLP-MAIN.615},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ZhaoNQ0R22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fat/JerniteNBRMDTLS22,
author = {Yacine Jernite and
Huu Nguyen and
Stella Biderman and
Anna Rogers and
Maraim Masoud and
Valentin Danchev and
Samson Tan and
Alexandra Sasha Luccioni and
Nishant Subramani and
Isaac Johnson and
G{\'{e}}rard Dupont and
Jesse Dodge and
Kyle Lo and
Zeerak Talat and
Dragomir R. Radev and
Aaron Gokaslan and
Somaieh Nikpoor and
Peter Henderson and
Rishi Bommasani and
Margaret Mitchell},
title = {Data Governance in the Age of Large-Scale Data-Driven Language Technology},
booktitle = {FAccT '22: 2022 {ACM} Conference on Fairness, Accountability, and
Transparency, Seoul, Republic of Korea, June 21 - 24, 2022},
pages = {2206--2222},
publisher = {{ACM}},
year = {2022},
url = {https://doi.org/10.1145/3531146.3534637},
doi = {10.1145/3531146.3534637},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fat/JerniteNBRMDTLS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/LiFKLTTSMMR22,
author = {Irene Li and
Alexander R. Fabbri and
Rina Kawamura and
Yixin Liu and
Xiangru Tang and
Jaesung Tae and
Chang Shen and
Sally Ma and
Tomoe Mizutani and
Dragomir Radev},
editor = {Nicoletta Calzolari and
Fr{\'{e}}d{\'{e}}ric B{\'{e}}chet and
Philippe Blache and
Khalid Choukri and
Christopher Cieri and
Thierry Declerck and
Sara Goggi and
Hitoshi Isahara and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Jan Odijk and
Stelios Piperidis},
title = {Surfer100: Generating Surveys From Web Resources, Wikipedia-style},
booktitle = {Proceedings of the Thirteenth Language Resources and Evaluation Conference,
{LREC} 2022, Marseille, France, 20-25 June 2022},
pages = {5388--5392},
publisher = {European Language Resources Association},
year = {2022},
url = {https://aclanthology.org/2022.lrec-1.576},
timestamp = {Mon, 10 Oct 2022 16:57:52 +0200},
biburl = {https://dblp.org/rec/conf/lrec/LiFKLTTSMMR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/TangNWWDWLCMR22,
author = {Xiangru Tang and
Arjun Nair and
Borui Wang and
Bingyao Wang and
Jai Desai and
Aaron Wade and
Haoran Li and
Asli Celikyilmaz and
Yashar Mehdad and
Dragomir R. Radev},
editor = {Marine Carpuat and
Marie{-}Catherine de Marneffe and
Iv{\'{a}}n Vladimir Meza Ru{\'{\i}}z},
title = {{CONFIT:} Toward Faithful Dialogue Summarization with Linguistically-Informed
Contrastive Fine-tuning},
booktitle = {Proceedings of the 2022 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL} 2022, Seattle, WA, United States, July 10-15, 2022},
pages = {5657--5668},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.naacl-main.415},
doi = {10.18653/V1/2022.NAACL-MAIN.415},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/naacl/TangNWWDWLCMR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/TangFLMAWCMR22,
author = {Xiangru Tang and
Alexander R. Fabbri and
Haoran Li and
Ziming Mao and
Griffin Adams and
Borui Wang and
Asli Celikyilmaz and
Yashar Mehdad and
Dragomir R. Radev},
editor = {Marine Carpuat and
Marie{-}Catherine de Marneffe and
Iv{\'{a}}n Vladimir Meza Ru{\'{\i}}z},
title = {Investigating Crowdsourcing Protocols for Evaluating the Factual Consistency
of Summaries},
booktitle = {Proceedings of the 2022 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL} 2022, Seattle, WA, United States, July 10-15, 2022},
pages = {5680--5692},
publisher = {Association for Computational Linguistics},
year = {2022},
url = {https://doi.org/10.18653/v1/2022.naacl-main.417},
doi = {10.18653/V1/2022.NAACL-MAIN.417},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/naacl/TangFLMAWCMR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-02312,
author = {Irene Li and
Thomas George and
Alexander R. Fabbri and
Tammy Liao and
Benjamin Chen and
Rina Kawamura and
Richard Zhou and
Vanessa Yan and
Swapnil Hingmire and
Dragomir R. Radev},
title = {A Transfer Learning Pipeline for Educational Resource Discovery with
Application in Leading Paragraph Generation},
journal = {CoRR},
volume = {abs/2201.02312},
year = {2022},
url = {https://arxiv.org/abs/2201.02312},
eprinttype = {arXiv},
eprint = {2201.02312},
timestamp = {Mon, 10 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-02312.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-05966,
author = {Tianbao Xie and
Chen Henry Wu and
Peng Shi and
Ruiqi Zhong and
Torsten Scholak and
Michihiro Yasunaga and
Chien{-}Sheng Wu and
Ming Zhong and
Pengcheng Yin and
Sida I. Wang and
Victor Zhong and
Bailin Wang and
Chengzu Li and
Connor Boyle and
Ansong Ni and
Ziyu Yao and
Dragomir R. Radev and
Caiming Xiong and
Lingpeng Kong and
Rui Zhang and
Noah A. Smith and
Luke Zettlemoyer and
Tao Yu},
title = {UnifiedSKG: Unifying and Multi-Tasking Structured Knowledge Grounding
with Text-to-Text Language Models},
journal = {CoRR},
volume = {abs/2201.05966},
year = {2022},
url = {https://arxiv.org/abs/2201.05966},
eprinttype = {arXiv},
eprint = {2201.05966},
timestamp = {Thu, 31 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2201-05966.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-16804,
author = {Yixin Liu and
Pengfei Liu and
Dragomir R. Radev and
Graham Neubig},
title = {{BRIO:} Bringing Order to Abstractive Summarization},
journal = {CoRR},
volume = {abs/2203.16804},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2203.16804},
doi = {10.48550/ARXIV.2203.16804},
eprinttype = {arXiv},
eprint = {2203.16804},
timestamp = {Mon, 04 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2203-16804.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-05424,
author = {Jungo Kasai and
Keisuke Sakaguchi and
Ronan Le Bras and
Dragomir R. Radev and
Yejin Choi and
Noah A. Smith},
title = {Beam Decoding with Controlled Patience},
journal = {CoRR},
volume = {abs/2204.05424},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.05424},
doi = {10.48550/ARXIV.2204.05424},
eprinttype = {arXiv},
eprint = {2204.05424},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-05424.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-06604,
author = {Irene Li and
Keen You and
Xiangru Tang and
Yujie Qiao and
Lucas Huang and
Chiachun Hsieh and
Benjamin Rosand and
Dragomir R. Radev},
title = {EHRKit: {A} Python Natural Language Processing Toolkit for Electronic
Health Record Texts},
journal = {CoRR},
volume = {abs/2204.06604},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.06604},
doi = {10.48550/ARXIV.2204.06604},
eprinttype = {arXiv},
eprint = {2204.06604},
timestamp = {Tue, 19 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-06604.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2204-08663,
author = {Fang Wu and
Qiang Zhang and
Dragomir R. Radev and
Yuyang Wang and
Xurui Jin and
Yinghui Jiang and
Zhangming Niu and
Stan Z. Li},
title = {Pre-training of Deep Protein Models with Molecular Dynamics Simulations
for Drug Binding},
journal = {CoRR},
volume = {abs/2204.08663},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2204.08663},
doi = {10.48550/ARXIV.2204.08663},
eprinttype = {arXiv},
eprint = {2204.08663},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2204-08663.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-07266,
author = {Fang Wu and
Siyuan Li and
Lirong Wu and
Dragomir R. Radev and
Qiang Zhang and
Stan Z. Li},
title = {Discovering the Representation Bottleneck of Graph Neural Networks
from Multi-order Interactions},
journal = {CoRR},
volume = {abs/2205.07266},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.07266},
doi = {10.48550/ARXIV.2205.07266},
eprinttype = {arXiv},
eprint = {2205.07266},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-07266.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-09273,
author = {Jungo Kasai and
Keisuke Sakaguchi and
Ronan Le Bras and
Hao Peng and
Ximing Lu and
Dragomir R. Radev and
Yejin Choi and
Noah A. Smith},
title = {Twist Decoding: Diverse Generators Guide Each Other},
journal = {CoRR},
volume = {abs/2205.09273},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.09273},
doi = {10.48550/ARXIV.2205.09273},
eprinttype = {arXiv},
eprint = {2205.09273},
timestamp = {Wed, 21 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-09273.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-12467,
author = {Linyong Nan and
Lorenzo Jaime Yu Flores and
Yilun Zhao and
Yixin Liu and
Luke Benson and
Weijin Zou and
Dragomir R. Radev},
title = {{R2D2:} Robust Data-to-Text with Replacement Detection},
journal = {CoRR},
volume = {abs/2205.12467},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.12467},
doi = {10.48550/ARXIV.2205.12467},
eprinttype = {arXiv},
eprint = {2205.12467},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-12467.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-12476,
author = {Yixin Liu and
Ansong Ni and
Linyong Nan and
Budhaditya Deb and
Chenguang Zhu and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
title = {Leveraging Locality in Abstractive Text Summarization},
journal = {CoRR},
volume = {abs/2205.12476},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.12476},
doi = {10.48550/ARXIV.2205.12476},
eprinttype = {arXiv},
eprint = {2205.12476},
timestamp = {Mon, 30 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-12476.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-14318,
author = {Ansong Ni and
Jeevana Priya Inala and
Chenglong Wang and
Oleksandr Polozov and
Christopher Meek and
Dragomir R. Radev and
Jianfeng Gao},
title = {Learning from Self-Sampled Correct and Partially-Correct Programs},
journal = {CoRR},
volume = {abs/2205.14318},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2205.14318},
doi = {10.48550/ARXIV.2205.14318},
eprinttype = {arXiv},
eprint = {2205.14318},
timestamp = {Thu, 11 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2205-14318.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-03216,
author = {Yacine Jernite and
Huu Nguyen and
Stella Biderman and
Anna Rogers and
Maraim Masoud and
Valentin Danchev and
Samson Tan and
Alexandra Sasha Luccioni and
Nishant Subramani and
G{\'{e}}rard Dupont and
Jesse Dodge and
Kyle Lo and
Zeerak Talat and
Isaac Johnson and
Dragomir R. Radev and
Somaieh Nikpoor and
J{\"{o}}rg Frohberg and
Aaron Gokaslan and
Peter Henderson and
Rishi Bommasani and
Margaret Mitchell},
title = {Data Governance in the Age of Large-Scale Data-Driven Language Technology},
journal = {CoRR},
volume = {abs/2206.03216},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.03216},
doi = {10.48550/ARXIV.2206.03216},
eprinttype = {arXiv},
eprint = {2206.03216},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-03216.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2206-11249,
author = {Sebastian Gehrmann and
Abhik Bhattacharjee and
Abinaya Mahendiran and
Alex Wang and
Alexandros Papangelis and
Aman Madaan and
Angelina McMillan{-}Major and
Anna Shvets and
Ashish Upadhyay and
Bingsheng Yao and
Bryan Wilie and
Chandra Bhagavatula and
Chaobin You and
Craig Thomson and
Cristina Garbacea and
Dakuo Wang and
Daniel Deutsch and
Deyi Xiong and
Di Jin and
Dimitra Gkatzia and
Dragomir R. Radev and
Elizabeth Clark and
Esin Durmus and
Faisal Ladhak and
Filip Ginter and
Genta Indra Winata and
Hendrik Strobelt and
Hiroaki Hayashi and
Jekaterina Novikova and
Jenna Kanerva and
Jenny Chim and
Jiawei Zhou and
Jordan Clive and
Joshua Maynez and
Jo{\~{a}}o Sedoc and
Juraj Juraska and
Kaustubh D. Dhole and
Khyathi Raghavi Chandu and
Laura Perez{-}Beltrachini and
Leonardo F. R. Ribeiro and
Lewis Tunstall and
Li Zhang and
Mahima Pushkarna and
Mathias Creutz and
Michael White and
Mihir Sanjay Kale and
Moussa Kamal Eddine and
Nico Daheim and
Nishant Subramani and
Ondrej Dusek and
Paul Pu Liang and
Pawan Sasanka Ammanamanchi and
Qi Zhu and
Ratish Puduppully and
Reno Kriz and
Rifat Shahriyar and
Ronald Cardenas and
Saad Mahamood and
Salomey Osei and
Samuel Cahyawijaya and
Sanja Stajner and
S{\'{e}}bastien Montella and
Shailza Jolly and
Simon Mille and
Tahmid Hasan and
Tianhao Shen and
Tosin P. AMahidewumi and
Vikas Raunak and
Vipul Raheja and
Vitaly Nikolaev and
Vivian Tsai and
Yacine Jernite and
Ying Xu and
Yisi Sang and
Yixin Liu and
Yufang Hou},
title = {GEMv2: Multilingual {NLG} Benchmarking in a Single Line of Code},
journal = {CoRR},
volume = {abs/2206.11249},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2206.11249},
doi = {10.48550/ARXIV.2206.11249},
eprinttype = {arXiv},
eprint = {2206.11249},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2206-11249.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-13332,
author = {Jungo Kasai and
Keisuke Sakaguchi and
Yoichi Takahashi and
Ronan Le Bras and
Akari Asai and
Xinyan Yu and
Dragomir R. Radev and
Noah A. Smith and
Yejin Choi and
Kentaro Inui},
title = {RealTime {QA:} What's the Answer Right Now?},
journal = {CoRR},
volume = {abs/2207.13332},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2207.13332},
doi = {10.48550/ARXIV.2207.13332},
eprinttype = {arXiv},
eprint = {2207.13332},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2207-13332.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-00840,
author = {Simeng Han and
Hailey Schoelkopf and
Yilun Zhao and
Zhenting Qi and
Martin Riddell and
Luke Benson and
Lucy Sun and
Ekaterina Zubova and
Yujie Qiao and
Matthew Burtell and
David Peng and
Jonathan Fan and
Yixin Liu and
Brian Wong and
Malcolm Sailor and
Ansong Ni and
Linyong Nan and
Jungo Kasai and
Tao Yu and
Rui Zhang and
Shafiq R. Joty and
Alexander R. Fabbri and
Wojciech Kryscinski and
Xi Victoria Lin and
Caiming Xiong and
Dragomir Radev},
title = {{FOLIO:} Natural Language Reasoning with First-Order Logic},
journal = {CoRR},
volume = {abs/2209.00840},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2209.00840},
doi = {10.48550/ARXIV.2209.00840},
eprinttype = {arXiv},
eprint = {2209.00840},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2209-00840.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-02875,
author = {Zhoujun Cheng and
Tianbao Xie and
Peng Shi and
Chengzu Li and
Rahul Nadkarni and
Yushi Hu and
Caiming Xiong and
Dragomir Radev and
Mari Ostendorf and
Luke Zettlemoyer and
Noah A. Smith and
Tao Yu},
title = {Binding Language Models in Symbolic Languages},
journal = {CoRR},
volume = {abs/2210.02875},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.02875},
doi = {10.48550/ARXIV.2210.02875},
eprinttype = {arXiv},
eprint = {2210.02875},
timestamp = {Fri, 07 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-02875.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2210-12374,
author = {Yilun Zhao and
Linyong Nan and
Zhenting Qi and
Rui Zhang and
Dragomir Radev},
title = {ReasTAP: Injecting Table Reasoning Skills During Pre-training via
Synthetic Reasoning Examples},
journal = {CoRR},
volume = {abs/2210.12374},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2210.12374},
doi = {10.48550/ARXIV.2210.12374},
eprinttype = {arXiv},
eprint = {2210.12374},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2210-12374.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-01786,
author = {Niklas Muennighoff and
Thomas Wang and
Lintang Sutawika and
Adam Roberts and
Stella Biderman and
Teven Le Scao and
M. Saiful Bari and
Sheng Shen and
Zheng Xin Yong and
Hailey Schoelkopf and
Xiangru Tang and
Dragomir Radev and
Alham Fikri Aji and
Khalid Almubarak and
Samuel Albanie and
Zaid Alyafeai and
Albert Webson and
Edward Raff and
Colin Raffel},
title = {Crosslingual Generalization through Multitask Finetuning},
journal = {CoRR},
volume = {abs/2211.01786},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.01786},
doi = {10.48550/ARXIV.2211.01786},
eprinttype = {arXiv},
eprint = {2211.01786},
timestamp = {Fri, 04 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-01786.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-05041,
author = {Yusen Zhang and
Yang Liu and
Ziyi Yang and
Yuwei Fang and
Yulong Chen and
Dragomir Radev and
Chenguang Zhu and
Michael Zeng and
Rui Zhang},
title = {MACSum: Controllable Summarization with Mixed Attributes},
journal = {CoRR},
volume = {abs/2211.05041},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.05041},
doi = {10.48550/ARXIV.2211.05041},
eprinttype = {arXiv},
eprint = {2211.05041},
timestamp = {Fri, 03 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-05041.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-05165,
author = {Ye Liu and
Semih Yavuz and
Rui Meng and
Dragomir Radev and
Caiming Xiong and
Yingbo Zhou},
title = {Uni-Parser: Unified Semantic Parser for Question Answering on Knowledge
Base and Database},
journal = {CoRR},
volume = {abs/2211.05165},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.05165},
doi = {10.48550/ARXIV.2211.05165},
eprinttype = {arXiv},
eprint = {2211.05165},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-05165.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-05886,
author = {Divyansh Agarwal and
Alexander R. Fabbri and
Simeng Han and
Wojciech Kryscinski and
Faisal Ladhak and
Bryan Li and
Kathleen R. McKeown and
Dragomir Radev and
Tianyi Zhang and
Sam Wiseman},
title = {{CREATIVESUMM:} Shared Task on Automatic Summarization for Creative
Writing},
journal = {CoRR},
volume = {abs/2211.05886},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.05886},
doi = {10.48550/ARXIV.2211.05886},
eprinttype = {arXiv},
eprint = {2211.05886},
timestamp = {Tue, 15 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-05886.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-16740,
author = {Zhangir Azerbayev and
Ansong Ni and
Hailey Schoelkopf and
Dragomir Radev},
title = {Explicit Knowledge Transfer for Weakly-Supervised Code Generation},
journal = {CoRR},
volume = {abs/2211.16740},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.16740},
doi = {10.48550/ARXIV.2211.16740},
eprinttype = {arXiv},
eprint = {2211.16740},
timestamp = {Fri, 02 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-16740.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-03447,
author = {Fang Wu and
Tao Yu and
Dragomir Radev and
Jinbo Xu},
title = {When Geometric Deep Learning Meets Pretrained Protein Language Models},
journal = {CoRR},
volume = {abs/2212.03447},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.03447},
doi = {10.48550/ARXIV.2212.03447},
eprinttype = {arXiv},
eprint = {2212.03447},
timestamp = {Mon, 02 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-03447.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-07981,
author = {Yixin Liu and
Alexander R. Fabbri and
Pengfei Liu and
Yilun Zhao and
Linyong Nan and
Ruilin Han and
Simeng Han and
Shafiq R. Joty and
Chien{-}Sheng Wu and
Caiming Xiong and
Dragomir Radev},
title = {Revisiting the Gold Standard: Grounding Summarization Evaluation with
Robust Human Evaluation},
journal = {CoRR},
volume = {abs/2212.07981},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.07981},
doi = {10.48550/ARXIV.2212.07981},
eprinttype = {arXiv},
eprint = {2212.07981},
timestamp = {Mon, 25 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-07981.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-09535,
author = {Zheng Xin Yong and
Hailey Schoelkopf and
Niklas Muennighoff and
Alham Fikri Aji and
David Ifeoluwa Adelani and
Khalid Almubarak and
M. Saiful Bari and
Lintang Sutawika and
Jungo Kasai and
Ahmed Baruwa and
Genta Indra Winata and
Stella Biderman and
Dragomir Radev and
Vassilina Nikoulina},
title = {{BLOOM+1:} Adding Language Support to {BLOOM} for Zero-Shot Prompting},
journal = {CoRR},
volume = {abs/2212.09535},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.09535},
doi = {10.48550/ARXIV.2212.09535},
eprinttype = {arXiv},
eprint = {2212.09535},
timestamp = {Tue, 03 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-09535.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-09968,
author = {Yixin Liu and
Budhaditya Deb and
Milagro Teruel and
Aaron Halfaker and
Dragomir Radev and
Ahmed Hassan Awadallah},
title = {On Improving Summarization Factual Consistency from Natural Language
Feedback},
journal = {CoRR},
volume = {abs/2212.09968},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.09968},
