Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: Cliff Young
@inproceedings{DBLP:conf/isca/JouppiK0MNNPSST23,
author = {Norman P. Jouppi and
George Kurian and
Sheng Li and
Peter C. Ma and
Rahul Nagarajan and
Lifeng Nai and
Nishant Patil and
Suvinay Subramanian and
Andy Swing and
Brian Towles and
Cliff Young and
Xiang Zhou and
Zongwei Zhou and
David A. Patterson},
editor = {Yan Solihin and
Mark A. Heinrich},
title = {{TPU} v4: An Optically Reconfigurable Supercomputer for Machine Learning
with Hardware Support for Embeddings},
booktitle = {Proceedings of the 50th Annual International Symposium on Computer
Architecture, {ISCA} 2023, Orlando, FL, USA, June 17-21, 2023},
pages = {82:1--82:14},
publisher = {{ACM}},
year = {2023},
url = {https://doi.org/10.1145/3579371.3589350},
doi = {10.1145/3579371.3589350},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/JouppiK0MNNPSST23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2304-01433,
author = {Norman P. Jouppi and
George Kurian and
Sheng Li and
Peter C. Ma and
Rahul Nagarajan and
Lifeng Nai and
Nishant Patil and
Suvinay Subramanian and
Andy Swing and
Brian Towles and
Cliff Young and
Xiang Zhou and
Zongwei Zhou and
David A. Patterson},
title = {{TPU} v4: An Optically Reconfigurable Supercomputer for Machine Learning
with Hardware Support for Embeddings},
journal = {CoRR},
volume = {abs/2304.01433},
year = {2023},
url = {https://doi.org/10.48550/arXiv.2304.01433},
doi = {10.48550/ARXIV.2304.01433},
eprinttype = {arXiv},
eprint = {2304.01433},
timestamp = {Mon, 17 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2304-01433.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-15841,
author = {Trevor Gale and
Deepak Narayanan and
Cliff Young and
Matei Zaharia},
title = {MegaBlocks: Efficient Sparse Training with Mixture-of-Experts},
journal = {CoRR},
volume = {abs/2211.15841},
year = {2022},
url = {https://doi.org/10.48550/arXiv.2211.15841},
doi = {10.48550/ARXIV.2211.15841},
eprinttype = {arXiv},
eprint = {2211.15841},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2211-15841.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/RainaY21,
author = {Priyanka Raina and
Cliff Young},
title = {Best Papers From Hot Chips 32},
journal = {{IEEE} Micro},
volume = {41},
number = {2},
pages = {6},
year = {2021},
url = {https://doi.org/10.1109/MM.2021.3060294},
doi = {10.1109/MM.2021.3060294},
timestamp = {Thu, 29 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/RainaY21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/NorriePYKLLYJP21,
author = {Thomas Norrie and
Nishant Patil and
Doe Hyun Yoon and
George Kurian and
Sheng Li and
James Laudon and
Cliff Young and
Norman P. Jouppi and
David A. Patterson},
title = {The Design Process for Google's Training Chips: TPUv2 and TPUv3},
journal = {{IEEE} Micro},
volume = {41},
number = {2},
pages = {56--63},
year = {2021},
url = {https://doi.org/10.1109/MM.2021.3058217},
doi = {10.1109/MM.2021.3058217},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/NorriePYKLLYJP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/Young21,
author = {Cliff Young},
title = {Atari's {ANTIC:} My Favorite Microprocessor},
journal = {{IEEE} Micro},
volume = {41},
number = {6},
pages = {161},
year = {2021},
url = {https://doi.org/10.1109/MM.2021.3118518},
doi = {10.1109/MM.2021.3118518},
timestamp = {Wed, 15 Dec 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/micro/Young21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/JouppiYAGJKLLMM21,
author = {Norman P. Jouppi and
Doe Hyun Yoon and
Matthew Ashcraft and
Mark Gottscho and
Thomas B. Jablin and