doi = {10.48550/ARXIV.2212.09968},
eprinttype = {arXiv},
eprint = {2212.09968},
timestamp = {Tue, 03 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-09968.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2212-12652,
author = {Borui Wang and
Chengcheng Feng and
Arjun Nair and
Madelyn Mao and
Jai Desai and
Asli Celikyilmaz and
Haoran Li and
Yashar Mehdad and
Dragomir Radev},
title = {{STRUDEL:} Structured Dialogue Summarization for Dialogue Comprehension},
journal = {CoRR},
volume = {abs/2212.12652},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2212.12652},
doi = {10.48550/ARXIV.2212.12652},
eprinttype = {arXiv},
eprint = {2212.12652},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2212-12652.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/EstevaKPH0RS21,
author = {Andre Esteva and
Anuprit Kale and
Romain Paulus and
Kazuma Hashimoto and
Wenpeng Yin and
Dragomir Radev and
Richard Socher},
title = {{COVID-19} information retrieval with deep-learning based semantic
search, question answering, and abstractive summarization},
journal = {npj Digit. Medicine},
volume = {4},
year = {2021},
url = {https://doi.org/10.1038/s41746-021-00437-0},
doi = {10.1038/S41746-021-00437-0},
timestamp = {Mon, 01 May 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/npjdm/EstevaKPH0RS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/FabbriKMXSR21,
author = {Alexander R. Fabbri and
Wojciech Kryscinski and
Bryan McCann and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
title = {SummEval: Re-evaluating Summarization Evaluation},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {9},
pages = {391--409},
year = {2021},
url = {https://doi.org/10.1162/tacl\_a\_00373},
doi = {10.1162/TACL\_A\_00373},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tacl/FabbriKMXSR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/LiYLQR20,
author = {Irene Li and
Vanessa Yan and
Tianxiao Li and
Rihao Qu and
Dragomir R. Radev},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {Unsupervised Cross-Domain Prerequisite Chain Learning using Variational
Graph Autoencoders},
booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational
Linguistics and the 11th International Joint Conference on Natural
Language Processing, {ACL/IJCNLP} 2021, (Volume 2: Short Papers),
Virtual Event, August 1-6, 2021},
pages = {1005--1011},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.acl-short.127},
doi = {10.18653/V1/2021.ACL-SHORT.127},
timestamp = {Mon, 09 Aug 2021 16:25:37 +0200},
biburl = {https://dblp.org/rec/conf/acl/LiYLQR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/YinRX21,
author = {Wenpeng Yin and
Dragomir R. Radev and
Caiming Xiong},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {DocNLI: {A} Large-scale Dataset for Document-level Natural Language
Inference},
booktitle = {Findings of the Association for Computational Linguistics: {ACL/IJCNLP}
2021, Online Event, August 1-6, 2021},
series = {Findings of {ACL}},
volume = {{ACL/IJCNLP} 2021},
pages = {4913--4922},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.findings-acl.435},
doi = {10.18653/V1/2021.FINDINGS-ACL.435},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/YinRX21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/FabbriRRWLMR20,
author = {Alexander R. Fabbri and
Faiaz Rahman and
Imad Rizvi and
Borui Wang and
Haoran Li and
Yashar Mehdad and
Dragomir R. Radev},
editor = {Chengqing Zong and
Fei Xia and
Wenjie Li and
Roberto Navigli},
title = {ConvoSumm: Conversation Summarization Benchmark and Improved Abstractive
Summarization with Argument Mining},
booktitle = {Proceedings of the 59th Annual Meeting of the Association for Computational
Linguistics and the 11th International Joint Conference on Natural
Language Processing, {ACL/IJCNLP} 2021, (Volume 1: Long Papers), Virtual
Event, August 1-6, 2021},
pages = {6866--6880},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.acl-long.535},
doi = {10.18653/V1/2021.ACL-LONG.535},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/FabbriRRWLMR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/NiAMF00AR21,
author = {Ansong Ni and
Zhangir Azerbayev and
Mutethia Mutuma and
Troy Feng and
Yusen Zhang and
Tao Yu and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
editor = {Heike Adel and
Shuming Shi},
title = {SummerTime: Text Summarization Toolkit for Non-experts},
booktitle = {Proceedings of the 2021 Conference on Empirical Methods in Natural
Language Processing: System Demonstrations, {EMNLP} 2021, Online and
Punta Cana, Dominican Republic, 7-11 November, 2021},
pages = {329--338},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.emnlp-demo.37},
doi = {10.18653/V1/2021.EMNLP-DEMO.37},
timestamp = {Thu, 20 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/NiAMF00AR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/0001N0ZZDCAR21,
author = {Yusen Zhang and
Ansong Ni and
Tao Yu and
Rui Zhang and
Chenguang Zhu and
Budhaditya Deb and
Asli Celikyilmaz and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
editor = {Marie{-}Francine Moens and
Xuanjing Huang and
Lucia Specia and
Scott Wen{-}tau Yih},
title = {An Exploratory Study on Long Dialogue Summarization: What Works and
What's Next},
booktitle = {Findings of the Association for Computational Linguistics: {EMNLP}
2021, Virtual Event / Punta Cana, Dominican Republic, 16-20 November,
2021},
pages = {4426--4433},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.findings-emnlp.377},
doi = {10.18653/V1/2021.FINDINGS-EMNLP.377},
timestamp = {Fri, 16 Feb 2024 08:27:36 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/0001N0ZZDCAR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iclr/0009WLWTYRSX21,
author = {Tao Yu and
Chien{-}Sheng Wu and
Xi Victoria Lin and
Bailin Wang and
Yi Chern Tan and
Xinyi Yang and
Dragomir R. Radev and
Richard Socher and
Caiming Xiong},
title = {GraPPa: Grammar-Augmented Pre-Training for Table Semantic Parsing},
booktitle = {9th International Conference on Learning Representations, {ICLR} 2021,
Virtual Event, Austria, May 3-7, 2021},
publisher = {OpenReview.net},
year = {2021},
url = {https://openreview.net/forum?id=kyaIeYj4zZ},
timestamp = {Wed, 23 Jun 2021 17:36:39 +0200},
biburl = {https://dblp.org/rec/conf/iclr/0009WLWTYRSX21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/NanRZRSHTVVKLIP21,
author = {Linyong Nan and
Dragomir R. Radev and
Rui Zhang and
Amrit Rau and
Abhinand Sivaprasad and
Chiachun Hsieh and
Xiangru Tang and
Aadit Vyas and
Neha Verma and
Pranav Krishna and
Yangxiaokang Liu and
Nadia Irwanto and
Jessica Pan and
Faiaz Rahman and
Ahmad Zaidi and
Mutethia Mutuma and
Yasin Tarabar and
Ankit Gupta and
Tao Yu and
Yi Chern Tan and
Xi Victoria Lin and
Caiming Xiong and
Richard Socher and
Nazneen Fatema Rajani},
editor = {Kristina Toutanova and
Anna Rumshisky and
Luke Zettlemoyer and
Dilek Hakkani{-}T{\"{u}}r and
Iz Beltagy and
Steven Bethard and
Ryan Cotterell and
Tanmoy Chakraborty and
Yichao Zhou},
title = {{DART:} Open-Domain Structured Data Record to Text Generation},
booktitle = {Proceedings of the 2021 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2021, Online, June 6-11, 2021},
pages = {432--447},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.naacl-main.37},
doi = {10.18653/V1/2021.NAACL-MAIN.37},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/NanRZRSHTVVKLIP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/FabbriHLLGJRM21,
author = {Alexander R. Fabbri and
Simeng Han and
Haoyuan Li and
Haoran Li and
Marjan Ghazvininejad and
Shafiq R. Joty and
Dragomir R. Radev and
Yashar Mehdad},
editor = {Kristina Toutanova and
Anna Rumshisky and
Luke Zettlemoyer and
Dilek Hakkani{-}T{\"{u}}r and
Iz Beltagy and
Steven Bethard and
Ryan Cotterell and
Tanmoy Chakraborty and
Yichao Zhou},
title = {Improving Zero and Few-Shot Abstractive Summarization with Intermediate
Fine-tuning and Data Augmentation},
booktitle = {Proceedings of the 2021 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2021, Online, June 6-11, 2021},
pages = {704--717},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.naacl-main.57},
doi = {10.18653/V1/2021.NAACL-MAIN.57},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/naacl/FabbriHLLGJRM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/ZhongYYZMJACLQR21,
author = {Ming Zhong and
Da Yin and
Tao Yu and
Ahmad Zaidi and
Mutethia Mutuma and
Rahul Jha and
Ahmed Hassan Awadallah and
Asli Celikyilmaz and
Yang Liu and
Xipeng Qiu and
Dragomir R. Radev},
editor = {Kristina Toutanova and
Anna Rumshisky and
Luke Zettlemoyer and
Dilek Hakkani{-}T{\"{u}}r and
Iz Beltagy and
Steven Bethard and
Ryan Cotterell and
Tanmoy Chakraborty and
Yichao Zhou},
title = {QMSum: {A} New Benchmark for Query-based Multi-domain Meeting Summarization},
booktitle = {Proceedings of the 2021 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2021, Online, June 6-11, 2021},
pages = {5905--5921},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.naacl-main.472},
doi = {10.18653/V1/2021.NAACL-MAIN.472},
timestamp = {Wed, 30 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/ZhongYYZMJACLQR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rep4nlp/LiSZLR21,
author = {Irene Li and
Prithviraj Sen and
Huaiyu Zhu and
Yunyao Li and
Dragomir R. Radev},
editor = {Anna Rogers and
Iacer Calixto and
Ivan Vulic and
Naomi Saphra and
Nora Kassner and
Oana{-}Maria Camburu and
Trapit Bansal and
Vered Shwartz},
title = {Improving Cross-lingual Text Classification with Zero-shot Instance-Weighting},
booktitle = {Proceedings of the 6th Workshop on Representation Learning for NLP,
RepL4NLP@ACL-IJCNLP 2021, Online, August 6, 2021},
pages = {1--7},
publisher = {Association for Computational Linguistics},
year = {2021},
url = {https://doi.org/10.18653/v1/2021.repl4nlp-1.1},
doi = {10.18653/V1/2021.REPL4NLP-1.1},
timestamp = {Mon, 01 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rep4nlp/LiSZLR21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-00369,
author = {Linyong Nan and
Chiachun Hsieh and
Ziming Mao and
Xi Victoria Lin and
Neha Verma and
Rui Zhang and
Wojciech Kryscinski and
Nick Schoelkopf and
Riley Kong and
Xiangru Tang and
Murori Mutuma and
Ben Rosand and
Isabel Trindade and
Renusree Bandaru and
Jacob Cunningham and
Caiming Xiong and
Dragomir R. Radev},
title = {FeTaQA: Free-form Table Question Answering},
journal = {CoRR},
volume = {abs/2104.00369},
year = {2021},
url = {https://arxiv.org/abs/2104.00369},
eprinttype = {arXiv},
eprint = {2104.00369},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-00369.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2104-05938,
author = {Ming Zhong and
Da Yin and
Tao Yu and
Ahmad Zaidi and
Mutethia Mutuma and
Rahul Jha and
Ahmed Hassan Awadallah and
Asli Celikyilmaz and
Yang Liu and
Xipeng Qiu and
Dragomir R. Radev},
title = {QMSum: {A} New Benchmark for Query-based Multi-domain Meeting Summarization},
journal = {CoRR},
volume = {abs/2104.05938},
year = {2021},
url = {https://arxiv.org/abs/2104.05938},
eprinttype = {arXiv},
eprint = {2104.05938},
timestamp = {Wed, 30 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2104-05938.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-03505,
author = {Irene Li and
Vanessa Yan and
Tianxiao Li and
Rihao Qu and
Dragomir R. Radev},
title = {Unsupervised Cross-Domain Prerequisite Chain Learning using Variational
Graph Autoencoders},
journal = {CoRR},
volume = {abs/2105.03505},
year = {2021},
url = {https://arxiv.org/abs/2105.03505},
eprinttype = {arXiv},
eprint = {2105.03505},
timestamp = {Fri, 14 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-03505.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2105-08209,
author = {Wojciech Kryscinski and
Nazneen Fatema Rajani and
Divyansh Agarwal and
Caiming Xiong and
Dragomir R. Radev},
title = {BookSum: {A} Collection of Datasets for Long-form Narrative Summarization},
journal = {CoRR},
volume = {abs/2105.08209},
year = {2021},
url = {https://arxiv.org/abs/2105.08209},
eprinttype = {arXiv},
eprint = {2105.08209},
timestamp = {Mon, 31 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2105-08209.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-00829,
author = {Alexander R. Fabbri and
Faiaz Rahman and
Imad Rizvi and
Borui Wang and
Haoran Li and
Yashar Mehdad and
Dragomir R. Radev},
title = {ConvoSumm: Conversation Summarization Benchmark and Improved Abstractive
Summarization with Argument Mining},
journal = {CoRR},
volume = {abs/2106.00829},
year = {2021},
url = {https://arxiv.org/abs/2106.00829},
eprinttype = {arXiv},
eprint = {2106.00829},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-00829.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-09449,
author = {Wenpeng Yin and
Dragomir R. Radev and
Caiming Xiong},
title = {DocNLI: {A} Large-scale Dataset for Document-level Natural Language
Inference},
journal = {CoRR},
volume = {abs/2106.09449},
year = {2021},
url = {https://arxiv.org/abs/2106.09449},
eprinttype = {arXiv},
eprint = {2106.09449},
timestamp = {Tue, 29 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2106-09449.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-02975,
author = {Irene Li and
Jessica Pan and
Jeremy Goldwasser and
Neha Verma and
Wai Pan Wong and
Muhammed Yavuz Nuzumlali and
Benjamin Rosand and
Yixin Li and
Matthew Zhang and
David Chang and
Richard Andrew Taylor and
Harlan M. Krumholz and
Dragomir R. Radev},
title = {Neural Natural Language Processing for Unstructured Data in Electronic
Health Records: a Review},
journal = {CoRR},
volume = {abs/2107.02975},
year = {2021},
url = {https://arxiv.org/abs/2107.02975},
eprinttype = {arXiv},
eprint = {2107.02975},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2107-02975.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2108-12738,
author = {Ansong Ni and
Zhangir Azerbayev and
Mutethia Mutuma and
Troy Feng and
Yusen Zhang and
Tao Yu and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
title = {SummerTime: Text Summarization Toolkit for Non-experts},
journal = {CoRR},
volume = {abs/2108.12738},
year = {2021},
url = {https://arxiv.org/abs/2108.12738},
eprinttype = {arXiv},
eprint = {2108.12738},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2108-12738.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-04609,
author = {Yusen Zhang and
Ansong Ni and
Tao Yu and
Rui Zhang and
Chenguang Zhu and
Budhaditya Deb and
Asli Celikyilmaz and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
title = {An Exploratory Study on Long Dialogue Summarization: What Works and
What's Next},
journal = {CoRR},
volume = {abs/2109.04609},
year = {2021},
url = {https://arxiv.org/abs/2109.04609},
eprinttype = {arXiv},
eprint = {2109.04609},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-04609.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-08722,
author = {Irene Li and
Vanessa Yan and
Dragomir R. Radev},
title = {Efficient Variational Graph Autoencoders for Unsupervised Cross-domain
Prerequisite Chains},
journal = {CoRR},
volume = {abs/2109.08722},
year = {2021},
url = {https://arxiv.org/abs/2109.08722},
eprinttype = {arXiv},
eprint = {2109.08722},
timestamp = {Mon, 27 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-08722.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2109-09195,
author = {Xiangru Tang and
Alexander R. Fabbri and
Ziming Mao and
Griffin Adams and
Borui Wang and
Haoran Li and
Yashar Mehdad and
Dragomir R. Radev},
title = {Investigating Crowdsourcing Protocols for Evaluating the Factual Consistency
of Summaries},
journal = {CoRR},
volume = {abs/2109.09195},
year = {2021},
url = {https://arxiv.org/abs/2109.09195},
eprinttype = {arXiv},
eprint = {2109.09195},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2109-09195.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-01191,
author = {Fang Wu and
Qiang Zhang and
Dragomir R. Radev and
Jiyu Cui and
Wen Zhang and
Huabin Xing and
Ningyu Zhang and
Huajun Chen},
title = {3D-Transformer: Molecular Representation with Transformer in 3D Space},
journal = {CoRR},
volume = {abs/2110.01191},
year = {2021},
url = {https://arxiv.org/abs/2110.01191},
eprinttype = {arXiv},
eprint = {2110.01191},
timestamp = {Tue, 27 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-01191.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-08168,
author = {Ziming Mao and
Chen Henry Wu and
Ansong Ni and
Yusen Zhang and
Rui Zhang and
Tao Yu and
Budhaditya Deb and
Chenguang Zhu and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
title = {{DYLE:} Dynamic Latent Extraction for Abstractive Long-Input Summarization},
journal = {CoRR},
volume = {abs/2110.08168},
year = {2021},
url = {https://arxiv.org/abs/2110.08168},
eprinttype = {arXiv},
eprint = {2110.08168},
timestamp = {Tue, 31 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-08168.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-10150,
author = {Yusen Zhang and
Ansong Ni and
Ziming Mao and
Chen Henry Wu and
Chenguang Zhu and
Budhaditya Deb and
Ahmed Hassan Awadallah and
Dragomir R. Radev and
Rui Zhang},
title = {Summ{\^{}}N: {A} Multi-Stage Summarization Framework for Long Input
Dialogues and Documents},
journal = {CoRR},
volume = {abs/2110.10150},
year = {2021},
url = {https://arxiv.org/abs/2110.10150},
eprinttype = {arXiv},
eprint = {2110.10150},
timestamp = {Tue, 31 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2110-10150.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-06377,
author = {Irene Li and
Alexander R. Fabbri and
Rina Kawamura and
Yixin Liu and
Xiangru Tang and
Jaesung Tae and
Chang Shen and
Sally Ma and
Tomoe Mizutani and
Dragomir R. Radev},
title = {Surfer100: Generating Surveys From Web Resources on Wikipedia-style},
journal = {CoRR},
volume = {abs/2112.06377},
year = {2021},
url = {https://arxiv.org/abs/2112.06377},
eprinttype = {arXiv},
eprint = {2112.06377},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-06377.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-08578,
author = {Swapnil Hingmire and
Irene Li and
Rena Kawamura and
Benjamin Chen and
Alexander R. Fabbri and
Xiangru Tang and
Yixin Liu and
Thomas George and
Tammy Liao and
Wai Pan Wong and
Vanessa Yan and
Richard Zhou and
Girish K. Palshikar and
Dragomir R. Radev},
title = {{CLICKER:} {A} Computational LInguistics Classification Scheme for
Educational Resources},
journal = {CoRR},
volume = {abs/2112.08578},
year = {2021},
url = {https://arxiv.org/abs/2112.08578},
eprinttype = {arXiv},
eprint = {2112.08578},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-08578.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-08713,
author = {Xiangru Tang and
Arjun Nair and
Borui Wang and
Bingyao Wang and
Jai Desai and
Aaron Wade and
Haoran Li and
Asli Celikyilmaz and
Yashar Mehdad and
Dragomir R. Radev},
title = {{CONFIT:} Toward Faithful Dialogue Summarization with Linguistically-Informed
Contrastive Fine-tuning},
journal = {CoRR},
volume = {abs/2112.08713},
year = {2021},
url = {https://arxiv.org/abs/2112.08713},
eprinttype = {arXiv},
eprint = {2112.08713},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2112-08713.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csl/DongMR20,
author = {MeiXing Dong and
Rada Mihalcea and
Dragomir R. Radev},
title = {Extending sparse text with induced domain-specific lexicons and embeddings:
{A} case study on predicting donations},
journal = {Comput. Speech Lang.},
volume = {59},
pages = {157--168},
year = {2020},
url = {https://doi.org/10.1016/j.csl.2019.06.007},
doi = {10.1016/J.CSL.2019.06.007},
timestamp = {Thu, 20 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/csl/DongMR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RajaniZTZWVGXSR20,
author = {Nazneen Fatema Rajani and
Rui Zhang and
Yi Chern Tan and
Stephan Zheng and
Jeremy Weiss and
Aadit Vyas and
Abhijit Gupta and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
editor = {Dan Jurafsky and
Joyce Chai and
Natalie Schluter and
Joel R. Tetreault},
title = {{ESPRIT:} Explaining Solutions to Physical Reasoning Tasks},