George Kurian and
James Laudon and
Sheng Li and
Peter C. Ma and
Xiaoyu Ma and
Thomas Norrie and
Nishant Patil and
Sushma Prasad and
Cliff Young and
Zongwei Zhou and
David A. Patterson},
title = {Ten Lessons From Three Generations Shaped Google's TPUv4i : Industrial
Product},
booktitle = {48th {ACM/IEEE} Annual International Symposium on Computer Architecture,
{ISCA} 2021, Virtual Event / Valencia, Spain, June 14-18, 2021},
pages = {1--14},
publisher = {{IEEE}},
year = {2021},
url = {https://doi.org/10.1109/ISCA52012.2021.00010},
doi = {10.1109/ISCA52012.2021.00010},
timestamp = {Mon, 19 Feb 2024 07:32:07 +0100},
biburl = {https://dblp.org/rec/conf/isca/JouppiYAGJKLLMM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlsys/KumarWYBKCS21,
author = {Sameer Kumar and
Yu Emma Wang and
Cliff Young and
James Bradbury and
Naveen Kumar and
Dehao Chen and
Andy Swing},
editor = {Alex Smola and
Alex Dimakis and
Ion Stoica},
title = {Exploring the Limits of Concurrency in {ML} Training on Google {TPUS}},
booktitle = {Proceedings of Machine Learning and Systems 2021, MLSys 2021, virtual,
April 5-9, 2021},
publisher = {mlsys.org},
year = {2021},
url = {https://proceedings.mlsys.org/paper/2021/hash/28dd2c7955ce926456240b2ff0100bde-Abstract.html},
timestamp = {Mon, 23 May 2022 11:55:02 +0200},
biburl = {https://dblp.org/rec/conf/mlsys/KumarWYBKCS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/JouppiYKLPLYP20,
author = {Norman P. Jouppi and
Doe Hyun Yoon and
George Kurian and
Sheng Li and
Nishant Patil and
James Laudon and
Cliff Young and
David A. Patterson},
title = {A domain-specific supercomputer for training deep neural networks},
journal = {Commun. {ACM}},
volume = {63},
number = {7},
pages = {67--78},
year = {2020},
url = {https://doi.org/10.1145/3360307},
doi = {10.1145/3360307},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/JouppiYKLPLYP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dac/GhodratiSYKE20,
author = {Soroush Ghodrati and
Hardik Sharma and
Cliff Young and
Nam Sung Kim and
Hadi Esmaeilzadeh},
title = {Bit-Parallel Vector Composability for Neural Acceleration},
booktitle = {57th {ACM/IEEE} Design Automation Conference, {DAC} 2020, San Francisco,
CA, USA, July 20-24, 2020},
pages = {1--6},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/DAC18072.2020.9218656},
doi = {10.1109/DAC18072.2020.9218656},
timestamp = {Wed, 14 Oct 2020 10:56:17 +0200},
biburl = {https://dblp.org/rec/conf/dac/GhodratiSYKE20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotchips/NorriePYKLLYJP20,
author = {Thomas Norrie and
Nishant Patil and
Doe Hyun Yoon and
George Kurian and
Sheng Li and
James Laudon and
Cliff Young and
Norman P. Jouppi and
David A. Patterson},
title = {Google's Training Chips Revealed: TPUv2 and TPUv3},
booktitle = {{IEEE} Hot Chips 32 Symposium, {HCS} 2020, Palo Alto, CA, USA, August
16-18, 2020},
pages = {1--70},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/HCS49909.2020.9220735},
doi = {10.1109/HCS49909.2020.9220735},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hotchips/NorriePYKLLYJP20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/GhodratiAKKYASA20,
author = {Soroush Ghodrati and
Byung Hoon Ahn and
Joon Kyung Kim and
Sean Kinzer and
Brahmendra Reddy Yatham and
Navateja Alla and
Hardik Sharma and
Mohammad Alian and
Eiman Ebrahimi and
Nam Sung Kim and
Cliff Young and
Hadi Esmaeilzadeh},
title = {Planaria: Dynamic Architecture Fission for Spatial Multi-Tenant Acceleration
of Deep Neural Networks},
booktitle = {53rd Annual {IEEE/ACM} International Symposium on Microarchitecture,
{MICRO} 2020, Athens, Greece, October 17-21, 2020},
pages = {681--697},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/MICRO50266.2020.00062},
doi = {10.1109/MICRO50266.2020.00062},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micro/GhodratiAKKYASA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mlsys/MattsonCDCMPTWB20,
author = {Peter Mattson and
Christine Cheng and
Gregory F. Diamos and
Cody Coleman and
Paulius Micikevicius and
David A. Patterson and
Hanlin Tang and
Gu{-}Yeon Wei and
Peter Bailis and
Victor Bittorf and
David Brooks and
Dehao Chen and
Debo Dutta and
Udit Gupta and
Kim M. Hazelwood and
Andy Hock and
Xinyuan Huang and
Daniel Kang and
David Kanter and
Naveen Kumar and
Jeffery Liao and
Deepak Narayanan and
Tayo Oguntebi and
Gennady Pekhimenko and
Lillian Pentecost and
Vijay Janapa Reddi and
Taylor Robie and
Tom St. John and
Carole{-}Jean Wu and
Lingjie Xu and
Cliff Young and
Matei Zaharia},
editor = {Inderjit S. Dhillon and
Dimitris S. Papailiopoulos and
Vivienne Sze},
title = {MLPerf Training Benchmark},
booktitle = {Proceedings of Machine Learning and Systems 2020, MLSys 2020, Austin,
TX, USA, March 2-4, 2020},
publisher = {mlsys.org},
year = {2020},
url = {https://proceedings.mlsys.org/book/309.pdf},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mlsys/MattsonCDCMPTWB20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/GaleZYE20,
author = {Trevor Gale and
Matei Zaharia and
Cliff Young and
Erich Elsen},
editor = {Christine Cuicchi and
Irene Qualters and
William T. Kramer},
title = {Sparse {GPU} kernels for deep learning},
booktitle = {Proceedings of the International Conference for High Performance Computing,
Networking, Storage and Analysis, {SC} 2020, Virtual Event / Atlanta,
Georgia, USA, November 9-19, 2020},
pages = {17},
publisher = {{IEEE/ACM}},
year = {2020},
url = {https://doi.org/10.1109/SC41405.2020.00021},
doi = {10.1109/SC41405.2020.00021},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/GaleZYE20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-05333,
author = {Soroush Ghodrati and
Hardik Sharma and
Cliff Young and
Nam Sung Kim and
Hadi Esmaeilzadeh},
title = {Bit-Parallel Vector Composability for Neural Acceleration},
journal = {CoRR},
volume = {abs/2004.05333},
year = {2020},
url = {https://arxiv.org/abs/2004.05333},
eprinttype = {arXiv},
eprint = {2004.05333},
timestamp = {Tue, 14 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2004-05333.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2006-10901,
author = {Trevor Gale and
Matei Zaharia and
Cliff Young and
Erich Elsen},
title = {Sparse {GPU} Kernels for Deep Learning},
journal = {CoRR},
volume = {abs/2006.10901},
year = {2020},
url = {https://arxiv.org/abs/2006.10901},
eprinttype = {arXiv},
eprint = {2006.10901},
timestamp = {Tue, 23 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-2006-10901.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2011-03641,
author = {Sameer Kumar and
James Bradbury and
Cliff Young and
Yu Emma Wang and
Anselm Levskaya and
Blake A. Hechtman and
Dehao Chen and
HyoukJoong Lee and
Mehmet Deveci and
Naveen Kumar and
Pankaj Kanwar and
Shibo Wang and
Skye Wanderman{-}Milne and
Steve Lacy and
Tao Wang and
Tayo Oguntebi and
Yazhou Zu and
Yuanzhong Xu and
Andy Swing},
title = {Exploring the limits of Concurrency in {ML} Training on Google TPUs},
journal = {CoRR},
volume = {abs/2011.03641},
year = {2020},
url = {https://arxiv.org/abs/2011.03641},
eprinttype = {arXiv},
eprint = {2011.03641},
timestamp = {Thu, 12 Nov 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-2011-03641.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1910-01500,