booktitle = {Proceedings of the 58th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2020, Online, July 5-10, 2020},
pages = {7906--7917},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.acl-main.706},
doi = {10.18653/V1/2020.ACL-MAIN.706},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RajaniZTZWVGXSR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/LiFHR20,
author = {Irene Li and
Alexander R. Fabbri and
Swapnil Hingmire and
Dragomir R. Radev},
editor = {Donia Scott and
N{\'{u}}ria Bel and
Chengqing Zong},
title = {{R-VGAE:} Relational-variational Graph Autoencoder for Unsupervised
Prerequisite Chain Learning},
booktitle = {Proceedings of the 28th International Conference on Computational
Linguistics, {COLING} 2020, Barcelona, Spain (Online), December 8-13,
2020},
pages = {1147--1157},
publisher = {International Committee on Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.coling-main.99},
doi = {10.18653/V1/2020.COLING-MAIN.99},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/LiFHR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/YinRRSX20,
author = {Wenpeng Yin and
Nazneen Fatema Rajani and
Dragomir R. Radev and
Richard Socher and
Caiming Xiong},
editor = {Bonnie Webber and
Trevor Cohn and
Yulan He and
Yang Liu},
title = {Universal Natural Language Processing with Limited Annotations: Try
Few-shot Textual Entailment as a Start},
booktitle = {Proceedings of the 2020 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2020, Online, November 16-20, 2020},
pages = {8229--8239},
publisher = {Association for Computational Linguistics},
year = {2020},
url = {https://doi.org/10.18653/v1/2020.emnlp-main.660},
doi = {10.18653/V1/2020.EMNLP-MAIN.660},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/YinRRSX20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-10610,
author = {Irene Li and
Alexander R. Fabbri and
Swapnil Hingmire and
Dragomir R. Radev},
title = {{R-VGAE:} Relational-variational Graph Autoencoder for Unsupervised
Prerequisite Chain Learning},
journal = {CoRR},
volume = {abs/2004.10610},
year = {2020},
url = {https://arxiv.org/abs/2004.10610},
eprinttype = {arXiv},
eprint = {2004.10610},
timestamp = {Sun, 24 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-10610.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-00730,
author = {Nazneen Fatema Rajani and
Rui Zhang and
Yi Chern Tan and
Stephan Zheng and
Jeremy Weiss and
Aadit Vyas and
Abhijit Gupta and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
title = {{ESPRIT:} Explaining Solutions to Physical Reasoning Tasks},
journal = {CoRR},
volume = {abs/2005.00730},
year = {2020},
url = {https://arxiv.org/abs/2005.00730},
eprinttype = {arXiv},
eprint = {2005.00730},
timestamp = {Fri, 08 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2005-00730.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-09595,
author = {Andre Esteva and
Anuprit Kale and
Romain Paulus and
Kazuma Hashimoto and
Wenpeng Yin and
Dragomir R. Radev and
Richard Socher},
title = {CO-Search: {COVID-19} Information Retrieval with Semantic Search,
Question Answering, and Abstractive Summarization},
journal = {CoRR},
volume = {abs/2006.09595},
year = {2020},
url = {https://arxiv.org/abs/2006.09595},
eprinttype = {arXiv},
eprint = {2006.09595},
timestamp = {Wed, 28 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-09595.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-02871,
author = {Dragomir R. Radev and
Rui Zhang and
Amrit Rau and
Abhinand Sivaprasad and
Chiachun Hsieh and
Nazneen Fatema Rajani and
Xiangru Tang and
Aadit Vyas and
Neha Verma and
Pranav Krishna and
Yangxiaokang Liu and
Nadia Irwanto and
Jessica Pan and
Faiaz Rahman and
Ahmad Zaidi and
Murori Mutuma and
Yasin Tarabar and
Ankit Gupta and
Tao Yu and
Yi Chern Tan and
Xi Victoria Lin and
Caiming Xiong and
Richard Socher},
title = {{DART:} Open-Domain Structured Data Record to Text Generation},
journal = {CoRR},
volume = {abs/2007.02871},
year = {2020},
url = {https://arxiv.org/abs/2007.02871},
eprinttype = {arXiv},
eprint = {2007.02871},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-02871.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-12626,
author = {Alexander R. Fabbri and
Wojciech Kryscinski and
Bryan McCann and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
title = {SummEval: Re-evaluating Summarization Evaluation},
journal = {CoRR},
volume = {abs/2007.12626},
year = {2020},
url = {https://arxiv.org/abs/2007.12626},
eprinttype = {arXiv},
eprint = {2007.12626},
timestamp = {Wed, 29 Jul 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2007-12626.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2009-13845,
author = {Tao Yu and
Chien{-}Sheng Wu and
Xi Victoria Lin and
Bailin Wang and
Yi Chern Tan and
Xinyi Yang and
Dragomir R. Radev and
Richard Socher and
Caiming Xiong},
title = {GraPPa: Grammar-Augmented Pre-Training for Table Semantic Parsing},
journal = {CoRR},
volume = {abs/2009.13845},
year = {2020},
url = {https://arxiv.org/abs/2009.13845},
eprinttype = {arXiv},
eprint = {2009.13845},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2009-13845.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-02584,
author = {Wenpeng Yin and
Nazneen Fatema Rajani and
Dragomir R. Radev and
Richard Socher and
Caiming Xiong},
title = {Universal Natural Language Processing with Limited Annotations: Try
Few-shot Textual Entailment as a Start},
journal = {CoRR},
volume = {abs/2010.02584},
year = {2020},
url = {https://arxiv.org/abs/2010.02584},
eprinttype = {arXiv},
eprint = {2010.02584},
timestamp = {Wed, 28 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-02584.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-12836,
author = {Alexander R. Fabbri and
Simeng Han and
Haoyuan Li and
Haoran Li and
Marjan Ghazvininejad and
Shafiq R. Joty and
Dragomir R. Radev and
Yashar Mehdad},
title = {Improving Zero and Few-Shot Abstractive Summarization with Intermediate
Fine-tuning and Data Augmentation},
journal = {CoRR},
volume = {abs/2010.12836},
year = {2020},
url = {https://arxiv.org/abs/2010.12836},
eprinttype = {arXiv},
eprint = {2010.12836},
timestamp = {Fri, 03 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2010-12836.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/LiFTR19,
author = {Irene Li and
Alexander R. Fabbri and
Robert R. Tung and
Dragomir R. Radev},
title = {What Should {I} Learn First: Introducing LectureBank for {NLP} Education
and Prerequisite Chain Learning},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {6674--6681},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33016674},
doi = {10.1609/AAAI.V33I01.33016674},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/LiFTR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/YasunagaKZFLFR19,
author = {Michihiro Yasunaga and
Jungo Kasai and
Rui Zhang and
Alexander R. Fabbri and
Irene Li and
Dan Friedman and
Dragomir R. Radev},
title = {ScisummNet: {A} Large Annotated Corpus and Content-Impact Models for
Scientific Paper Summarization with Citation Networks},
booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
2019, The Thirty-First Innovative Applications of Artificial Intelligence
Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
USA, January 27 - February 1, 2019},
pages = {7386--7393},
publisher = {{AAAI} Press},
year = {2019},
url = {https://doi.org/10.1609/aaai.v33i01.33017386},
doi = {10.1609/AAAI.V33I01.33017386},
timestamp = {Tue, 02 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaai/YasunagaKZFLFR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/FabbriLSLR19,
author = {Alexander R. Fabbri and
Irene Li and
Tianwei She and
Suyi Li and
Dragomir R. Radev},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {Multi-News: {A} Large-Scale Multi-Document Summarization Dataset and
Abstractive Hierarchical Model},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {1074--1084},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1102},
doi = {10.18653/V1/P19-1102},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/FabbriLSLR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhangWSBFHVR19,
author = {Rui Zhang and
Caitlin Westerfield and
Sungrok Shim and
Garrett Bingham and
Alexander R. Fabbri and
William Hu and
Neha Verma and
Dragomir R. Radev},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {Improving Low-Resource Cross-lingual Document Retrieval by Reranking
with Deep Bilingual Representations},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {3173--3179},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1306},
doi = {10.18653/V1/P19-1306},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhangWSBFHVR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/YuZYTLLELPCJDPS19,
author = {Tao Yu and
Rui Zhang and
Michihiro Yasunaga and
Yi Chern Tan and
Xi Victoria Lin and
Suyi Li and
Heyang Er and
Irene Li and
Bo Pang and
Tao Chen and
Emily Ji and
Shreya Dixit and
David Proctor and
Sungrok Shim and
Jonathan Kraft and
Vincent Zhang and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
editor = {Anna Korhonen and
David R. Traum and
Llu{\'{\i}}s M{\`{a}}rquez},
title = {SParC: Cross-Domain Semantic Parsing in Context},
booktitle = {Proceedings of the 57th Conference of the Association for Computational
Linguistics, {ACL} 2019, Florence, Italy, July 28- August 2, 2019,
Volume 1: Long Papers},
pages = {4511--4523},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/p19-1443},
doi = {10.18653/V1/P19-1443},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/YuZYTLLELPCJDPS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/YuZELXPLTSLJYSC19,
author = {Tao Yu and
Rui Zhang and
Heyang Er and
Suyi Li and
Eric Xue and
Bo Pang and
Xi Victoria Lin and
Yi Chern Tan and
Tianze Shi and
Zihan Li and
Youxuan Jiang and
Michihiro Yasunaga and
Sungrok Shim and
Tao Chen and
Alexander R. Fabbri and
Zifan Li and
Luyao Chen and
Yuwen Zhang and
Shreya Dixit and
Vincent Zhang and
Caiming Xiong and
Richard Socher and
Walter S. Lasecki and
Dragomir R. Radev},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {CoSQL: {A} Conversational Text-to-SQL Challenge Towards Cross-Domain
Natural Language Interfaces to Databases},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {1962--1979},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1204},
doi = {10.18653/V1/D19-1204},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/YuZELXPLTSLJYSC19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ZhangYESXLSXSR19,
author = {Rui Zhang and
Tao Yu and
Heyang Er and
Sungrok Shim and
Eric Xue and
Xi Victoria Lin and
Tianze Shi and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
editor = {Kentaro Inui and
Jing Jiang and
Vincent Ng and
Xiaojun Wan},
title = {Editing-Based {SQL} Query Generation for Cross-Domain Context-Dependent
Questions},
booktitle = {Proceedings of the 2019 Conference on Empirical Methods in Natural
Language Processing and the 9th International Joint Conference on
Natural Language Processing, {EMNLP-IJCNLP} 2019, Hong Kong, China,
November 3-7, 2019},
pages = {5337--5348},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/D19-1537},
doi = {10.18653/V1/D19-1537},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/emnlp/ZhangYESXLSXSR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evia/OardCGBNNSXZMMK19,
author = {Douglas W. Oard and
Marine Carpuat and
Petra Galusc{\'{a}}kov{\'{a}} and
Joseph Barrow and
Suraj Nair and
Xing Niu and
Han{-}Chin Shing and
Weijia Xu and
Elena Zotkina and
Kathleen R. McKeown and
Smaranda Muresan and
Efsun Selin Kayi and
Ramy Eskander and
Chris Kedzie and
Yan Virin and
Dragomir R. Radev and
Rui Zhang and
Mark J. F. Gales and
Anton Ragni and
Kenneth Heafield},
editor = {Nicola Ferro and
Ian Soboroff and
Min Zhang},
title = {Surprise Languages: Rapid-Response Cross-Language {IR}},
booktitle = {Proceedings of the 9th International Workshop on Evaluating Information
Access co-located with the 14th {NTCIR} Conference on the Evaluation
of Information Access Technologies {(NTCIR} 2019), Tokyo, Japan, June
10, 2019},
year = {2019},
url = {https://research.nii.ac.jp/ntcir/workshop/OnlineProceedings14/pdf/evia/04-EVIA2019-EVIA-OardD.pdf},
timestamp = {Mon, 11 Dec 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/evia/OardCGBNNSXZMMK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/KasaiFFRR19,
author = {Jungo Kasai and
Dan Friedman and
Robert Frank and
Dragomir R. Radev and
Owen Rambow},
editor = {Jill Burstein and
Christy Doran and
Thamar Solorio},
title = {Syntax-aware Neural Semantic Role Labeling with Supertags},
booktitle = {Proceedings of the 2019 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2019, Minneapolis, MN, USA, June 2-7, 2019, Volume 1 (Long
and Short Papers)},
pages = {701--709},
publisher = {Association for Computational Linguistics},
year = {2019},
url = {https://doi.org/10.18653/v1/n19-1075},
doi = {10.18653/V1/N19-1075},
timestamp = {Mon, 30 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/KasaiFFRR19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ChandrasekaranY19,
author = {Muthu Kumar Chandrasekaran and
Michihiro Yasunaga and
Dragomir R. Radev and
Dayne Freitag and
Min{-}Yen Kan},
editor = {Muthu Kumar Chandrasekaran and
Philipp Mayr},
title = {Overview and Results: CL-SciSumm Shared Task 2019},
booktitle = {Proceedings of the 4th Joint Workshop on Bibliometric-enhanced Information
Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
2019) co-located with the 42nd International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval {(SIGIR} 2019),
Paris, France, July 25, 2019},
series = {{CEUR} Workshop Proceedings},
volume = {2414},
pages = {153--166},
publisher = {CEUR-WS.org},
year = {2019},
url = {https://ceur-ws.org/Vol-2414/paper17.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:17 +0100},
biburl = {https://dblp.org/rec/conf/sigir/ChandrasekaranY19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ChandrasekaranM19,
author = {Muthu Kumar Chandrasekaran and
Philipp Mayr and
Michihiro Yasunaga and
Dayne Freitag and
Dragomir R. Radev and
Min{-}Yen Kan},
editor = {Benjamin Piwowarski and
Max Chevalier and
{\'{E}}ric Gaussier and
Yoelle Maarek and
Jian{-}Yun Nie and
Falk Scholer},
title = {Joint Workshop on Bibliometric-enhanced Information Retrieval and
Natural Language Processing for Digital Libraries {(BIRNDL} 2019)},
booktitle = {Proceedings of the 42nd International {ACM} {SIGIR} Conference on
Research and Development in Information Retrieval, {SIGIR} 2019, Paris,
France, July 21-25, 2019},
pages = {1441--1443},
publisher = {{ACM}},
year = {2019},
url = {https://doi.org/10.1145/3331184.3331650},
doi = {10.1145/3331184.3331650},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigir/ChandrasekaranM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-05260,
author = {Jungo Kasai and
Dan Friedman and
Robert Frank and
Dragomir R. Radev and
Owen Rambow},
title = {Syntax-aware Neural Semantic Role Labeling with Supertags},
journal = {CoRR},
volume = {abs/1903.05260},
year = {2019},
url = {http://arxiv.org/abs/1903.05260},
eprinttype = {arXiv},
eprint = {1903.05260},
timestamp = {Mon, 30 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1903-05260.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-01749,
author = {Alexander R. Fabbri and
Irene Li and
Tianwei She and
Suyi Li and
Dragomir R. Radev},
title = {Multi-News: a Large-Scale Multi-Document Summarization Dataset and
Abstractive Hierarchical Model},
journal = {CoRR},
volume = {abs/1906.01749},
year = {2019},
url = {http://arxiv.org/abs/1906.01749},
eprinttype = {arXiv},
eprint = {1906.01749},
timestamp = {Thu, 13 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-01749.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-02285,
author = {Tao Yu and
Rui Zhang and
Michihiro Yasunaga and
Yi Chern Tan and
Xi Victoria Lin and
Suyi Li and
Heyang Er and
Irene Li and
Bo Pang and
Tao Chen and
Emily Ji and
Shreya Dixit and
David Proctor and
Sungrok Shim and
Jonathan Kraft and
Vincent Zhang and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
title = {SParC: Cross-Domain Semantic Parsing in Context},
journal = {CoRR},
volume = {abs/1906.02285},
year = {2019},
url = {http://arxiv.org/abs/1906.02285},
eprinttype = {arXiv},
eprint = {1906.02285},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-02285.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-03492,
author = {Rui Zhang and
Caitlin Westerfield and
Sungrok Shim and
Garrett Bingham and
Alexander R. Fabbri and
Neha Verma and
William Hu and
Dragomir R. Radev},
title = {Improving Low-Resource Cross-lingual Document Retrieval by Reranking
with Deep Bilingual Representations},
journal = {CoRR},
volume = {abs/1906.03492},
year = {2019},
url = {http://arxiv.org/abs/1906.03492},
eprinttype = {arXiv},
eprint = {1906.03492},
timestamp = {Fri, 06 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-03492.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-10910,
author = {Youngnam Lee and
Youngduck Choi and
Junghyun Cho and
Alexander R. Fabbri and
Hyunbin Loh and
Chanyou Hwang and
Yongku Lee and
Sang{-}Wook Kim and
Dragomir R. Radev},
title = {Creating {A} Neural Pedagogical Agent by Jointly Learning to Review
and Assess},
journal = {CoRR},
volume = {abs/1906.10910},
year = {2019},
url = {http://arxiv.org/abs/1906.10910},
eprinttype = {arXiv},
eprint = {1906.10910},
timestamp = {Thu, 27 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1906-10910.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-09854,
author = {Muthu Kumar Chandrasekaran and
Michihiro Yasunaga and
Dragomir R. Radev and
Dayne Freitag and
Min{-}Yen Kan},
title = {Overview and Results: CL-SciSumm Shared Task 2019},
journal = {CoRR},
volume = {abs/1907.09854},
year = {2019},
url = {http://arxiv.org/abs/1907.09854},
eprinttype = {arXiv},
eprint = {1907.09854},
timestamp = {Tue, 30 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1907-09854.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-00764,
author = {Kokil Jaidka and
Michihiro Yasunaga and
Muthu Kumar Chandrasekaran and
Dragomir R. Radev and
Min{-}Yen Kan},
title = {The CL-SciSumm Shared Task 2018: Results and Key Insights},
journal = {CoRR},
volume = {abs/1909.00764},
year = {2019},
url = {http://arxiv.org/abs/1909.00764},
eprinttype = {arXiv},
eprint = {1909.00764},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-00764.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-00786,
author = {Rui Zhang and
Tao Yu and
Heyang Er and
Sungrok Shim and
Eric Xue and
Xi Victoria Lin and
Tianze Shi and
Caiming Xiong and
Richard Socher and
Dragomir R. Radev},
title = {Editing-Based {SQL} Query Generation for Cross-Domain Context-Dependent
Questions},
journal = {CoRR},
volume = {abs/1909.00786},
year = {2019},
url = {http://arxiv.org/abs/1909.00786},
eprinttype = {arXiv},
eprint = {1909.00786},
timestamp = {Thu, 19 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-00786.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-01716,
author = {Michihiro Yasunaga and
Jungo Kasai and
Rui Zhang and
Alexander R. Fabbri and
Irene Li and
Dan Friedman and
Dragomir R. Radev},
title = {ScisummNet: {A} Large Annotated Corpus and Content-Impact Models for
Scientific Paper Summarization with Citation Networks},
journal = {CoRR},
volume = {abs/1909.01716},
year = {2019},
url = {http://arxiv.org/abs/1909.01716},
eprinttype = {arXiv},
eprint = {1909.01716},
timestamp = {Tue, 26 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-01716.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1909-05378,
author = {Tao Yu and
Rui Zhang and
Heyang Er and
Suyi Li and
Eric Xue and
Bo Pang and
Xi Victoria Lin and
Yi Chern Tan and
Tianze Shi and
Zihan Li and
Youxuan Jiang and
Michihiro Yasunaga and
Sungrok Shim and
Tao Chen and
Alexander R. Fabbri and
Zifan Li and
Luyao Chen and
Yuwen Zhang and
Shreya Dixit and
Vincent Zhang and
Caiming Xiong and
Richard Socher and
Walter S. Lasecki and
Dragomir R. Radev},
title = {CoSQL: {A} Conversational Text-to-SQL Challenge Towards Cross-Domain
Natural Language Interfaces to Databases},
journal = {CoRR},
volume = {abs/1909.05378},