author = {Peter Mattson and
Christine Cheng and
Cody Coleman and
Greg Diamos and
Paulius Micikevicius and
David A. Patterson and
Hanlin Tang and
Gu{-}Yeon Wei and
Peter Bailis and
Victor Bittorf and
David Brooks and
Dehao Chen and
Debojyoti Dutta and
Udit Gupta and
Kim M. Hazelwood and
Andrew Hock and
Xinyuan Huang and
Bill Jia and
Daniel Kang and
David Kanter and
Naveen Kumar and
Jeffery Liao and
Guokai Ma and
Deepak Narayanan and
Tayo Oguntebi and
Gennady Pekhimenko and
Lillian Pentecost and
Vijay Janapa Reddi and
Taylor Robie and
Tom St. John and
Carole{-}Jean Wu and
Lingjie Xu and
Cliff Young and
Matei Zaharia},
title = {MLPerf Training Benchmark},
journal = {CoRR},
volume = {abs/1910.01500},
year = {2019},
url = {http://arxiv.org/abs/1910.01500},
eprinttype = {arXiv},
eprint = {1910.01500},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/abs-1910-01500.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/JouppiYPP18,
author = {Norman P. Jouppi and
Cliff Young and
Nishant Patil and
David A. Patterson},
title = {A domain-specific architecture for deep neural networks},
journal = {Commun. {ACM}},
volume = {61},
number = {9},
pages = {50--59},
year = {2018},
url = {https://doi.org/10.1145/3154484},
doi = {10.1145/3154484},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/JouppiYPP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/DeanPY18,
author = {Jeff Dean and
David A. Patterson and
Cliff Young},
title = {A New Golden Age in Computer Architecture: Empowering the Machine-Learning
Revolution},
journal = {{IEEE} Micro},
volume = {38},
number = {2},
pages = {21--29},
year = {2018},
url = {https://doi.org/10.1109/MM.2018.112130030},
doi = {10.1109/MM.2018.112130030},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/DeanPY18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/JouppiYPP18,
author = {Norman P. Jouppi and
Cliff Young and
Nishant Patil and
David A. Patterson},
title = {Motivation for and Evaluation of the First Tensor Processing Unit},
journal = {{IEEE} Micro},
volume = {38},
number = {3},
pages = {10--19},
year = {2018},
url = {https://doi.org/10.1109/MM.2018.032271057},
doi = {10.1109/MM.2018.032271057},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/JouppiYPP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ShazeerCPTVKHLH18,
author = {Noam Shazeer and
Youlong Cheng and
Niki Parmar and
Dustin Tran and
Ashish Vaswani and
Penporn Koanantakool and
Peter Hawkins and
HyoukJoong Lee and
Mingsheng Hong and
Cliff Young and
Ryan Sepassi and
Blake A. Hechtman},
editor = {Samy Bengio and
Hanna M. Wallach and
Hugo Larochelle and
Kristen Grauman and
Nicol{\`{o}} Cesa{-}Bianchi and
Roman Garnett},
title = {Mesh-TensorFlow: Deep Learning for Supercomputers},
booktitle = {Advances in Neural Information Processing Systems 31: Annual Conference
on Neural Information Processing Systems 2018, NeurIPS 2018, December
3-8, 2018, Montr{\'{e}}al, Canada},
pages = {10435--10444},
year = {2018},
url = {https://proceedings.neurips.cc/paper/2018/hash/3a37abdeefe1dab1b30f7c5c7e581b93-Abstract.html},
timestamp = {Mon, 16 May 2022 15:41:51 +0200},
biburl = {https://dblp.org/rec/conf/nips/ShazeerCPTVKHLH18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-02084,
author = {Noam Shazeer and
Youlong Cheng and
Niki Parmar and
Dustin Tran and
Ashish Vaswani and
Penporn Koanantakool and
Peter Hawkins and
HyoukJoong Lee and
Mingsheng Hong and
Cliff Young and
Ryan Sepassi and
Blake A. Hechtman},
title = {Mesh-TensorFlow: Deep Learning for Supercomputers},
journal = {CoRR},
volume = {abs/1811.02084},
year = {2018},