year = {2019},
url = {http://arxiv.org/abs/1909.05378},
eprinttype = {arXiv},
eprint = {1909.05378},
timestamp = {Thu, 19 Jan 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1909-05378.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-14076,
author = {Irene Li and
Michihiro Yasunaga and
Muhammed Yavuz Nuzumlali and
Cesar Caraballo and
Shiwani Mahajan and
Harlan M. Krumholz and
Dragomir R. Radev},
title = {A Neural Topic-Attention Model for Medical Term Abbreviation Disambiguation},
journal = {CoRR},
volume = {abs/1910.14076},
year = {2019},
url = {http://arxiv.org/abs/1910.14076},
eprinttype = {arXiv},
eprint = {1910.14076},
timestamp = {Mon, 04 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-14076.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/LogeswaranLR18,
author = {Lajanugen Logeswaran and
Honglak Lee and
Dragomir R. Radev},
editor = {Sheila A. McIlraith and
Kilian Q. Weinberger},
title = {Sentence Ordering and Coherence Modeling using Recurrent Neural Networks},
booktitle = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence,
(AAAI-18), the 30th innovative Applications of Artificial Intelligence
(IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in
Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February
2-7, 2018},
pages = {5285--5292},
publisher = {{AAAI} Press},
year = {2018},
url = {https://doi.org/10.1609/aaai.v32i1.11997},
doi = {10.1609/AAAI.V32I1.11997},
timestamp = {Mon, 04 Sep 2023 12:29:24 +0200},
biburl = {https://dblp.org/rec/conf/aaai/LogeswaranLR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ZhangLPR18,
author = {Rui Zhang and
Honglak Lee and
Lazaros Polymenakos and
Dragomir R. Radev},
editor = {Sheila A. McIlraith and
Kilian Q. Weinberger},
title = {Addressee and Response Selection in Multi-Party Conversations With
Speaker Interaction RNNs},
booktitle = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence,
(AAAI-18), the 30th innovative Applications of Artificial Intelligence
(IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in
Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February
2-7, 2018},
pages = {5690--5697},
publisher = {{AAAI} Press},
year = {2018},
url = {https://doi.org/10.1609/aaai.v32i1.11937},
doi = {10.1609/AAAI.V32I1.11937},
timestamp = {Mon, 04 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ZhangLPR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ZhangSYXR18,
author = {Rui Zhang and
C{\'{\i}}cero Nogueira dos Santos and
Michihiro Yasunaga and
Bing Xiang and
Dragomir R. Radev},
editor = {Iryna Gurevych and
Yusuke Miyao},
title = {Neural Coreference Resolution with Deep Biaffine Attention by Joint
Mention Detection and Mention Clustering},
booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume
2: Short Papers},
pages = {102--107},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/P18-2017/},
doi = {10.18653/V1/P18-2017},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ZhangSYXR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RadevKZZFRS18,
author = {Catherine Finegan{-}Dollak and
Jonathan K. Kummerfeld and
Li Zhang and
Karthik Ramanathan and
Sesh Sadasivam and
Rui Zhang and
Dragomir R. Radev},
editor = {Iryna Gurevych and
Yusuke Miyao},
title = {Improving Text-to-SQL Evaluation Methodology},
booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume
1: Long Papers},
pages = {351--360},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/P18-1033/},
doi = {10.18653/V1/P18-1033},
timestamp = {Fri, 19 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/acl/RadevKZZFRS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RadevFLTHTTW18,
author = {Alexander R. Fabbri and
Irene Li and
Prawat Trairatvorakul and
Yijiao He and
Wei Tai Ting and
Robert Tung and
Caitlin Westerfield and
Dragomir R. Radev},
editor = {Iryna Gurevych and
Yusuke Miyao},
title = {TutorialBank: {A} Manually-Collected Corpus for Prerequisite Chains,
Survey Extraction and Resource Recommendation},
booktitle = {Proceedings of the 56th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2018, Melbourne, Australia, July 15-20, 2018, Volume
1: Long Papers},
pages = {611--620},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://aclanthology.org/P18-1057/},
doi = {10.18653/V1/P18-1057},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RadevFLTHTTW18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/YuYYZWLR18,
author = {Tao Yu and
Michihiro Yasunaga and
Kai Yang and
Rui Zhang and
Dongxu Wang and
Zifan Li and
Dragomir R. Radev},
editor = {Ellen Riloff and
David Chiang and
Julia Hockenmaier and
Jun'ichi Tsujii},
title = {SyntaxSQLNet: Syntax Tree Networks for Complex and Cross-Domain Text-to-SQL
Task},
booktitle = {Proceedings of the 2018 Conference on Empirical Methods in Natural
Language Processing, Brussels, Belgium, October 31 - November 4, 2018},
pages = {1653--1663},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://doi.org/10.18653/v1/d18-1193},
doi = {10.18653/V1/D18-1193},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/YuYYZWLR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/YuZYYWLMLYRZR18,
author = {Tao Yu and
Rui Zhang and
Kai Yang and
Michihiro Yasunaga and
Dongxu Wang and
Zifan Li and
James Ma and
Irene Li and
Qingning Yao and
Shanelle Roman and
Zilin Zhang and
Dragomir R. Radev},
editor = {Ellen Riloff and
David Chiang and
Julia Hockenmaier and
Jun'ichi Tsujii},
title = {Spider: {A} Large-Scale Human-Labeled Dataset for Complex and Cross-Domain
Semantic Parsing and Text-to-SQL Task},
booktitle = {Proceedings of the 2018 Conference on Empirical Methods in Natural
Language Processing, Brussels, Belgium, October 31 - November 4, 2018},
pages = {3911--3921},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://doi.org/10.18653/v1/d18-1425},
doi = {10.18653/V1/D18-1425},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/YuZYYWLMLYRZR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/YuLZZR18,
author = {Tao Yu and
Zifan Li and
Zilin Zhang and
Rui Zhang and
Dragomir R. Radev},
editor = {Marilyn A. Walker and
Heng Ji and
Amanda Stent},
title = {TypeSQL: Knowledge-Based Type-Aware Neural Text-to-SQL Generation},
booktitle = {Proceedings of the 2018 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
NAACL-HLT, New Orleans, Louisiana, USA, June 1-6, 2018, Volume 2 (Short
Papers)},
pages = {588--594},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://doi.org/10.18653/v1/n18-2093},
doi = {10.18653/V1/N18-2093},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/YuLZZR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/YasunagaKR18,
author = {Michihiro Yasunaga and
Jungo Kasai and
Dragomir R. Radev},
editor = {Marilyn A. Walker and
Heng Ji and
Amanda Stent},
title = {Robust Multilingual Part-of-Speech Tagging via Adversarial Training},
booktitle = {Proceedings of the 2018 Conference of the North American Chapter of
the Association for Computational Linguistics: Human Language Technologies,
{NAACL-HLT} 2018, New Orleans, Louisiana, USA, June 1-6, 2018, Volume
1 (Long Papers)},
pages = {976--986},
publisher = {Association for Computational Linguistics},
year = {2018},
url = {https://doi.org/10.18653/v1/n18-1089},
doi = {10.18653/V1/N18-1089},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/YasunagaKR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/JaidkaYCRK18,
author = {Kokil Jaidka and
Michihiro Yasunaga and
Muthu Kumar Chandrasekaran and
Dragomir R. Radev and
Min{-}Yen Kan},
editor = {Philipp Mayr and
Muthu Kumar Chandrasekaran and
Kokil Jaidka},
title = {The CL-SciSumm Shared Task 2018: Results and Key Insights},
booktitle = {Proceedings of the 3rd Joint Workshop on Bibliometric-enhanced Information
Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
2018) co-located with the 41st International {ACM} {SIGIR} Conference
on Research and Development in Information Retrieval {(SIGIR} 2018),
Ann Arbor, USA, July 12, 2018},
series = {{CEUR} Workshop Proceedings},
volume = {2132},
pages = {74--83},
publisher = {CEUR-WS.org},
year = {2018},
url = {https://ceur-ws.org/Vol-2132/paper7.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:16 +0100},
biburl = {https://dblp.org/rec/conf/sigir/JaidkaYCRK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-09769,
author = {Tao Yu and
Zifan Li and
Zilin Zhang and
Rui Zhang and
Dragomir R. Radev},
title = {TypeSQL: Knowledge-based Type-Aware Neural Text-to-SQL Generation},
journal = {CoRR},
volume = {abs/1804.09769},
year = {2018},
url = {http://arxiv.org/abs/1804.09769},
eprinttype = {arXiv},
eprint = {1804.09769},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1804-09769.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-04617,
author = {Alexander R. Fabbri and
Irene Li and
Prawat Trairatvorakul and
Yijiao He and
Wei Tai Ting and
Robert Tung and
Caitlin Westerfield and
Dragomir R. Radev},
title = {TutorialBank: {A} Manually-Collected Corpus for Prerequisite Chains,
Survey Extraction and Resource Recommendation},
journal = {CoRR},
volume = {abs/1805.04617},
year = {2018},
url = {http://arxiv.org/abs/1805.04617},
eprinttype = {arXiv},
eprint = {1805.04617},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-04617.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1805-04893,
author = {Rui Zhang and
C{\'{\i}}cero Nogueira dos Santos and
Michihiro Yasunaga and
Bing Xiang and
Dragomir R. Radev},
title = {Neural Coreference Resolution with Deep Biaffine Attention by Joint
Mention Detection and Mention Clustering},
journal = {CoRR},
volume = {abs/1805.04893},
year = {2018},
url = {http://arxiv.org/abs/1805.04893},
eprinttype = {arXiv},
eprint = {1805.04893},
timestamp = {Tue, 26 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1805-04893.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1806-09029,
author = {Catherine Finegan{-}Dollak and
Jonathan K. Kummerfeld and
Li Zhang and
Karthik Ramanathan and
Sesh Sadasivam and
Rui Zhang and
Dragomir R. Radev},
title = {Improving Text-to-SQL Evaluation Methodology},
journal = {CoRR},
volume = {abs/1806.09029},
year = {2018},
url = {http://arxiv.org/abs/1806.09029},
eprinttype = {arXiv},
eprint = {1806.09029},
timestamp = {Fri, 19 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1806-09029.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1808-09889,
author = {Javid Dadashkarimi and
Alexander R. Fabbri and
Sekhar Tatikonda and
Dragomir R. Radev},
title = {Zero-shot Transfer Learning for Semantic Parsing},
journal = {CoRR},
volume = {abs/1808.09889},
year = {2018},
url = {http://arxiv.org/abs/1808.09889},
eprinttype = {arXiv},
eprint = {1808.09889},
timestamp = {Mon, 03 Sep 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1808-09889.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-08887,
author = {Tao Yu and
Rui Zhang and
Kai Yang and
Michihiro Yasunaga and
Dongxu Wang and
Zifan Li and
James Ma and
Irene Li and
Qingning Yao and
Shanelle Roman and
Zilin Zhang and
Dragomir R. Radev},
title = {Spider: {A} Large-Scale Human-Labeled Dataset for Complex and Cross-Domain
Semantic Parsing and Text-to-SQL Task},
journal = {CoRR},
volume = {abs/1809.08887},
year = {2018},
url = {http://arxiv.org/abs/1809.08887},
eprinttype = {arXiv},
eprint = {1809.08887},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1809-08887.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1810-05237,
author = {Tao Yu and
Michihiro Yasunaga and
Kai Yang and
Rui Zhang and
Dongxu Wang and
Zifan Li and
Dragomir R. Radev},
title = {SyntaxSQLNet: Syntax Tree Networks for Complex and Cross-DomainText-to-SQL
Task},
journal = {CoRR},
volume = {abs/1810.05237},
year = {2018},
url = {http://arxiv.org/abs/1810.05237},
eprinttype = {arXiv},
eprint = {1810.05237},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1810-05237.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-12181,
author = {Irene Li and
Alexander R. Fabbri and
Robert R. Tung and
Dragomir R. Radev},
title = {What Should {I} Learn First: Introducing LectureBank for {NLP} Education
and Prerequisite Chain Learning},
journal = {CoRR},
volume = {abs/1811.12181},
year = {2018},
url = {http://arxiv.org/abs/1811.12181},
eprinttype = {arXiv},
eprint = {1811.12181},
timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-12181.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nle/JhaAQR17,
author = {Rahul Jha and
Amjad Abu{-}Jbara and
Vahed Qazvinian and
Dragomir R. Radev},
title = {NLP-driven citation analysis for scientometrics},
journal = {Nat. Lang. Eng.},
volume = {23},
number = {1},
pages = {93--130},
year = {2017},
url = {https://doi.org/10.1017/S1351324915000443},
doi = {10.1017/S1351324915000443},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nle/JhaAQR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conll/YasunagaZMPSR17,
author = {Michihiro Yasunaga and
Rui Zhang and
Kshitijh Meelu and
Ayush Pareek and
Krishnan Srinivasan and
Dragomir R. Radev},
editor = {Roger Levy and
Lucia Specia},
title = {Graph-based Neural Multi-Document Summarization},
booktitle = {Proceedings of the 21st Conference on Computational Natural Language
Learning (CoNLL 2017), Vancouver, Canada, August 3-4, 2017},
pages = {452--462},
publisher = {Association for Computational Linguistics},
year = {2017},
url = {https://doi.org/10.18653/v1/K17-1045},
doi = {10.18653/V1/K17-1045},
timestamp = {Fri, 06 Aug 2021 00:41:08 +0200},
biburl = {https://dblp.org/rec/conf/conll/YasunagaZMPSR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/YasunagaZMPSR17,
author = {Michihiro Yasunaga and
Rui Zhang and
Kshitijh Meelu and
Ayush Pareek and
Krishnan Srinivasan and
Dragomir R. Radev},
title = {Graph-based Neural Multi-Document Summarization},
journal = {CoRR},
volume = {abs/1706.06681},
year = {2017},
url = {http://arxiv.org/abs/1706.06681},
eprinttype = {arXiv},
eprint = {1706.06681},
timestamp = {Tue, 26 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/YasunagaZMPSR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1709-04005,
author = {Rui Zhang and
Honglak Lee and
Lazaros Polymenakos and
Dragomir R. Radev},
title = {Addressee and Response Selection in Multi-Party Conversations with
Speaker Interaction RNNs},
journal = {CoRR},
volume = {abs/1709.04005},
year = {2017},
url = {http://arxiv.org/abs/1709.04005},
eprinttype = {arXiv},
eprint = {1709.04005},
timestamp = {Tue, 26 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1709-04005.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1711-04903,
author = {Michihiro Yasunaga and
Jungo Kasai and
Dragomir R. Radev},
title = {Robust Multilingual Part-of-Speech Tagging via Adversarial Training},
journal = {CoRR},
volume = {abs/1711.04903},
year = {2017},
url = {http://arxiv.org/abs/1711.04903},
eprinttype = {arXiv},
eprint = {1711.04903},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1711-04903.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RadevJGM16,
author = {Dragomir R. Radev and
Mark Thomas Joseph and
Bryan R. Gibson and
Pradeep Muthukrishnan},
title = {A bibliometric and network analysis of the field of computational
linguistics},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {67},
number = {3},
pages = {683--706},
year = {2016},
url = {https://doi.org/10.1002/asi.23394},
doi = {10.1002/ASI.23394},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/RadevJGM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Finegan-DollakR16,
author = {Catherine Finegan{-}Dollak and
Dragomir R. Radev},
title = {Sentence simplification, compression, and disaggregation for summarization
of sophisticated documents},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {67},
number = {10},
pages = {2437--2453},
year = {2016},
url = {https://doi.org/10.1002/asi.23576},
doi = {10.1002/ASI.23576},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/Finegan-DollakR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/McKeownDCPTBBBC16,
author = {Kathy McKeown and
Hal Daum{\'{e}} III and
Snigdha Chaturvedi and
John Paparrizos and
Kapil Thadani and
Pablo Barrio and
Or Biran and
Suvarna Bothe and
Michael Collins and
Kenneth R. Fleischmann and
Luis Gravano and
Rahul Jha and
Ben King and
Kevin McInerney and
Taesun Moon and
Arvind Neelakantan and
Diarmuid {\'{O}} S{\'{e}}aghdha and
Dragomir R. Radev and
Thomas Clay Templeton and
Simone Teufel},
title = {Predicting the impact of scientific concepts using full-text features},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {67},
number = {11},
pages = {2684--2696},
year = {2016},
url = {https://doi.org/10.1002/asi.23612},
doi = {10.1002/ASI.23612},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/McKeownDCPTBBBC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Finegan-DollakC16,
author = {Catherine Finegan{-}Dollak and
Reed Coke and
Rui Zhang and
Xiangyi Ye and
Dragomir R. Radev},
title = {Effects of Creativity and Cluster Tightness on Short Text Clustering
Performance},
booktitle = {Proceedings of the 54th Annual Meeting of the Association for Computational
Linguistics, {ACL} 2016, August 7-12, 2016, Berlin, Germany, Volume
1: Long Papers},
publisher = {The Association for Computer Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/p16-1062},
doi = {10.18653/V1/P16-1062},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Finegan-DollakC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/BhutaniJR16,
author = {Nikita Bhutani and
H. V. Jagadish and
Dragomir R. Radev},
editor = {Jian Su and
Xavier Carreras and
Kevin Duh},
title = {Nested Propositions in Open Information Extraction},
booktitle = {Proceedings of the 2016 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2016, Austin, Texas, USA, November 1-4,
2016},
pages = {55--64},
publisher = {The Association for Computational Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/d16-1006},
doi = {10.18653/V1/D16-1006},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/BhutaniJR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icbo/OzgurHXORH16,
author = {Arzucan {\"{O}}zg{\"{u}}r and
Junguk Hur and
Zuoshuang Xiang and
Edison Ong and
Dragomir R. Radev and
Yongqun He},
editor = {Pankaj Jaiswal and
Robert Hoehndorf and
Cecilia N. Arighi and
Austin Meier},
title = {Ignet: {A} Centrality and INO-based Web System for Analyzing and Visualizing
Literature-mined Networks},
booktitle = {Proceedings of the Joint International Conference on Biological Ontology
and BioCreative, Corvallis, Oregon, United States, August 1-4, 2016},
series = {{CEUR} Workshop Proceedings},
volume = {1747},
publisher = {CEUR-WS.org},
year = {2016},
url = {https://ceur-ws.org/Vol-1747/BP01\_ICBO2016.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:23 +0100},
biburl = {https://dblp.org/rec/conf/icbo/OzgurHXORH16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/MehdadSTRBB16,
author = {Yashar Mehdad and
Amanda Stent and
Kapil Thadani and
Dragomir R. Radev and
Youssef Billawala and
Karolina Buchner},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Sara Goggi and
Marko Grobelnik and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Extractive Summarization under Strict Length Constraints},
booktitle = {Proceedings of the Tenth International Conference on Language Resources
and Evaluation {LREC} 2016, Portoro{\v{z}}, Slovenia, May 23-28, 2016},
publisher = {European Language Resources Association {(ELRA)}},
year = {2016},
url = {http://www.lrec-conf.org/proceedings/lrec2016/summaries/311.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/MehdadSTRBB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/OzatesOR16,
author = {Saziye Bet{\"{u}}l {\"{O}}zates and
Arzucan {\"{O}}zg{\"{u}}r and
Dragomir R. Radev},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Sara Goggi and
Marko Grobelnik and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Sentence Similarity based on Dependency Tree Kernels for Multi-document
Summarization},
booktitle = {Proceedings of the Tenth International Conference on Language Resources
and Evaluation {LREC} 2016, Portoro{\v{z}}, Slovenia, May 23-28, 2016},
publisher = {European Language Resources Association {(ELRA)}},
year = {2016},