url = {http://arxiv.org/abs/1811.02084},
eprinttype = {arXiv},
eprint = {1811.02084},
timestamp = {Thu, 22 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/abs-1811-02084.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/JouppiYPPABBBBB17,
author = {Norman P. Jouppi and
Cliff Young and
Nishant Patil and
David A. Patterson and
Gaurav Agrawal and
Raminder Bajwa and
Sarah Bates and
Suresh Bhatia and
Nan Boden and
Al Borchers and
Rick Boyle and
Pierre{-}luc Cantin and
Clifford Chao and
Chris Clark and
Jeremy Coriell and
Mike Daley and
Matt Dau and
Jeffrey Dean and
Ben Gelb and
Tara Vazir Ghaemmaghami and
Rajendra Gottipati and
William Gulland and
Robert Hagmann and
C. Richard Ho and
Doug Hogberg and
John Hu and
Robert Hundt and
Dan Hurt and
Julian Ibarz and
Aaron Jaffey and
Alek Jaworski and
Alexander Kaplan and
Harshit Khaitan and
Daniel Killebrew and
Andy Koch and
Naveen Kumar and
Steve Lacy and
James Laudon and
James Law and
Diemthu Le and
Chris Leary and
Zhuyuan Liu and
Kyle Lucke and
Alan Lundin and
Gordon MacKean and
Adriana Maggiore and
Maire Mahony and
Kieran Miller and
Rahul Nagarajan and
Ravi Narayanaswami and
Ray Ni and
Kathy Nix and
Thomas Norrie and
Mark Omernick and
Narayana Penukonda and
Andy Phelps and
Jonathan Ross and
Matt Ross and
Amir Salek and
Emad Samadiani and
Chris Severn and
Gregory Sizikov and
Matthew Snelham and
Jed Souter and
Dan Steinberg and
Andy Swing and
Mercedes Tan and
Gregory Thorson and
Bo Tian and
Horia Toma and
Erick Tuttle and
Vijay Vasudevan and
Richard Walter and
Walter Wang and
Eric Wilcox and
Doe Hyun Yoon},
title = {In-Datacenter Performance Analysis of a Tensor Processing Unit},
booktitle = {Proceedings of the 44th Annual International Symposium on Computer
Architecture, {ISCA} 2017, Toronto, ON, Canada, June 24-28, 2017},
pages = {1--12},
publisher = {{ACM}},
year = {2017},
url = {https://doi.org/10.1145/3079856.3080246},
doi = {10.1145/3079856.3080246},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/JouppiYPPABBBBB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JouppiYPPABBBBB17,
author = {Norman P. Jouppi and
Cliff Young and
Nishant Patil and
David A. Patterson and
Gaurav Agrawal and
Raminder Bajwa and
Sarah Bates and
Suresh Bhatia and
Nan Boden and
Al Borchers and
Rick Boyle and
Pierre{-}luc Cantin and
Clifford Chao and
Chris Clark and
Jeremy Coriell and
Mike Daley and
Matt Dau and
Jeffrey Dean and
Ben Gelb and
Tara Vazir Ghaemmaghami and
Rajendra Gottipati and
William Gulland and
Robert Hagmann and
C. Richard Ho and
Doug Hogberg and
John Hu and
Robert Hundt and
Dan Hurt and
Julian Ibarz and
Aaron Jaffey and
Alek Jaworski and
Alexander Kaplan and
Harshit Khaitan and
Andy Koch and
Naveen Kumar and
Steve Lacy and
James Laudon and
James Law and
Diemthu Le and
Chris Leary and
Zhuyuan Liu and
Kyle Lucke and
Alan Lundin and
Gordon MacKean and
Adriana Maggiore and
Maire Mahony and
Kieran Miller and
Rahul Nagarajan and
Ravi Narayanaswami and
Ray Ni and
Kathy Nix and
Thomas Norrie and
Mark Omernick and
Narayana Penukonda and
Andy Phelps and
Jonathan Ross and
Amir Salek and
Emad Samadiani and
Chris Severn and
Gregory Sizikov and
Matthew Snelham and
Jed Souter and
Dan Steinberg and
Andy Swing and
Mercedes Tan and
Gregory Thorson and
Bo Tian and
Horia Toma and
Erick Tuttle and
Vijay Vasudevan and
Richard Walter and
Walter Wang and
Eric Wilcox and
Doe Hyun Yoon},
title = {In-Datacenter Performance Analysis of a Tensor Processing Unit},
journal = {CoRR},
volume = {abs/1704.04760},
year = {2017},
url = {http://arxiv.org/abs/1704.04760},
eprinttype = {arXiv},