url = {http://www.lrec-conf.org/proceedings/lrec2016/summaries/617.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/OzatesOR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/RadevSTPICJVJJM16,
author = {Dragomir R. Radev and
Amanda Stent and
Joel R. Tetreault and
Aasish Pappu and
Aikaterini Iliakopoulou and
Agustin Chanfreau and
Paloma de Juan and
Jordi Vallmitjana and
Alejandro Jaimes and
Rahul Jha and
Robert Mankoff},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Thierry Declerck and
Sara Goggi and
Marko Grobelnik and
Bente Maegaard and
Joseph Mariani and
H{\'{e}}l{\`{e}}ne Mazo and
Asunci{\'{o}}n Moreno and
Jan Odijk and
Stelios Piperidis},
title = {Humor in Collective Discourse: Unsupervised Funniness Detection in
the New Yorker Cartoon Caption Contest},
booktitle = {Proceedings of the Tenth International Conference on Language Resources
and Evaluation {LREC} 2016, Portoro{\v{z}}, Slovenia, May 23-28, 2016},
publisher = {European Language Resources Association {(ELRA)}},
year = {2016},
url = {http://www.lrec-conf.org/proceedings/lrec2016/summaries/317.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/RadevSTPICJVJJM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/WangMRS16,
author = {William Yang Wang and
Yashar Mehdad and
Dragomir R. Radev and
Amanda Stent},
editor = {Kevin Knight and
Ani Nenkova and
Owen Rambow},
title = {A Low-Rank Approximation Approach to Learning Joint Embeddings of
News Stories and Images for Timeline Summarization},
booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter
of the Association for Computational Linguistics: Human Language Technologies,
San Diego California, USA, June 12-17, 2016},
pages = {58--68},
publisher = {The Association for Computational Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/n16-1008},
doi = {10.18653/V1/N16-1008},
timestamp = {Fri, 25 Nov 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/naacl/WangMRS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/ZhangLR16,
author = {Rui Zhang and
Honglak Lee and
Dragomir R. Radev},
editor = {Kevin Knight and
Ani Nenkova and
Owen Rambow},
title = {Dependency Sensitive Convolutional Neural Networks for Modeling Sentences
and Documents},
booktitle = {{NAACL} {HLT} 2016, The 2016 Conference of the North American Chapter
of the Association for Computational Linguistics: Human Language Technologies,
San Diego California, USA, June 12-17, 2016},
pages = {1512--1521},
publisher = {The Association for Computational Linguistics},
year = {2016},
url = {https://doi.org/10.18653/v1/n16-1177},
doi = {10.18653/V1/N16-1177},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/ZhangLR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/CokeKR16,
author = {Reed Coke and
Ben King and
Dragomir R. Radev},
title = {Classifying Syntactic Regularities for Hundreds of Languages},
journal = {CoRR},
volume = {abs/1603.08016},
year = {2016},
url = {http://arxiv.org/abs/1603.08016},
eprinttype = {arXiv},
eprint = {1603.08016},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/CokeKR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangLR16,
author = {Rui Zhang and
Honglak Lee and
Dragomir R. Radev},
title = {Dependency Sensitive Convolutional Neural Networks for Modeling Sentences
and Documents},
journal = {CoRR},
volume = {abs/1611.02361},
year = {2016},
url = {http://arxiv.org/abs/1611.02361},
eprinttype = {arXiv},
eprint = {1611.02361},
timestamp = {Tue, 26 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/ZhangLR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LogeswaranLR16,
author = {Lajanugen Logeswaran and
Honglak Lee and
Dragomir R. Radev},
title = {Sentence Ordering using Recurrent Neural Networks},
journal = {CoRR},
volume = {abs/1611.02654},
year = {2016},
url = {http://arxiv.org/abs/1611.02654},
eprinttype = {arXiv},
eprint = {1611.02654},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/LogeswaranLR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nle/NastaseMR15,
author = {Vivi Nastase and
Rada Mihalcea and
Dragomir R. Radev},
title = {A survey of graphs in natural language processing},
journal = {Nat. Lang. Eng.},
volume = {21},
number = {5},
pages = {665--698},
year = {2015},
url = {https://doi.org/10.1017/S1351324915000340},
doi = {10.1017/S1351324915000340},
timestamp = {Wed, 25 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/nle/NastaseMR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/JhaCR15,
author = {Rahul Jha and
Reed Coke and
Dragomir R. Radev},
editor = {Blai Bonet and
Sven Koenig},
title = {Surveyor: {A} System for Generating Coherent Survey Articles for Scientific
Topics},
booktitle = {Proceedings of the Twenty-Ninth {AAAI} Conference on Artificial Intelligence,
January 25-30, 2015, Austin, Texas, {USA}},
pages = {2167--2173},
publisher = {{AAAI} Press},
year = {2015},
url = {https://doi.org/10.1609/aaai.v29i1.9495},
doi = {10.1609/AAAI.V29I1.9495},
timestamp = {Mon, 18 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/aaai/JhaCR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/JhaFKCR15,
author = {Rahul Jha and
Catherine Finegan{-}Dollak and
Ben King and
Reed Coke and
Dragomir R. Radev},
title = {Content Models for Survey Generation: {A} Factoid-Based Evaluation},
booktitle = {Proceedings of the 53rd Annual Meeting of the Association for Computational
Linguistics and the 7th International Joint Conference on Natural
Language Processing of the Asian Federation of Natural Language Processing,
{ACL} 2015, July 26-31, 2015, Beijing, China, Volume 1: Long Papers},
pages = {441--450},
publisher = {The Association for Computer Linguistics},
year = {2015},
url = {https://doi.org/10.3115/v1/p15-1043},
doi = {10.3115/V1/P15-1043},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/JhaFKCR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/RadevSTPICJVJJM15,
author = {Dragomir R. Radev and
Amanda Stent and
Joel R. Tetreault and
Aasish Pappu and
Aikaterini Iliakopoulou and
Agustin Chanfreau and
Paloma de Juan and
Jordi Vallmitjana and
Alejandro Jaimes and
Rahul Jha and
Robert Mankoff},
title = {Humor in Collective Discourse: Unsupervised Funniness Detection in
the New Yorker Cartoon Caption Contest},
journal = {CoRR},
volume = {abs/1506.08126},
year = {2015},
url = {http://arxiv.org/abs/1506.08126},
eprinttype = {arXiv},
eprint = {1506.08126},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/RadevSTPICJVJJM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/AwadallahALR14,
author = {Ahmed Hassan Awadallah and
Amjad Abu{-}Jbara and
Wanchen Lu and
Dragomir R. Radev},
title = {A Random Walk-Based Model for Identifying Semantic Orientation},
journal = {Comput. Linguistics},
volume = {40},
number = {3},
pages = {539--562},
year = {2014},
url = {https://doi.org/10.1162/COLI\_a\_00192},
doi = {10.1162/COLI\_A\_00192},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/coling/AwadallahALR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tacl/KingJR14,
author = {Ben King and
Rahul Jha and
Dragomir R. Radev},
title = {Heterogeneous Networks and Their Applications: Scientometrics, Name
Disambiguation, and Topic Modeling},
journal = {Trans. Assoc. Comput. Linguistics},
volume = {2},
pages = {1--14},
year = {2014},
url = {https://doi.org/10.1162/tacl\_a\_00161},
doi = {10.1162/TACL\_A\_00161},
timestamp = {Fri, 10 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/tacl/KingJR14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vardial/KingRA14,
author = {Ben King and
Dragomir R. Radev and
Steven P. Abney},
editor = {Marcos Zampieri and
Liling Tan and
Nikola Ljubesic and
J{\"{o}}rg Tiedemann},
title = {Experiments in Sentence Language Identification with Groups of Similar
Languages},
booktitle = {Proceedings of the First Workshop on Applying {NLP} Tools to Similar
Languages, Varieties and Dialects, VarDial@COLING 2014, Dublin, Ireland,
August 23, 2014},
pages = {146--154},
publisher = {Association for Computational Linguistics and Dublin City University},
year = {2014},
url = {https://doi.org/10.3115/v1/W14-5317},
doi = {10.3115/V1/W14-5317},
timestamp = {Fri, 06 Aug 2021 00:41:20 +0200},
biburl = {https://dblp.org/rec/conf/vardial/KingRA14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/QazvinianRMDZWM14,
author = {Vahed Qazvinian and
Dragomir R. Radev and
Saif M. Mohammad and
Bonnie J. Dorr and
David M. Zajic and
Michael Whidby and
Taesun Moon},
title = {Generating Extractive Summaries of Scientific Paradigms},
journal = {CoRR},
volume = {abs/1402.0556},
year = {2014},
url = {http://arxiv.org/abs/1402.0556},
eprinttype = {arXiv},
eprint = {1402.0556},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/QazvinianRMDZWM14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/Radev13,
author = {Dragomir R. Radev},
title = {Puzzles in Logic, Languages and Computation - The Red Book},
volume = {1},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-34378-0},
doi = {10.1007/978-3-642-34378-0},
isbn = {978-3-642-34377-3},
timestamp = {Tue, 26 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/sp/Radev13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jair/QazvinianRMDZWM13,
author = {Vahed Qazvinian and
Dragomir R. Radev and
Saif M. Mohammad and
Bonnie J. Dorr and
David M. Zajic and
Michael Whidby and
Taesun Moon},
title = {Generating Extractive Summaries of Scientific Paradigms},
journal = {J. Artif. Intell. Res.},
volume = {46},
pages = {165--201},
year = {2013},
url = {https://doi.org/10.1613/jair.3732},
doi = {10.1613/JAIR.3732},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jair/QazvinianRMDZWM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lre/RadevMQA13,
author = {Dragomir R. Radev and
Pradeep Muthukrishnan and
Vahed Qazvinian and
Amjad Abu{-}Jbara},
title = {The {ACL} anthology network corpus},
journal = {Lang. Resour. Evaluation},
volume = {47},
number = {4},
pages = {919--944},
year = {2013},
url = {https://doi.org/10.1007/s10579-012-9211-2},
doi = {10.1007/S10579-012-9211-2},
timestamp = {Thu, 05 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/lre/RadevMQA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/KingJRM13,
author = {Ben King and
Rahul Jha and
Dragomir R. Radev and
Robert Mankoff},
title = {Random Walk Factoid Annotation for Collective Discourse},
booktitle = {Proceedings of the 51st Annual Meeting of the Association for Computational
Linguistics, {ACL} 2013, 4-9 August 2013, Sofia, Bulgaria, Volume
2: Short Papers},
pages = {249--254},
publisher = {The Association for Computer Linguistics},
year = {2013},
url = {https://aclanthology.org/P13-2045/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/KingJRM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/JhaAR13,
author = {Rahul Jha and
Amjad Abu{-}Jbara and
Dragomir R. Radev},
title = {A System for Summarizing Scientific Topics Starting from Keywords},
booktitle = {Proceedings of the 51st Annual Meeting of the Association for Computational
Linguistics, {ACL} 2013, 4-9 August 2013, Sofia, Bulgaria, Volume
2: Short Papers},
pages = {572--577},
publisher = {The Association for Computer Linguistics},
year = {2013},
url = {https://aclanthology.org/P13-2102/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/JhaAR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Abu-JbaraKDR13,
author = {Amjad Abu{-}Jbara and
Ben King and
Mona T. Diab and
Dragomir R. Radev},
title = {Identifying Opinion Subgroups in Arabic Online Discussions},
booktitle = {Proceedings of the 51st Annual Meeting of the Association for Computational
Linguistics, {ACL} 2013, 4-9 August 2013, Sofia, Bulgaria, Volume
2: Short Papers},
pages = {829--835},
publisher = {The Association for Computer Linguistics},
year = {2013},
url = {https://aclanthology.org/P13-2144/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Abu-JbaraKDR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bea/Abu-JbaraJMR13,
author = {Amjad Abu{-}Jbara and
Rahul Jha and
Eric Morley and
Dragomir R. Radev},
editor = {Joel R. Tetreault and
Jill Burstein and
Claudia Leacock},
title = {Experimental Results on the Native Language Identification Shared
Task},
booktitle = {Proceedings of the Eighth Workshop on Innovative Use of {NLP} for
Building Educational Applications, BEA@NAACL-HLT 2013, June 13, 2013,
Atlanta, Georgia, {USA}},
pages = {82--88},
publisher = {The Association for Computer Linguistics},
year = {2013},
url = {https://aclanthology.org/W13-1710/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bea/Abu-JbaraJMR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Abu-JbaraER13,
author = {Amjad Abu{-}Jbara and
Jefferson Ezra and
Dragomir R. Radev},
editor = {Lucy Vanderwende and
Hal Daum{\'{e}} III and
Katrin Kirchhoff},
title = {Purpose and Polarity of Citation: Towards NLP-based Bibliometrics},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
9-14, 2013, Westin Peachtree Plaza Hotel, Atlanta, Georgia, {USA}},
pages = {596--606},
publisher = {The Association for Computational Linguistics},
year = {2013},
url = {https://aclanthology.org/N13-1067/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Abu-JbaraER13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RadevA12,
author = {Dragomir R. Radev and
Amjad Abu{-}Jbara},
editor = {Rafael E. Banchs},
title = {Rediscovering {ACL} Discoveries Through the Lens of {ACL} Anthology
Network Citing Sentences},
booktitle = {Proceedings of the Special Workshop on Rediscovering 50 Years of Discoveries@ACL
2012, Jeju Island, Korea, July 10, 2012},
pages = {1--12},
publisher = {Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/W12-3201/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RadevA12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Abu-JbaraR12,
author = {Amjad Abu{-}Jbara and
Dragomir R. Radev},
title = {Subgroup Detector: {A} System for Detecting Subgroups in Online Discussions},
booktitle = {The 50th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the System Demonstrations, July 10, 2012, Jeju Island,
Korea},
pages = {133--138},
publisher = {The Association for Computer Linguistics},
year = {2012},
url = {https://aclanthology.org/P12-3023/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Abu-JbaraR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Abu-JbaraDDR12,
author = {Amjad Abu{-}Jbara and
Pradeep Dasigi and
Mona T. Diab and
Dragomir R. Radev},
title = {Subgroup Detection in Ideological Discussions},
booktitle = {The 50th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the Conference, July 8-14, 2012, Jeju Island, Korea
- Volume 1: Long Papers},
pages = {399--409},
publisher = {The Association for Computer Linguistics},
year = {2012},
url = {https://aclanthology.org/P12-1042/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Abu-JbaraDDR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/HassanAR12,
author = {Ahmed Hassan Awadallah and
Amjad Abu{-}Jbara and
Dragomir R. Radev},
editor = {Jun'ichi Tsujii and
James Henderson and
Marius Pasca},
title = {Detecting Subgroups in Online Discussions by Modeling Positive and
Negative Relations among Participants},
booktitle = {Proceedings of the 2012 Joint Conference on Empirical Methods in Natural
Language Processing and Computational Natural Language Learning, EMNLP-CoNLL
2012, July 12-14, 2012, Jeju Island, Korea},
pages = {59--70},
publisher = {{ACL}},
year = {2012},
url = {https://aclanthology.org/D12-1006/},
timestamp = {Thu, 14 Apr 2022 16:28:48 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/HassanAR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Abu-JbaraHR12,
author = {Amjad Abu{-}Jbara and
Ahmed Hassan Awadallah and
Dragomir R. Radev},
title = {AttitudeMiner: Mining Attitude from Online Discussions},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
3-8, 2012, Montr{\'{e}}al, Canada},
pages = {33--36},
publisher = {The Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/N12-3009/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Abu-JbaraHR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/Abu-JbaraR12,
author = {Amjad Abu{-}Jbara and
Dragomir R. Radev},
title = {Reference Scope Identification in Citing Sentences},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
3-8, 2012, Montr{\'{e}}al, Canada},
pages = {80--90},
publisher = {The Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/N12-1009/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/Abu-JbaraR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/starsem/Abu-JbaraR12,
author = {Amjad Abu{-}Jbara and
Dragomir R. Radev},
editor = {Eneko Agirre and
Johan Bos and
Mona T. Diab},
title = {UMichigan: {A} Conditional Random Field Model for Resolving the Scope
of Negation},
booktitle = {Proceedings of the First Joint Conference on Lexical and Computational
Semantics, *SEM 2012, June 7-8, 2012, Montr{\'{e}}al, Canada},
pages = {328--334},
publisher = {Association for Computational Linguistics},
year = {2012},
url = {https://aclanthology.org/S12-1043/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/starsem/Abu-JbaraR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/textgraphs/AwadallahAR12,
author = {Ahmed Hassan Awadallah and
Amjad Abu{-}Jbara and
Dragomir R. Radev},
editor = {Irina Matveeva and
Ga{\"{e}}l Dias and
Ahmed Hassan},
title = {Extracting Signed Social Networks from Text},
booktitle = {Proceedings of TextGraphs@ACL 2012: the 7th Workshop on Graph-based
Methods for Natural Language Processing, July 13, 2012, Jeju, Republic
of Korea},
pages = {6--14},
publisher = {The Association for Computer Linguistics},
year = {2012},
url = {https://aclanthology.org/W12-4102/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/textgraphs/AwadallahAR12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1204-3498,
author = {Vahed Qazvinian and
Dragomir R. Radev},
title = {A Computational Analysis of Collective Discourse},
journal = {CoRR},
volume = {abs/1204.3498},
year = {2012},
url = {http://arxiv.org/abs/1204.3498},
eprinttype = {arXiv},
eprint = {1204.3498},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1204-3498.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/OzgurXRH11,
author = {Arzucan {\"{O}}zg{\"{u}}r and
Zuoshuang Xiang and
Dragomir R. Radev and
Yongqun He},
title = {Mining of vaccine-associated IFN-{\(\gamma\)} gene interaction networks
using the Vaccine Ontology},
journal = {J. Biomed. Semant.},
volume = {2},
number = {{S-2}},
pages = {S8},
year = {2011},
url = {http://www.jbiomedsem.com/content/2/S2/S8},
timestamp = {Thu, 13 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/biomedsem/OzgurXRH11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/KanoBGSBHCVRHKBLPPMANPORRSCKPOT11,
author = {Yoshinobu Kano and
Jari Bj{\"{o}}rne and
Filip Ginter and
Tapio Salakoski and
Ekaterina Buyko and
Udo Hahn and
K. Bretonnel Cohen and
Karin Verspoor and
Christophe Roeder and
Lawrence E. Hunter and
Halil Kilicoglu and
Sabine Bergler and
Sofie Van Landeghem and
Thomas Van Parys and
Yves Van de Peer and
Makoto Miwa and
Sophia Ananiadou and
Mariana L. Neves and
Alberto D. Pascual{-}Montano and
Arzucan {\"{O}}zg{\"{u}}r and
Dragomir R. Radev and
Sebastian Riedel and
Rune S{\ae}tre and
Hong{-}Woo Chun and
Jin{-}Dong Kim and
Sampo Pyysalo and
Tomoko Ohta and
Jun'ichi Tsujii},
title = {U-Compare bio-event meta-service: compatible BioNLP event extraction
services},
journal = {{BMC} Bioinform.},
volume = {12},
pages = {481},
year = {2011},
url = {https://doi.org/10.1186/1471-2105-12-481},
doi = {10.1186/1471-2105-12-481},
timestamp = {Thu, 17 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/bmcbi/KanoBGSBHCVRHKBLPPMANPORRSCKPOT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/QazvinianR11,
author = {Vahed Qazvinian and
Dragomir R. Radev},
editor = {Wolfram Burgard and
Dan Roth},
title = {Exploiting Phase Transition in Latent Networks for Clustering},
booktitle = {Proceedings of the Twenty-Fifth {AAAI} Conference on Artificial Intelligence,
{AAAI} 2011, San Francisco, California, USA, August 7-11, 2011},
pages = {908--913},
publisher = {{AAAI} Press},
year = {2011},
url = {https://doi.org/10.1609/aaai.v25i1.7972},
doi = {10.1609/AAAI.V25I1.7972},
timestamp = {Mon, 04 Sep 2023 16:05:54 +0200},
biburl = {https://dblp.org/rec/conf/aaai/QazvinianR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Abu-JbaraR11a,
author = {Amjad Abu{-}Jbara and
Dragomir R. Radev},
title = {Clairlib: {A} Toolkit for Natural Language Processing, Information
Retrieval, and Network Analysis},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA} - System Demonstrations},
pages = {121--126},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-4021/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Abu-JbaraR11a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Abu-JbaraR11,
author = {Amjad Abu{-}Jbara and
Dragomir R. Radev},
editor = {Dekang Lin and
Yuji Matsumoto and
Rada Mihalcea},
title = {Coherent Citation-Based Summarization of Scientific Papers},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA}},
pages = {500--509},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-1051/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Abu-JbaraR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HassanAJR11,
author = {Ahmed Hassan Awadallah and
Amjad Abu{-}Jbara and
Rahul Jha and
Dragomir R. Radev},
title = {Identifying the Semantic Orientation of Foreign Words},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA} - Short Papers},
pages = {592--597},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-2104/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HassanAJR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/QazvinianR11,
author = {Vahed Qazvinian and
Dragomir R. Radev},
editor = {Dekang Lin and
Yuji Matsumoto and
Rada Mihalcea},
title = {Learning From Collective Human Behavior to Introduce Diversity in
Lexical Choice},
booktitle = {The 49th Annual Meeting of the Association for Computational Linguistics:
Human Language Technologies, Proceedings of the Conference, 19-24
June, 2011, Portland, Oregon, {USA}},
pages = {1098--1108},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/P11-1110/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/QazvinianR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/QazvinianRRM11,
author = {Vahed Qazvinian and
Emily Rosengren and
Dragomir R. Radev and
Qiaozhu Mei},
title = {Rumor has it: Identifying Misinformation in Microblogs},
booktitle = {Proceedings of the 2011 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2011, 27-31 July 2011, John McIntyre
Conference Centre, Edinburgh, UK, {A} meeting of SIGDAT, a Special
Interest Group of the {ACL}},
pages = {1589--1599},
publisher = {{ACL}},
year = {2011},
url = {https://aclanthology.org/D11-1147/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/QazvinianRRM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/textgraphs/MuthukrishnanRM11,
author = {Pradeep Muthukrishnan and
Dragomir R. Radev and
Qiaozhu Mei},
title = {Simultaneous Similarity Learning and Feature-Weight Learning for Document
Clustering},
booktitle = {Proceedings of the 2011 Workshop on Graph-based Methods for Natural
Language Processing, TextGraphs-6, June 23, 2011, Portland, Oregon,
{USA}},
pages = {42--50},
publisher = {The Association for Computer Linguistics},
year = {2011},
url = {https://aclanthology.org/W11-1107/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/textgraphs/MuthukrishnanRM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1102-2831,
author = {Madhav Krishna and
Ahmed Hassan Awadallah and
Yang Liu and
Dragomir R. Radev},
title = {The effect of linguistic constraints on the large scale organization
of language},
journal = {CoRR},
volume = {abs/1102.2831},
year = {2011},
url = {http://arxiv.org/abs/1102.2831},
eprinttype = {arXiv},
eprint = {1102.2831},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1102-2831.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1102-5458,
author = {Amruta Joshi and
Junghoo Cho and
Dragomir R. Radev and
Ahmed Hassan Awadallah},
title = {Improving Image Search based on User Created Communities},
journal = {CoRR},
volume = {abs/1102.5458},
year = {2011},
url = {http://arxiv.org/abs/1102.5458},
eprinttype = {arXiv},
eprint = {1102.5458},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1102-5458.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1109-2128,
author = {G{\"{u}}nes Erkan and
Dragomir R. Radev},
title = {LexRank: Graph-based Lexical Centrality as Salience in Text Summarization},
journal = {CoRR},
volume = {abs/1109.2128},
year = {2011},
url = {http://arxiv.org/abs/1109.2128},
eprinttype = {arXiv},
eprint = {1109.2128},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1109-2128.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/HassanR10,
author = {Ahmed Hassan Awadallah and
Dragomir R. Radev},
editor = {Jan Hajic and
Sandra Carberry and
Stephen Clark},
title = {Identifying Text Polarity Using Random Walks},
booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association
for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden},
pages = {395--403},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/P10-1041/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/HassanR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/QazvinianR10,
author = {Vahed Qazvinian and
Dragomir R. Radev},
editor = {Jan Hajic and
Sandra Carberry and
Stephen Clark},
title = {Identifying Non-Explicit Citing Sentences for Citation-Based Summarization},
booktitle = {{ACL} 2010, Proceedings of the 48th Annual Meeting of the Association
for Computational Linguistics, July 11-16, 2010, Uppsala, Sweden},
pages = {555--564},
publisher = {The Association for Computer Linguistics},
year = {2010},
url = {https://aclanthology.org/P10-1057/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/QazvinianR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/QazvinianRO10,
author = {Vahed Qazvinian and
Dragomir R. Radev and
Arzucan {\"{O}}zg{\"{u}}r},
editor = {Chu{-}Ren Huang and
Dan Jurafsky},
title = {Citation Summarization Through Keyphrase Extraction},
booktitle = {{COLING} 2010, 23rd International Conference on Computational Linguistics,
Proceedings of the Conference, 23-27 August 2010, Beijing, China},
pages = {895--903},
publisher = {Tsinghua University Press},
year = {2010},
url = {https://aclanthology.org/C10-1101/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/QazvinianRO10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/HassanQR10,
author = {Ahmed Hassan Awadallah and
Vahed Qazvinian and
Dragomir R. Radev},
title = {What's with the Attitude? Identifying Sentences with Attitude in Online
Discussions},
booktitle = {Proceedings of the 2010 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2010, 9-11 October 2010, {MIT} Stata
Center, Massachusetts, USA, {A} meeting of SIGDAT, a Special Interest
Group of the {ACL}},
pages = {1245--1255},
publisher = {{ACL}},
year = {2010},
url = {https://aclanthology.org/D10-1121/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/HassanQR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/MuthukrishnanRM10,
author = {Pradeep Muthukrishnan and
Dragomir R. Radev and
Qiaozhu Mei},
editor = {Geoffrey I. Webb and
Bing Liu and
Chengqi Zhang and
Dimitrios Gunopulos and
Xindong Wu},
title = {Edge Weight Regularization over Multiple Graphs for Similarity Learning},
booktitle = {{ICDM} 2010, The 10th {IEEE} International Conference on Data Mining,
Sydney, Australia, 14-17 December 2010},
pages = {374--383},
publisher = {{IEEE} Computer Society},
year = {2010},
url = {https://doi.org/10.1109/ICDM.2010.156},
doi = {10.1109/ICDM.2010.156},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/MuthukrishnanRM10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kdd/MeiGR10,
author = {Qiaozhu Mei and
Jian Guo and
Dragomir R. Radev},
editor = {Bharat Rao and
Balaji Krishnapuram and
Andrew Tomkins and
Qiang Yang},
title = {DivRank: the interplay of prestige and diversity in information networks},
booktitle = {Proceedings of the 16th {ACM} {SIGKDD} International Conference on
Knowledge Discovery and Data Mining, Washington, DC, USA, July 25-28,
2010},
pages = {1009--1018},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1835804.1835931},
doi = {10.1145/1835804.1835931},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kdd/MeiGR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/OtterbacherER09,
author = {Jahna Otterbacher and
G{\"{u}}nes Erkan and
Dragomir R. Radev},
title = {Biased LexRank: Passage retrieval using random walks with question-based
priors},
journal = {Inf. Process. Manag.},
volume = {45},
number = {1},
pages = {42--54},
year = {2009},
url = {https://doi.org/10.1016/j.ipm.2008.06.004},
doi = {10.1016/J.IPM.2008.06.004},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/OtterbacherER09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/ArisSQR09,
author = {Aleks Aris and
Ben Shneiderman and
Vahed Qazvinian and
Dragomir R. Radev},
title = {Visual overviews for discovering key papers and influences across
research fronts},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {60},
number = {11},
pages = {2219--2228},
year = {2009},
url = {https://doi.org/10.1002/asi.21160},
doi = {10.1002/ASI.21160},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/ArisSQR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nar/TarceaWABGMWCJOTCMPRASJ09,
author = {V. Glenn Tarcea and
Terry E. Weymouth and
Alexander S. Ade and
Aaron V. Bookvich and
Jing Gao and
Vasudeva Mahavisno and
Zach Wright and
Adriane Chapman and
Magesh Jayapandian and
Arzucan {\"{O}}zg{\"{u}}r and
Yuanyuan Tian and
James D. Cavalcoli and
Barbara Mirel and
Jignesh M. Patel and
Dragomir R. Radev and
Brian D. Athey and
David J. States and
H. V. Jagadish},
title = {Michigan molecular interactions r2: from interacting proteins to pathways},
journal = {Nucleic Acids Res.},
volume = {37},
number = {Database-Issue},
pages = {642--646},
year = {2009},
url = {https://doi.org/10.1093/nar/gkn722},
doi = {10.1093/NAR/GKN722},
timestamp = {Sun, 17 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/nar/TarceaWABGMWCJOTCMPRASJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bionlp/OzgurR09,
author = {Arzucan {\"{O}}zg{\"{u}}r and
Dragomir R. Radev},
title = {Supervised Classification for Extracting Biomedical Events},
booktitle = {Proceedings of the BioNLP 2009 Workshop Companion Volume for Shared
Task, BioNLP@HLT-NAACL 2009 - Shared Task, Boulder, Colorado, USA,
June 5, 2009},
pages = {111--114},
publisher = {Association for Computational Linguistics},
year = {2009},
url = {https://aclanthology.org/W09-1416/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bionlp/OzgurR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/OzgurR09,
author = {Arzucan {\"{O}}zg{\"{u}}r and
Dragomir R. Radev},
title = {Detecting Speculations and their Scopes in Scientific Text},
booktitle = {Proceedings of the 2009 Conference on Empirical Methods in Natural
Language Processing, {EMNLP} 2009, 6-7 August 2009, Singapore, {A}
meeting of SIGDAT, a Special Interest Group of the {ACL}},
pages = {1398--1407},
publisher = {{ACL}},
year = {2009},
url = {https://aclanthology.org/D09-1145/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/OzgurR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwsm/HassanRCJ09,
author = {Ahmed Hassan Awadallah and
Dragomir R. Radev and
Junghoo Cho and
Amruta Joshi},
editor = {Eytan Adar and
Matthew Hurst and
Tim Finin and
Natalie S. Glance and
Nicolas Nicolov and
Belle L. Tseng},
title = {Content Based Recommendation and Summarization in the Blogosphere},
booktitle = {Proceedings of the Third International Conference on Weblogs and Social
Media, {ICWSM} 2009, San Jose, California, USA, May 17-20, 2009},
publisher = {The {AAAI} Press},
year = {2009},
url = {http://aaai.org/ocs/index.php/ICWSM/09/paper/view/203},
timestamp = {Fri, 05 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icwsm/HassanRCJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icwsm/QazvinianR09,
author = {Vahed Qazvinian and
Dragomir R. Radev},
editor = {Eytan Adar and
Matthew Hurst and
Tim Finin and
Natalie S. Glance and
Nicolas Nicolov and
Belle L. Tseng},
title = {The Evolution of Scientific Paper Title Networks},
booktitle = {Proceedings of the Third International Conference on Weblogs and Social
Media, {ICWSM} 2009, San Jose, California, USA, May 17-20, 2009},
publisher = {The {AAAI} Press},
year = {2009},
url = {http://aaai.org/ocs/index.php/ICWSM/09/paper/view/223},
timestamp = {Fri, 05 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icwsm/QazvinianR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/MohammadDEHMQRZ09,
author = {Saif M. Mohammad and
Bonnie J. Dorr and
Melissa Egan and
Ahmed Hassan Awadallah and
Pradeep Muthukrishnan and
Vahed Qazvinian and
Dragomir R. Radev and
David M. Zajic},
title = {Using Citations to Generate surveys of Scientific Paradigms},
booktitle = {Human Language Technologies: Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, May
31 - June 5, 2009, Boulder, Colorado, {USA}},
pages = {584--592},
publisher = {The Association for Computational Linguistics},
year = {2009},
url = {https://aclanthology.org/N09-1066/},
timestamp = {Tue, 03 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/MohammadDEHMQRZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/JardinsGR08,
author = {Marie desJardins and
Matthew E. Gaston and
Dragomir R. Radev},
title = {Introduction to the Special Issue on {AI} and Networks},
journal = {{AI} Mag.},
volume = {29},
number = {3},
pages = {11--15},
year = {2008},
url = {https://doi.org/10.1609/aimag.v29i3.2163},
doi = {10.1609/AIMAG.V29I3.2163},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/JardinsGR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/RadevM08,
author = {Dragomir R. Radev and
Rada Mihalcea},
title = {Networks and Natural Language Processing},
journal = {{AI} Mag.},
volume = {29},
number = {3},
pages = {16--28},
year = {2008},
url = {https://doi.org/10.1609/aimag.v29i3.2160},
doi = {10.1609/AIMAG.V29I3.2160},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/RadevM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/expert/RadevL08,
author = {Dragomir R. Radev and
Mirella Lapata},
title = {Natural Language Processing and the Web},
journal = {{IEEE} Intell. Syst.},
volume = {23},
number = {5},
pages = {16--17},
year = {2008},
url = {https://doi.org/10.1109/MIS.2008.89},
doi = {10.1109/MIS.2008.89},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/expert/RadevL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/OtterbacherRK08,
author = {Jahna Otterbacher and
Dragomir R. Radev and
Omer Kareem},
title = {Hierarchical summarization for delivering information to mobile devices},
journal = {Inf. Process. Manag.},
volume = {44},
number = {2},
pages = {931--947},
year = {2008},
url = {https://doi.org/10.1016/j.ipm.2007.06.002},
doi = {10.1016/J.IPM.2007.06.002},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/OtterbacherRK08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/ElkissSFESR08,
author = {Aaron Elkiss and
Siwei Shen and
Anthony Fader and
G{\"{u}}nes Erkan and
David J. States and
Dragomir R. Radev},
title = {Blind men and elephants: What do citation summaries tell us about
a research article?},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {59},
number = {1},
pages = {51--62},
year = {2008},
url = {https://doi.org/10.1002/asi.20707},
doi = {10.1002/ASI.20707},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/ElkissSFESR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/OtterbacherR08,
author = {Jahna Otterbacher and
Dragomir R. Radev},
title = {Exploring fact-focused relevance and novelty detection},
journal = {J. Documentation},
volume = {64},
number = {4},
pages = {496--510},
year = {2008},
url = {https://doi.org/10.1108/00220410810884057},
doi = {10.1108/00220410810884057},
timestamp = {Sun, 06 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jd/OtterbacherR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/HassanFCQMCR08,
author = {Ahmed Hassan Awadallah and
Anthony Fader and
Michael H. Crespin and
Kevin M. Quinn and
Burt L. Monroe and
Michael Colaresi and
Dragomir R. Radev},
editor = {Donia Scott and
Hans Uszkoreit},
title = {Tracking the Dynamic Evolution of Participants Salience in a Discussion},
booktitle = {{COLING} 2008, 22nd International Conference on Computational Linguistics,
Proceedings of the Conference, 18-22 August 2008, Manchester, {UK}},
pages = {313--320},
year = {2008},
url = {https://aclanthology.org/C08-1040/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/HassanFCQMCR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/MuthukrishnanGR08,
author = {Pradeep Muthukrishnan and
Joshua Gerrish and
Dragomir R. Radev},
editor = {Donia Scott and
Hans Uszkoreit},
title = {Detecting Multiple Facets of an Event using Graph-Based Unsupervised
Methods},
booktitle = {{COLING} 2008, 22nd International Conference on Computational Linguistics,
Proceedings of the Conference, 18-22 August 2008, Manchester, {UK}},
pages = {609--616},
year = {2008},
url = {https://aclanthology.org/C08-1077/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/MuthukrishnanGR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/QazvinianR08,
author = {Vahed Qazvinian and
Dragomir R. Radev},
editor = {Donia Scott and
Hans Uszkoreit},
title = {Scientific Paper Summarization Using Citation Summary Networks},
booktitle = {{COLING} 2008, 22nd International Conference on Computational Linguistics,
Proceedings of the Conference, 18-22 August 2008, Manchester, {UK}},
pages = {689--696},
year = {2008},
url = {https://aclanthology.org/C08-1087/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/QazvinianR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismb/OzgurVER08,
author = {Arzucan {\"{O}}zg{\"{u}}r and
Thuy Vu and
G{\"{u}}nes Erkan and
Dragomir R. Radev},
title = {Identifying gene-disease associations using centrality on a literature
mined gene-interaction network},
booktitle = {Proceedings 16th International Conference on Intelligent Systems for
Molecular Biology (ISMB), Toronto, Canada, July 19-23, 2008},
pages = {277--285},
year = {2008},
url = {https://doi.org/10.1093/bioinformatics/btn182},
doi = {10.1093/BIOINFORMATICS/BTN182},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ismb/OzgurVER08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/BirdDDGJKLPRT08,
author = {Steven Bird and
Robert Dale and
Bonnie J. Dorr and
Bryan R. Gibson and
Mark Thomas Joseph and
Min{-}Yen Kan and
Dongwon Lee and
Brett Powley and
Dragomir R. Radev and
Yee Fan Tan},
title = {The {ACL} Anthology Reference Corpus: {A} Reference Dataset for Bibliographic
Research in Computational Linguistics},
booktitle = {Proceedings of the International Conference on Language Resources
and Evaluation, {LREC} 2008, 26 May - 1 June 2008, Marrakech, Morocco},
publisher = {European Language Resources Association},
year = {2008},
url = {http://www.lrec-conf.org/proceedings/lrec2008/summaries/445.html},
timestamp = {Thu, 21 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/lrec/BirdDDGJKLPRT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/OtterbacherR08,
author = {Jahna Otterbacher and
Dragomir R. Radev},
title = {Modeling Document Dynamics: an Evolutionary Approach},
booktitle = {Proceedings of the International Conference on Language Resources
and Evaluation, {LREC} 2008, 26 May - 1 June 2008, Marrakech, Morocco},
publisher = {European Language Resources Association},
year = {2008},
url = {http://www.lrec-conf.org/proceedings/lrec2008/summaries/115.html},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/OtterbacherR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0807-1560,
author = {Vahed Qazvinian and
Dragomir R. Radev},
title = {Scientific Paper Summarization Using Citation Summary Networks},
journal = {CoRR},
volume = {abs/0807.1560},
year = {2008},
url = {http://arxiv.org/abs/0807.1560},
eprinttype = {arXiv},
eprint = {0807.1560},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0807-1560.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ErkanOR07,
author = {G{\"{u}}nes Erkan and