eprint = {1704.04760},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/corr/JouppiYPPABBBBB17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WuSCLNMKCGMKSJL16,
author = {Yonghui Wu and
Mike Schuster and
Zhifeng Chen and
Quoc V. Le and
Mohammad Norouzi and
Wolfgang Macherey and
Maxim Krikun and
Yuan Cao and
Qin Gao and
Klaus Macherey and
Jeff Klingner and
Apurva Shah and
Melvin Johnson and
Xiaobing Liu and
Lukasz Kaiser and
Stephan Gouws and
Yoshikiyo Kato and
Taku Kudo and
Hideto Kazawa and
Keith Stevens and
George Kurian and
Nishant Patil and
Wei Wang and
Cliff Young and
Jason Smith and
Jason Riesa and
Alex Rudnick and
Oriol Vinyals and
Greg Corrado and
Macduff Hughes and
Jeffrey Dean},
title = {Google's Neural Machine Translation System: Bridging the Gap between
Human and Machine Translation},
journal = {CoRR},
volume = {abs/1609.08144},
year = {2016},
url = {http://arxiv.org/abs/1609.08144},
eprinttype = {arXiv},
eprint = {1609.08144},
timestamp = {Thu, 14 Jan 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/corr/WuSCLNMKCGMKSJL16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14,
author = {David E. Shaw and
J. P. Grossman and
Joseph A. Bank and
Brannon Batson and
J. Adam Butts and
Jack C. Chao and
Martin M. Deneroff and
Ron O. Dror and
Amos Even and
Christopher H. Fenton and
Anthony Forte and
Joseph Gagliardo and
Gennette Gill and
Brian Greskamp and
C. Richard Ho and
Douglas J. Ierardi and
Lev Iserovich and
Jeffrey Kuskin and
Richard H. Larson and
Timothy Layman and
Li{-}Siang Lee and
Adam K. Lerer and
Chester Li and
Daniel Killebrew and
Kenneth M. Mackenzie and
Shark Yeuk{-}Hai Mok and
Mark A. Moraes and
Rolf Mueller and
Lawrence J. Nociolo and
Jon L. Peticolas and
Terry Quan and
Daniel Ramot and
John K. Salmon and
Daniele Paolo Scarpazza and
U. Ben Schafer and
Naseer Siddique and
Christopher W. Snyder and
Jochen Spengler and
Ping Tak Peter Tang and
Michael Theobald and
Horia Toma and
Brian Towles and
Benjamin Vitale and
Stanley C. Wang and
Cliff Young},
editor = {Trish Damkroger and
Jack J. Dongarra},
title = {Anton 2: Raising the Bar for Performance and Programmability in a
Special-Purpose Molecular Dynamics Supercomputer},
booktitle = {International Conference for High Performance Computing, Networking,
Storage and Analysis, {SC} 2014, New Orleans, LA, USA, November 16-21,
2014},
pages = {41--53},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/SC.2014.9},
doi = {10.1109/SC.2014.9},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/GrossmanKBTDILSTYS13,
author = {J. P. Grossman and
Jeffrey Kuskin and
Joseph A. Bank and
Michael Theobald and
Ron O. Dror and
Douglas J. Ierardi and
Richard H. Larson and
U. Ben Schafer and
Brian Towles and
Cliff Young and
David E. Shaw},
editor = {Vivek Sarkar and
Rastislav Bod{\'{\i}}k},
title = {Hardware support for fine-grained event-driven computation in Anton
2},
booktitle = {Architectural Support for Programming Languages and Operating Systems,
{ASPLOS} 2013, Houston, TX, USA, March 16-20, 2013},
pages = {549--560},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2451116.2451175},
doi = {10.1145/2451116.2451175},
timestamp = {Wed, 07 Jul 2021 13:23:08 +0200},
biburl = {https://dblp.org/rec/conf/asplos/GrossmanKBTDILSTYS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/DrorGMTCSYBBSKLMS11,
author = {Ron O. Dror and
J. P. Grossman and
Kenneth M. Mackenzie and
Brian Towles and
Edmond Chow and
John K. Salmon and
Cliff Young and
Joseph A. Bank and
Brannon Batson and
Martin M. Deneroff and
Jeffrey Kuskin and
Richard H. Larson and
Mark A. Moraes and
David E. Shaw},
title = {Overcoming Communication Latency Barriers in Massively Parallel Scientific
Computation},
journal = {{IEEE} Micro},
volume = {31},
number = {3},
pages = {8--19},
year = {2011},
url = {https://doi.org/10.1109/MM.2011.38},
doi = {10.1109/MM.2011.38},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/micro/DrorGMTCSYBBSKLMS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/parallel/DrorYS11,
author = {Ron O. Dror and
Cliff Young and
David E. Shaw},
editor = {David A. Padua},
title = {Anton, {A} Special-Purpose Molecular Simulation Machine},
booktitle = {Encyclopedia of Parallel Computing},
pages = {60--71},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-0-387-09766-4\_199},
doi = {10.1007/978-0-387-09766-4\_199},
timestamp = {Wed, 12 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/parallel/DrorYS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/parallel/FisherFY11,
author = {Joseph A. Fisher and
Paolo Faraboschi and
Cliff Young},
editor = {David A. Padua},
title = {{VLIW} Processors},
booktitle = {Encyclopedia of Parallel Computing},
pages = {2135--2142},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-0-387-09766-4\_471},
doi = {10.1007/978-0-387-09766-4\_471},
timestamp = {Wed, 12 Jul 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/reference/parallel/FisherFY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/DrorGMTCSYBBDKLMS10,
author = {Ron O. Dror and
J. P. Grossman and
Kenneth M. Mackenzie and
Brian Towles and
Edmond Chow and
John K. Salmon and
Cliff Young and
Joseph A. Bank and
Brannon Batson and
Martin M. Deneroff and
Jeffrey Kuskin and
Richard H. Larson and
Mark A. Moraes and
David E. Shaw},
title = {Exploiting 162-Nanosecond End-to-End Communication Latency on Anton},
booktitle = {Conference on High Performance Computing Networking, Storage and Analysis,
{SC} 2010, New Orleans, LA, USA, November 13-19, 2010},
pages = {1--12},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/SC.2010.23},
doi = {10.1109/SC.2010.23},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/sc/DrorGMTCSYBBDKLMS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09,
author = {David E. Shaw and
Ron O. Dror and
John K. Salmon and
J. P. Grossman and
Kenneth M. Mackenzie and
Joseph A. Bank and
Cliff Young and
Martin M. Deneroff and
Brannon Batson and
Kevin J. Bowers and
Edmond Chow and
Michael P. Eastwood and
Doug Ierardi and
John L. Klepeis and
Jeffrey Kuskin and
Richard H. Larson and
Kresten Lindorff{-}Larsen and
Paul Maragakis and
Mark A. Moraes and
Stefano Piana and
Yibing Shan and
Brian Towles},
title = {Millisecond-scale molecular dynamics simulations on Anton},
booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
{SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1654059.1654099},
doi = {10.1145/1654059.1654099},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09a,
author = {David E. Shaw and
Ron O. Dror and
John K. Salmon and
J. P. Grossman and
Kenneth M. Mackenzie and
Joseph A. Bank and
Cliff Young and
Martin M. Deneroff and
Brannon Batson and
Kevin J. Bowers and
Edmond Chow and
Michael P. Eastwood and
Doug Ierardi and
John L. Klepeis and
Jeffrey Kuskin and
Richard H. Larson and
Kresten Lindorff{-}Larsen and
Paul Maragakis and
Mark A. Moraes and
Stefano Piana and
Yibing Shan and
Brian Towles},
title = {Millisecond-scale molecular dynamics simulations on Anton},
booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
{SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1654059.1654126},
doi = {10.1145/1654059.1654126},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/YoungBDGSS09,
author = {Cliff Young and
Joseph A. Bank and
Ron O. Dror and