Arzucan {\"{O}}zg{\"{u}}r and
Dragomir R. Radev},
editor = {Jason Eisner},
title = {Semi-Supervised Classification for Extracting Protein Interaction
Sentences using Dependency Parsing},
booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical
Methods in Natural Language Processing and Computational Natural Language
Learning, June 28-30, 2007, Prague, Czech Republic},
pages = {228--237},
publisher = {{ACL}},
year = {2007},
url = {https://aclanthology.org/D07-1024/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ErkanOR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/FaderRCMQC07,
author = {Anthony Fader and
Dragomir R. Radev and
Michael H. Crespin and
Burt L. Monroe and
Kevin M. Quinn and
Michael Colaresi},
editor = {Jason Eisner},
title = {MavenRank: Identifying Influential Members of the {US} Senate Using
Lexical Centrality},
booktitle = {EMNLP-CoNLL 2007, Proceedings of the 2007 Joint Conference on Empirical
Methods in Natural Language Processing and Computational Natural Language
Learning, June 28-30, 2007, Prague, Czech Republic},
pages = {658--666},
publisher = {{ACL}},
year = {2007},
url = {https://aclanthology.org/D07-1069/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/FaderRCMQC07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0712-3298,
author = {Dragomir R. Radev and
Mark Hodges and
Anthony Fader and
Mark Thomas Joseph and
Joshua Gerrish and
Mark Schaller and
Jonathan dePeri and
Bryan R. Gibson},
title = {{CLAIRLIB} Documentation v1.03},
journal = {CoRR},
volume = {abs/0712.3298},
year = {2007},
url = {http://arxiv.org/abs/0712.3298},
eprinttype = {arXiv},
eprint = {0712.3298},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-0712-3298.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RadevEFJSS06,
author = {Dragomir R. Radev and
G{\"{u}}nes Erkan and
Anthony Fader and
Patrick Jordan and
Siwei Shen and
James P. Sweeney},
editor = {Nicoletta Calzolari and
Claire Cardie and
Pierre Isabelle},
title = {LexNet: {A} Graphical Environment for Graph-Based {NLP}},
booktitle = {{ACL} 2006, 21st International Conference on Computational Linguistics
and 44th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the Conference, Sydney, Australia, 17-21 July 2006},
publisher = {The Association for Computer Linguistics},
year = {2006},
url = {https://aclanthology.org/P06-4012/},
doi = {10.3115/1225403.1225415},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RadevEFJSS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/ShenRPE06,
author = {Siwei Shen and
Dragomir R. Radev and
Agam Patel and
G{\"{u}}nes Erkan},
editor = {Nicoletta Calzolari and
Claire Cardie and
Pierre Isabelle},
title = {Adding Syntax to Dynamic Programming for Aligning Comparable Texts
for the Generation of Paraphrases},
booktitle = {{ACL} 2006, 21st International Conference on Computational Linguistics
and 44th Annual Meeting of the Association for Computational Linguistics,
Proceedings of the Conference, Sydney, Australia, 17-21 July 2006},
publisher = {The Association for Computer Linguistics},
year = {2006},
url = {https://aclanthology.org/P06-2096/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/ShenRPE06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/PatelR06,
author = {Agam Patel and
Dragomir R. Radev},
editor = {Nicoletta Calzolari and
Khalid Choukri and
Aldo Gangemi and
Bente Maegaard and
Joseph Mariani and
Jan Odijk and
Daniel Tapias},
title = {Lexical similarity can distinguish between automatic and manual translations},
booktitle = {Proceedings of the Fifth International Conference on Language Resources
and Evaluation, {LREC} 2006, Genoa, Italy, May 22-28, 2006},
pages = {1230--1235},
publisher = {European Language Resources Association {(ELRA)}},
year = {2006},
url = {http://www.lrec-conf.org/proceedings/lrec2006/summaries/235.html},
timestamp = {Mon, 19 Aug 2019 15:23:22 +0200},
biburl = {https://dblp.org/rec/conf/lrec/PatelR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/MihalceaR06,
author = {Rada Mihalcea and
Dragomir R. Radev},
editor = {Robert C. Moore and
Jeff A. Bilmes and
Jennifer Chu{-}Carroll and
Mark Sanderson},
title = {Graph-based Algorithms for Natural Language Processing and Information
Retrieval},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association of Computational Linguistics, Proceedings, June
4-9, 2006, New York, New York, {USA}},
publisher = {The Association for Computational Linguistics},
year = {2006},
url = {https://aclanthology.org/N06-5003/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/MihalceaR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/OtterbacherRK06,
author = {Jahna Otterbacher and
Dragomir R. Radev and
Omer Kareem},
editor = {Efthimis N. Efthimiadis and
Susan T. Dumais and
David Hawking and
Kalervo J{\"{a}}rvelin},
title = {News to go: hierarchical text summarization for mobile devices},
booktitle = {{SIGIR} 2006: Proceedings of the 29th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Seattle,
Washington, USA, August 6-11, 2006},
pages = {589--596},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1148170.1148271},
doi = {10.1145/1148170.1148271},
timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
biburl = {https://dblp.org/rec/conf/sigir/OtterbacherRK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/OtterbacherR06,
author = {Jahna Otterbacher and
Dragomir R. Radev},
editor = {Efthimis N. Efthimiadis and
Susan T. Dumais and
David Hawking and
Kalervo J{\"{a}}rvelin},
title = {Fact-focused novelty detection: a feasibility study},
booktitle = {{SIGIR} 2006: Proceedings of the 29th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Seattle,
Washington, USA, August 6-11, 2006},
pages = {687--688},
publisher = {{ACM}},
year = {2006},
url = {https://doi.org/10.1145/1148170.1148318},
doi = {10.1145/1148170.1148318},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sigir/OtterbacherR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slt/Radev06,
author = {Dragomir R. Radev},
editor = {Mazin Gilbert and
Hermann Ney},
title = {Graph-Based Methods for Language Processing and Information Retrieval},
booktitle = {2006 {IEEE} {ACL} Spoken Language Technology Workshop, {SLT} 2006,
Palm Beach, Aruba, December 10-13, 2006},
pages = {4},
publisher = {{IEEE}},
year = {2006},
url = {https://doi.org/10.1109/SLT.2006.326781},
doi = {10.1109/SLT.2006.326781},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/slt/Radev06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/RadevOWB05,
author = {Dragomir R. Radev and
Jahna Otterbacher and
Adam Winkel and
Sasha Blair{-}Goldensohn},
title = {NewsInEssence: summarizing online news topics},
journal = {Commun. {ACM}},
volume = {48},
number = {10},
pages = {95--98},
year = {2005},
url = {https://doi.org/10.1145/1089107.1089111},
doi = {10.1145/1089107.1089111},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/cacm/RadevOWB05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/LamCRST05,
author = {Wai Lam and
Ki Chan and
Dragomir R. Radev and
Horacio Saggion and
Simone Teufel},
title = {Context-based generic cross-lingual retrieval of documents and automated
summaries},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {56},
number = {2},
pages = {129--139},
year = {2005},
url = {https://doi.org/10.1002/asi.20104},
doi = {10.1002/ASI.20104},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/LamCRST05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RadevFQWG05,
author = {Dragomir R. Radev and
Weiguo Fan and
Hong Qi and
Harris Wu and
Amardeep Grewal},
title = {Probabilistic question answering on the Web},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {56},
number = {6},
pages = {571--583},
year = {2005},
url = {https://doi.org/10.1002/asi.20146},
doi = {10.1002/ASI.20146},
timestamp = {Mon, 02 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/jasis/RadevFQWG05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/OtterbacherER05,
author = {Jahna Otterbacher and
G{\"{u}}nes Erkan and
Dragomir R. Radev},
title = {Using Random Walks for Question-focused Sentence Retrieval},
booktitle = {{HLT/EMNLP} 2005, Human Language Technology Conference and Conference
on Empirical Methods in Natural Language Processing, Proceedings of
the Conference, 6-8 October 2005, Vancouver, British Columbia, Canada},
pages = {915--922},
publisher = {The Association for Computational Linguistics},
year = {2005},
url = {https://aclanthology.org/H05-1115/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/OtterbacherER05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RadevKO05,
author = {Dragomir R. Radev and
Omer Kareem and
Jahna Otterbacher},
editor = {Ricardo A. Baeza{-}Yates and
Nivio Ziviani and
Gary Marchionini and
Alistair Moffat and
John Tait},
title = {Hierarchical text summarization for WAP-enabled mobile devices},
booktitle = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, Salvador,
Brazil, August 15-19, 2005},
pages = {679},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1076034.1076191},
doi = {10.1145/1076034.1076191},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/RadevKO05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/RadevJST04,
author = {Dragomir R. Radev and
Hongyan Jing and
Magorzata Sty and
Daniel Tam},
title = {Centroid-based summarization of multiple documents},
journal = {Inf. Process. Manag.},
volume = {40},
number = {6},
pages = {919--938},
year = {2004},
url = {https://doi.org/10.1016/j.ipm.2003.10.006},
doi = {10.1016/J.IPM.2003.10.006},
timestamp = {Fri, 21 Feb 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ipm/RadevJST04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jair/ErkanR04,
author = {G{\"{u}}nes Erkan and
Dragomir R. Radev},
title = {LexRank: Graph-based Lexical Centrality as Salience in Text Summarization},
journal = {J. Artif. Intell. Res.},
volume = {22},
pages = {457--479},
year = {2004},
url = {https://doi.org/10.1613/jair.1523},
doi = {10.1613/JAIR.1523},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jair/ErkanR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asist/PeckBBR04,
author = {Frederick A. Peck and
Suresh K. Bhavnani and
Marilyn H. Blackmon and
Dragomir R. Radev},
title = {Exploring the use of natural language systems for fact identification:
Towards the automatic construction of healthcare portals},
booktitle = {Managing and Enhancing Information: Cultures and Conflicts - Proceedings
of the 67th ASIS{\&}T Annual Meeting, {ASIST} 2004, Providence,
Rhode Island, USA, November 12-17, 2004},
series = {Proc. Assoc. Inf. Sci. Technol.},
volume = {41},
number = {1},
pages = {327--338},
publisher = {Wiley},
year = {2004},
url = {https://doi.org/10.1002/meet.1450410139},
doi = {10.1002/MEET.1450410139},
timestamp = {Fri, 21 Jan 2022 13:55:35 +0100},
biburl = {https://dblp.org/rec/conf/asist/PeckBBR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/OtterbacherR04,
author = {Jahna Otterbacher and
Dragomir R. Radev},
title = {Comparing Semantically Related Sentences: The Case of Paraphrase Versus
Subsumption},
booktitle = {{COLING} 2004, 20th International Conference on Computational Linguistics,
Proceedings of the Conference, 23-27 August 2004, Geneva, Switzerland},
year = {2004},
url = {https://aclanthology.org/C04-1184/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/OtterbacherR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emnlp/ErkanR04,
author = {G{\"{u}}nes Erkan and
Dragomir R. Radev},
title = {LexPageRank: Prestige in Multi-Document Text Summarization},
booktitle = {Proceedings of the 2004 Conference on Empirical Methods in Natural
Language Processing , {EMNLP} 2004, {A} meeting of SIGDAT, a Special
Interest Group of the ACL, held in conjunction with {ACL} 2004, 25-26
July 2004, Barcelona, Spain},
pages = {365--371},
publisher = {{ACL}},
year = {2004},
url = {https://aclanthology.org/W04-3247/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/emnlp/ErkanR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcnlp/ZhangR04,
author = {Zhu Zhang and
Dragomir R. Radev},
editor = {Keh{-}Yih Su and
Jun'ichi Tsujii and
Jong{-}Hyeok Lee and
Oi Yee Kwong},
title = {Combining Labeled and Unlabeled Data for Learning Cross-Document Structural
Relationships},
booktitle = {Natural Language Processing - {IJCNLP} 2004, First International Joint
Conference, Hainan Island, China, March 22-24, 2004, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {3248},
pages = {32--41},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30211-7\_4},
doi = {10.1007/978-3-540-30211-7\_4},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/ijcnlp/ZhangR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/OtterbacherR04,
author = {Jahna Otterbacher and
Dragomir R. Radev},
title = {RevisionBank: {A} Resource for Revision-based Multi-document Summarization
and Evaluation},
booktitle = {Proceedings of the Fourth International Conference on Language Resources
and Evaluation, {LREC} 2004, May 26-28, 2004, Lisbon, Portugal},
publisher = {European Language Resources Association},
year = {2004},
url = {http://www.lrec-conf.org/proceedings/lrec2004/summaries/409.htm},
timestamp = {Mon, 19 Aug 2019 15:22:43 +0200},
biburl = {https://dblp.org/rec/conf/lrec/OtterbacherR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/RadevABBCDDHLLOQSTTWZ04,
author = {Dragomir R. Radev and
Timothy Allison and
Sasha Blair{-}Goldensohn and
John Blitzer and
Arda {\c{C}}elebi and
Stanko Dimitrov and
Elliott Dr{\'{a}}bek and
Ali Hakim and
Wai Lam and
Danyu Liu and
Jahna Otterbacher and
Hong Qi and
Horacio Saggion and
Simone Teufel and
Michael Topper and
Adam Winkel and
Zhu Zhang},
title = {{MEAD} - {A} Platform for Multidocument Multilingual Text Summarization},
booktitle = {Proceedings of the Fourth International Conference on Language Resources
and Evaluation, {LREC} 2004, May 26-28, 2004, Lisbon, Portugal},
publisher = {European Language Resources Association},
year = {2004},
url = {http://www.lrec-conf.org/proceedings/lrec2004/summaries/757.htm},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/RadevABBCDDHLLOQSTTWZ04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/RadevOZ04,
author = {Dragomir R. Radev and
Jahna Otterbacher and
Zhu Zhang},
title = {{CST} Bank: {A} Corpus for the Study of Cross-document Structural
Relationships},
booktitle = {Proceedings of the Fourth International Conference on Language Resources
and Evaluation, {LREC} 2004, May 26-28, 2004, Lisbon, Portugal},
publisher = {European Language Resources Association},
year = {2004},
url = {http://www.lrec-conf.org/proceedings/lrec2004/summaries/411.htm},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/RadevOZ04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/OchGKSYFKSSEJJR04,
author = {Franz Josef Och and
Daniel Gildea and
Sanjeev Khudanpur and
Anoop Sarkar and
Kenji Yamada and
Alexander M. Fraser and
Shankar Kumar and
Libin Shen and
David Smith and
Katherine Eng and
Viren Jain and
Zhen Jin and
Dragomir R. Radev},
editor = {Julia Hirschberg and
Susan T. Dumais and
Daniel Marcu and
Salim Roukos},
title = {A Smorgasbord of Features for Statistical Machine Translation},
booktitle = {Human Language Technology Conference of the North American Chapter
of the Association for Computational Linguistics, {HLT-NAACL} 2004,
Boston, Massachusetts, USA, May 2-7, 2004},
pages = {161--168},
publisher = {The Association for Computational Linguistics},
year = {2004},
url = {https://aclanthology.org/N04-1021/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/OchGKSYFKSSEJJR04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/RadevACDKTWY04,
author = {Dragomir R. Radev and
Timothy Allison and
Matthew Craig and
Stanko Dimitrov and
Omer Kareem and
Michael Topper and
Adam Winkel and
Jin Yi},
title = {A Scaleable Multi-document Centroid-based Summarizer},
booktitle = {Demonstration Papers at {HLT-NAACL} 2004, Boston, Massachusetts, USA,
May 2-7, 2004},
publisher = {The Association for Computational Linguistics},
year = {2004},
url = {https://aclanthology.org/N04-3007/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/RadevACDKTWY04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/RadevQWT04,
author = {Dragomir R. Radev and
Hong Qi and
Adam Winkel and
Daniel Tam},
title = {Computational Linkuistics: Word Triggers across Hyperlinks},
booktitle = {Proceedings of {HLT-NAACL} 2004: Short Papers, Boston, Massachusetts,
USA, May 2-7, 2004},
publisher = {The Association for Computational Linguistics},
year = {2004},
url = {https://aclanthology.org/N04-4031/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/RadevQWT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndqa/PustejovskySCRGSSK04,
author = {James Pustejovsky and
Roser Saur{\'{\i}} and
Jos{\'{e}} M. Casta{\~{n}}o and
Dragomir R. Radev and
Robert J. Gaizauskas and
Andrea Setzer and
Beth Sundheim and
Graham Katz},
editor = {Mark T. Maybury},
title = {Representing Temporal and Event Knowledge for {QA} Systems},
booktitle = {New Directions in Question Answering},
pages = {99--112},
publisher = {{AAAI} Press},
year = {2004},
timestamp = {Mon, 29 Aug 2016 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ndqa/PustejovskySCRGSSK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndqa/WuRF04,
author = {Harris Wu and
Dragomir R. Radev and
Weiguo Fan},
editor = {Mark T. Maybury},
title = {Toward Answer-Focused Summarization Using Search Engines},
booktitle = {New Directions in Question Answering},
pages = {227--236},
publisher = {{AAAI} Press},
year = {2004},
timestamp = {Tue, 14 Dec 2004 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ndqa/WuRF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/RadevTSLBQCLD03,
author = {Dragomir R. Radev and
Simone Teufel and
Horacio Saggion and
Wai Lam and
John Blitzer and
Hong Qi and
Arda {\c{C}}elebi and
Danyu Liu and
Elliott Dr{\'{a}}bek},
editor = {Erhard W. Hinrichs and
Dan Roth},
title = {Evaluation Challenges in Large-Scale Document Summarization},
booktitle = {Proceedings of the 41st Annual Meeting of the Association for Computational
Linguistics, 7-12 July 2003, Sapporo Convention Center, Sapporo, Japan},
pages = {375--382},
publisher = {{ACL}},
year = {2003},
url = {https://aclanthology.org/P03-1048/},
doi = {10.3115/1075096.1075144},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/RadevTSLBQCLD03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/ZhangOR03,
author = {Zhu Zhang and
Jahna Otterbacher and
Dragomir R. Radev},
title = {Learning cross-document structural relationships using boosting},
booktitle = {Proceedings of the 2003 {ACM} {CIKM} International Conference on Information
and Knowledge Management, New Orleans, Louisiana, USA, November 2-8,
2003},
pages = {124--130},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/956863.956887},
doi = {10.1145/956863.956887},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/ZhangOR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/RadevT03,
author = {Dragomir R. Radev and
Daniel Tam},
title = {Summarization evaluation using relative utility},
booktitle = {Proceedings of the 2003 {ACM} {CIKM} International Conference on Information
and Knowledge Management, New Orleans, Louisiana, USA, November 2-8,
2003},
pages = {508--511},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/956863.956960},
doi = {10.1145/956863.956960},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/RadevT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndqa/PustejovskyCISGSKR03,
author = {James Pustejovsky and
Jos{\'{e}} M. Casta{\~{n}}o and
Robert Ingria and
Roser Saur{\'{\i}} and
Robert J. Gaizauskas and
Andrea Setzer and
Graham Katz and
Dragomir R. Radev},
editor = {Mark T. Maybury},
title = {TimeML: Robust Specification of Event and Temporal Expressions in
Text},
booktitle = {New Directions in Question Answering, Papers from 2003 {AAAI} Spring
Symposium, Stanford University, Stanford, CA, {USA}},
pages = {28--34},
publisher = {{AAAI} Press},
year = {2003},
timestamp = {Mon, 29 Aug 2016 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ndqa/PustejovskyCISGSKR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ndqa/Radev03,