J. P. Grossman and
John K. Salmon and
David E. Shaw},
title = {A 32x32x32, spatially distributed 3D {FFT} in four microseconds on
Anton},
booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
{SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1654059.1654083},
doi = {10.1145/1654059.1654083},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/sc/YoungBDGSS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08,
author = {David E. Shaw and
Martin M. Deneroff and
Ron O. Dror and
Jeffrey Kuskin and
Richard H. Larson and
John K. Salmon and
Cliff Young and
Brannon Batson and
Kevin J. Bowers and
Jack C. Chao and
Michael P. Eastwood and
Joseph Gagliardo and
J. P. Grossman and
C. Richard Ho and
Doug Ierardi and
Istv{\'{a}}n Kolossv{\'{a}}ry and
John L. Klepeis and
Timothy Layman and
Christine McLeavey and
Mark A. Moraes and
Rolf Mueller and
Edward C. Priest and
Yibing Shan and
Jochen Spengler and
Michael Theobald and
Brian Towles and
Stanley C. Wang},
title = {Anton, a special-purpose machine for molecular dynamics simulation},
journal = {Commun. {ACM}},
volume = {51},
number = {7},
pages = {91--97},
year = {2008},
url = {https://doi.org/10.1145/1364782.1364802},
doi = {10.1145/1364782.1364802},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/codes/GrossmanYBMISDS08,
author = {J. P. Grossman and
Cliff Young and
Joseph A. Bank and
Kenneth M. Mackenzie and
Doug Ierardi and
John K. Salmon and
Ron O. Dror and
David E. Shaw},
editor = {Catherine H. Gebotys and
Grant Martin},
title = {Simulation and embedded software development for Anton, a parallel
machine with heterogeneous multicore ASICs},
booktitle = {Proceedings of the 6th International Conference on Hardware/Software
Codesign and System Synthesis, {CODES+ISSS} 2008, Atlanta, GA, USA,
October 19-24, 2008},
pages = {125--130},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1450135.1450165},
doi = {10.1145/1450135.1450165},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/codes/GrossmanYBMISDS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LarsonSDDYGSKS08,
author = {Richard H. Larson and
John K. Salmon and
Ron O. Dror and
Martin M. Deneroff and
Cliff Young and
J. P. Grossman and
Yibing Shan and
John L. Klepeis and
David E. Shaw},
title = {High-throughput pairwise point interactions in Anton, a specialized
machine for molecular dynamics simulation},
booktitle = {14th International Conference on High-Performance Computer Architecture
{(HPCA-14} 2008), 16-20 February 2008, Salt Lake City, UT, {USA}},
pages = {331--342},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HPCA.2008.4658650},
doi = {10.1109/HPCA.2008.4658650},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpca/LarsonSDDYGSKS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/KuskinYGBDDS08,
author = {Jeffrey Kuskin and
Cliff Young and
J. P. Grossman and
Brannon Batson and
Martin M. Deneroff and
Ron O. Dror and
David E. Shaw},
title = {Incorporating flexibility in Anton, a specialized machine for molecular
dynamics simulation},
booktitle = {14th International Conference on High-Performance Computer Architecture
{(HPCA-14} 2008), 16-20 February 2008, Salt Lake City, UT, {USA}},
pages = {343--354},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/HPCA.2008.4658651},
doi = {10.1109/HPCA.2008.4658651},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/hpca/KuskinYGBDDS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/GrossmanSHITBSWMTYGDDS08,
author = {J. P. Grossman and
John K. Salmon and
C. Richard Ho and
Doug Ierardi and
Brian Towles and
Brannon Batson and
Jochen Spengler and
Stanley C. Wang and
Rolf