author = {Dragomir R. Radev},
editor = {Mark T. Maybury},
title = {Panel on Web-Based Question Answering},
booktitle = {New Directions in Question Answering, Papers from 2003 {AAAI} Spring
Symposium, Stanford University, Stanford, CA, {USA}},
pages = {105--106},
publisher = {{AAAI} Press},
year = {2003},
timestamp = {Tue, 02 Mar 2004 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ndqa/Radev03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YuJR03,
author = {Cong Yu and
H. V. Jagadish and
Dragomir R. Radev},
editor = {Charles L. A. Clarke and
Gordon V. Cormack and
Jamie Callan and
David Hawking and
Alan F. Smeaton},
title = {Querying {XML} using structures and keywords in timber},
booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
28 - August 1, 2003, Toronto, Canada},
pages = {463},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/860435.860554},
doi = {10.1145/860435.860554},
timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
biburl = {https://dblp.org/rec/conf/sigir/YuJR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/OtterbacherQHR03,
author = {Jahna Otterbacher and
Hong Qi and
Ali Hakim and
Dragomir R. Radev},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {The University of Michigan at {TREC} 2003},
booktitle = {Proceedings of The Twelfth Text REtrieval Conference, {TREC} 2003,
Gaithersburg, Maryland, USA, November 18-21, 2003},
series = {{NIST} Special Publication},
volume = {500-255},
pages = {732--738},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2003},
url = {http://trec.nist.gov/pubs/trec12/papers/umich.novelty.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/OtterbacherQHR03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/RadevHM02,
author = {Dragomir R. Radev and
Eduard H. Hovy and
Kathleen R. McKeown},
title = {Introduction to the Special Issue on Summarization},
journal = {Comput. Linguistics},
volume = {28},
number = {4},
pages = {399--408},
year = {2002},
url = {https://doi.org/10.1162/089120102762671927},
doi = {10.1162/089120102762671927},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/coling/RadevHM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RadevLF02,
author = {Dragomir R. Radev and
Kelsey Libner and
Weiguo Fan},
title = {Getting answers to natural language questions on the Web},
journal = {J. Assoc. Inf. Sci. Technol.},
volume = {53},
number = {5},
pages = {359--364},
year = {2002},
url = {https://doi.org/10.1002/asi.10053},
doi = {10.1002/ASI.10053},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jasis/RadevLF02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ZhangBR02,
author = {Zhu Zhang and
Sasha Blair{-}Goldensohn and
Dragomir R. Radev},
editor = {Rina Dechter and
Michael J. Kearns and
Richard S. Sutton},
title = {Towards CST-Enhanced Summarization},
booktitle = {Proceedings of the Eighteenth National Conference on Artificial Intelligence
and Fourteenth Conference on Innovative Applications of Artificial
Intelligence, July 28 - August 1, 2002, Edmonton, Alberta, Canada},
pages = {439--446},
publisher = {{AAAI} Press / The {MIT} Press},
year = {2002},
url = {http://www.aaai.org/Library/AAAI/2002/aaai02-067.php},
timestamp = {Tue, 05 Sep 2023 09:10:47 +0200},
biburl = {https://dblp.org/rec/conf/aaai/ZhangBR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coling/SaggionRTL02,
author = {Horacio Saggion and
Dragomir R. Radev and
Simone Teufel and
Wai Lam},
title = {Meta-evaluation of Summaries in a Cross-lingual Environment using
Content-based Metrics},
booktitle = {19th International Conference on Computational Linguistics, {COLING}
2002, Howard International House and Academia Sinica, Taipei, Taiwan,
August 24 - September 1, 2002},
year = {2002},
url = {https://aclanthology.org/C02-1073/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/coling/SaggionRTL02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/RadevQWF02,
author = {Dragomir R. Radev and
Hong Qi and
Harris Wu and
Weiguo Fan},
title = {Evaluating Web-based Question Answering Systems},
booktitle = {Proceedings of the Third International Conference on Language Resources
and Evaluation, {LREC} 2002, May 29-31, 2002, Las Palmas, Canary Islands,
Spain},
publisher = {European Language Resources Association},
year = {2002},
url = {http://www.lrec-conf.org/proceedings/lrec2002/sumarios/301.htm},
timestamp = {Mon, 19 Aug 2019 15:23:48 +0200},
biburl = {https://dblp.org/rec/conf/lrec/RadevQWF02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lrec/SaggionRTLS02,
author = {Horacio Saggion and
Dragomir R. Radev and
Simone Teufel and
Wai Lam and
Stephanie M. Strassel},
title = {Developing Infrastructure for the Evaluation of Single and Multi-document
Summarization Systems in a Cross-lingual Environment},
booktitle = {Proceedings of the Third International Conference on Language Resources
and Evaluation, {LREC} 2002, May 29-31, 2002, Las Palmas, Canary Islands,
Spain},
publisher = {European Language Resources Association},
year = {2002},
url = {http://www.lrec-conf.org/proceedings/lrec2002/sumarios/158.htm},
timestamp = {Mon, 19 Aug 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/lrec/SaggionRTLS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/QiOWR02,
author = {Hong Qi and
Jahna Otterbacher and
Adam Winkel and
Dragomir R. Radev},
editor = {Ellen M. Voorhees and
Lori P. Buckland},
title = {The University of Michigan at {TREC} 2002: Question Answering and
Novelty Tracks},
booktitle = {Proceedings of The Eleventh Text REtrieval Conference, {TREC} 2002,
Gaithersburg, Maryland, USA, November 19-22, 2002},
series = {{NIST} Special Publication},
volume = {500-251},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2002},
url = {http://trec.nist.gov/pubs/trec11/papers/umichigan.radev.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/QiOWR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/RadevFQWG02,
author = {Dragomir R. Radev and
Weiguo Fan and
Hong Qi and
Harris Wu and
Amardeep Grewal},
editor = {David Lassner and
David De Roure and
Arun Iyengar},
title = {Probabilistic question answering on the web},
booktitle = {Proceedings of the Eleventh International World Wide Web Conference,
{WWW} 2002, May 7-11, 2002, Honolulu, Hawaii, {USA}},
pages = {408--419},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/511446.511500},
doi = {10.1145/511446.511500},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/www/RadevFQWG02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/RadevQZBZFP01,
author = {Dragomir R. Radev and
Hong Qi and
Zhiping Zheng and
Sasha Blair{-}Goldensohn and
Zhu Zhang and
Weiguo Fan and
John M. Prager},
title = {Mining the Web for Answers to Natural Language Questions},
booktitle = {Proceedings of the 2001 {ACM} {CIKM} International Conference on Information
and Knowledge Management, Atlanta, Georgia, USA, November 5-10, 2001},
pages = {143--150},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/502585.502610},
doi = {10.1145/502585.502610},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cikm/RadevQZBZFP01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ercimdl/RadevBZR01,
author = {Dragomir R. Radev and
Sasha Blair{-}Goldensohn and
Zhu Zhang and
Revathi Sundara Raghavan},
editor = {Panos Constantopoulos and
Ingeborg S{\o}lvberg},
title = {Interactive, Domain-Independent Identification and Summarization of
Topically Related News Articles},
booktitle = {Research and Advanced Technology for Digital Libraries, 5th European
Conference, {ECDL} 2001, Darmstadt, Germany, September 4-9, 2001,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2163},
pages = {225--238},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-44796-2\_20},
doi = {10.1007/3-540-44796-2\_20},
timestamp = {Mon, 28 Aug 2023 21:17:44 +0200},
biburl = {https://dblp.org/rec/conf/ercimdl/RadevBZR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/PragerRC01,
author = {John M. Prager and
Dragomir R. Radev and
Krzysztof Czuba},
title = {Answering What-Is Questions by Virtual Annotation},
booktitle = {Proceedings of the First International Conference on Human Language
Technology Research, {HLT} 2001, San Diego, California, USA, March
18-21, 2001},
publisher = {Morgan Kaufmann},
year = {2001},
url = {https://aclanthology.org/H01-1006/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/PragerRC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/RadevBZR01,
author = {Dragomir R. Radev and
Sasha Blair{-}Goldensohn and
Zhu Zhang and
Revathi Sundara Raghavan},
title = {NewsInEssence: {A} System For Domain-Independent, Real-Time News Clustering
and Multi-Document Summarization},
booktitle = {Proceedings of the First International Conference on Human Language
Technology Research, {HLT} 2001, San Diego, California, USA, March
18-21, 2001},
publisher = {Morgan Kaufmann},
year = {2001},
url = {https://aclanthology.org/H01-1056/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/naacl/RadevBZR01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anlp/RadevPS00,
author = {Dragomir R. Radev and
John M. Prager and
Valerie Samn},
title = {Ranking suspected answers to natural language questions using predictive
annotation},
booktitle = {6th Applied Natural Language Processing Conference, {ANLP} 2000, Seattle,
Washington, USA, April 29 - May 4, 2000},
pages = {150--157},
publisher = {{ACL}},
year = {2000},
url = {https://aclanthology.org/A00-1021/},
doi = {10.3115/974147.974168},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anlp/RadevPS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigdial/Radev00,
author = {Dragomir R. Radev},
editor = {Laila Dybkj{\ae}r and
K{\^{o}}iti Hasida and
David R. Traum},
title = {A Common Theory of Information Fusion from Multiple Text Sources Step
One: Cross-Document Structure},
booktitle = {Proceedings of the {SIGDIAL} 2000 Workshop, The 1st Annual Meeting
of the Special Interest Group on Discourse and Dialogue, 7-8 October
2000, Hong Kong},
pages = {74--83},
publisher = {The Association for Computer Linguistics},
year = {2000},
url = {https://aclanthology.org/W00-1009/},
doi = {10.3115/1117736.1117745},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sigdial/Radev00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/PragerBCR00,
author = {John M. Prager and
Eric W. Brown and
Anni Coden and
Dragomir R. Radev},
editor = {Emmanuel J. Yannakoudakis and
Nicholas J. Belkin and
Peter Ingwersen and
Mun{-}Kew Leong},
title = {Question-answering by predictive annotation},
booktitle = {{SIGIR} 2000: Proceedings of the 23rd Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval, July
24-28, 2000, Athens, Greece},
pages = {184--191},
publisher = {{ACM}},
year = {2000},
url = {https://doi.org/10.1145/345508.345574},
doi = {10.1145/345508.345574},
timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
biburl = {https://dblp.org/rec/conf/sigir/PragerBCR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/PragerBRC00,
author = {John M. Prager and
Eric W. Brown and
Dragomir R. Radev and
Krzysztof Czuba},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {One Search Engine or Two for Question-Answering},
booktitle = {Proceedings of The Ninth Text REtrieval Conference, {TREC} 2000, Gaithersburg,
Maryland, USA, November 13-16, 2000},
series = {{NIST} Special Publication},
volume = {500-249},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {2000},
url = {http://trec.nist.gov/pubs/trec9/papers/PragerTrec9notebook.pdf},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/PragerBRC00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-CL-0005020,
author = {Dragomir R. Radev and
Hongyan Jing and
Malgorzata Budzikowska},
title = {Centroid-based summarization of multiple documents: sentence extraction
utility-based evaluation, and user studies},
journal = {CoRR},
volume = {cs.CL/0005020},
year = {2000},
url = {https://arxiv.org/abs/cs/0005020},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-CL-0005020.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-CL-0005029,
author = {Dragomir R. Radev and
John M. Prager and
Valerie Samn},
title = {Ranking suspected answers to natural language questions using predictive
annotation},
journal = {CoRR},
volume = {cs.CL/0005029},
year = {2000},
url = {https://arxiv.org/abs/cs/0005029},
timestamp = {Fri, 10 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/cs-CL-0005029.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/GreenCKSCRHHHFOS99,
author = {Nancy L. Green and
Jennifer Chu{-}Carroll and
David Kortenkamp and
Alan C. Schultz and
Michael H. Coen and
Dragomir R. Radev and
Eduard H. Hovy and
Peter Haddawy and
Steve Hanks and
Eugene C. Freuder and
Charlie Ortiz and
Sandip Sen},
title = {The {AAAI} Spring Symposia},
journal = {{AI} Mag.},
volume = {20},
number = {3},
pages = {83--86},
year = {1999},
url = {https://doi.org/10.1609/aimag.v20i3.1469},
doi = {10.1609/AIMAG.V20I3.1469},
timestamp = {Mon, 22 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/aim/GreenCKSCRHHHFOS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/PragerRBCS99,
author = {John M. Prager and
Dragomir R. Radev and
Eric W. Brown and
Anni Coden and
Valerie Samn},
editor = {Ellen M. Voorhees and
Donna K. Harman},
title = {The Use of Predictive Annotation for Question Answering in {TREC8}},
booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
Gaithersburg, Maryland, USA, November 17-19, 1999},
series = {{NIST} Special Publication},
volume = {500-246},
publisher = {National Institute of Standards and Technology {(NIST)}},
year = {1999},
url = {http://trec.nist.gov/pubs/trec8/papers/IBMTrec8QA.ps},
timestamp = {Wed, 07 Jul 2021 16:44:22 +0200},
biburl = {https://dblp.org/rec/conf/trec/PragerRBCS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/coling/RadevM98,
author = {Dragomir R. Radev and
Kathleen R. McKeown},
title = {Generating Natural Language Summaries from Multiple On-Line Sources},
journal = {Comput. Linguistics},
volume = {24},
number = {3},
pages = {469--500},
year = {1998},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/coling/RadevM98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/Radev98,
author = {Dragomir R. Radev},
editor = {Christian Boitet and
Pete Whitelock},
title = {Learning Correlations between Linguistic Indicators and Semantic Constraints:
Reuse of Context-Dependent Decsriptions of Entities},
booktitle = {36th Annual Meeting of the Association for Computational Linguistics
and 17th International Conference on Computational Linguistics, {COLING-ACL}
'98, August 10-14, 1998, Universit{\'{e}} de Montr{\'{e}}al,
Montr{\'{e}}al, Quebec, Canada. Proceedings of the Conference},
pages = {1072--1078},
publisher = {Morgan Kaufmann Publishers / {ACL}},
year = {1998},
url = {https://aclanthology.org/P98-2176/},
doi = {10.3115/980691.980745},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl/Radev98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cmp-lg-9806001,
author = {Dragomir R. Radev},
title = {Learning Correlations between Linguistic Indicators and Semantic Constraints:
Reuse of Context-Dependent Descriptions of Entities},
journal = {CoRR},
volume = {cmp-lg/9806001},
year = {1998},
url = {http://arxiv.org/abs/cmp-lg/9806001},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/cmp-lg-9806001.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jodl/AhoCMRSZ98,
author = {Alfred V. Aho and
Shih{-}Fu Chang and
Kathleen R. McKeown and
Dragomir R. Radev and
John R. Smith and
Kazi A. Zaman},
title = {Columbia Digital News Project: An Environment for Briefing and Search
over Multimedia Information},
journal = {Int. J. Digit. Libr.},
volume = {1},
number = {4},
pages = {377--385},
year = {1997},
url = {https://doi.org/10.1007/s007990050030},
doi = {10.1007/S007990050030},
timestamp = {Fri, 11 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jodl/AhoCMRSZ98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adl/AhoCMRSZ97,
author = {Alfred V. Aho and
Shih{-}Fu Chang and
Kathleen R. McKeown and
Dragomir R. Radev and
John R. Smith and
Kazi A. Zaman},
title = {Columbia Digital News System An Environment for Briefing and Search
over Multimedia Information},
booktitle = {4th International Forum on Research and Technology Advances in Digital
Libraries {(ADL} '97), Washington, DC, USA, May 7-9, 1997},
pages = {82--94},
publisher = {{IEEE} Computer Society},
year = {1997},
url = {https://doi.org/10.1109/ADL.1997.601203},
doi = {10.1109/ADL.1997.601203},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/adl/AhoCMRSZ97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/anlp/RadevM97,
author = {Dragomir R. Radev and
Kathleen R. McKeown},
title = {Building a Generation Knowledge Source using Internet-Accessible Newswire},
booktitle = {5th Applied Natural Language Processing Conference, {ANLP} 1997, Marriott
Hotel, Washington, USA, March 31 - April 3, 1997},
pages = {221--228},
publisher = {{ACL}},
year = {1997},
url = {https://aclanthology.org/A97-1033/},
doi = {10.3115/974557.974590},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/anlp/RadevM97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cmp-lg-9702014,
author = {Dragomir R. Radev and
Kathleen R. McKeown},
title = {Building a Generation Knowledge Source using Internet-Accessible Newswire},
journal = {CoRR},
volume = {cmp-lg/9702014},
year = {1997},
url = {http://arxiv.org/abs/cmp-lg/9702014},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/cmp-lg-9702014.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cmp-lg-9710001,
author = {Evelyne Tzoukermann and
Dragomir R. Radev},
title = {Use of Weighted Finite State Transducers in Part of Speech Tagging},
journal = {CoRR},
volume = {cmp-lg/9710001},
year = {1997},
url = {http://arxiv.org/abs/cmp-lg/9710001},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/cmp-lg-9710001.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cmp-lg-9710002,
author = {Evelyne Tzoukermann and
Dragomir R. Radev and
William A. Gale},
title = {Tagging French Without Lexical Probabilities - Combining Linguistic
Knowledge And Statistical Learning},
journal = {CoRR},
volume = {cmp-lg/9710002},
year = {1997},
url = {http://arxiv.org/abs/cmp-lg/9710002},
timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/cmp-lg-9710002.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl-vlc/TzoukermannR96,
author = {Evelyne Tzoukermann and
Dragomir R. Radev},
editor = {Eva I. Ejerhed and
Ido Dagan},
title = {Using Word Class for Part-of-speech Disambiguation},
booktitle = {Fourth Workshop on Very Large Corpora, VLC@COLING 1996, Copenhagen,
Denmark, August 4, 1996},
year = {1996},
url = {https://aclanthology.org/W96-0101/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/acl-vlc/TzoukermannR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inlg/Radev96,
author = {Dragomir R. Radev},
title = {An Architecture For Distributed Natural Language Summarization},
booktitle = {Eighth International Natural Language Generation Workshop, {INLG}
1996, Herstmonceux Castle, Sussex, UK, June 12-15, 1996 - Posters
and Demonstrations},
year = {1996},
url = {https://aclanthology.org/W96-0512/},
timestamp = {Fri, 06 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/inlg/Radev96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/McKeownR95,
author = {Kathleen R. McKeown and
Dragomir R. Radev},
editor = {Edward A. Fox and
Peter Ingwersen and
Raya Fidel},
title = {Generating Summaries of Multiple News Articles},
booktitle = {SIGIR'95, Proceedings of the 18th Annual International {ACM} {SIGIR}
Conference on Research and Development in Information Retrieval. Seattle,
Washington, USA, July 9-13, 1995 (Special Issue of the {SIGIR} Forum)},
pages = {74--82},
publisher = {{ACM} Press},
year = {1995},
url = {https://doi.org/10.1145/215206.215334},
doi = {10.1145/215206.215334},
timestamp = {Tue, 06 Nov 2018 11:07:25 +0100},
biburl = {https://dblp.org/rec/conf/sigir/McKeownR95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-04-14 01:14 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
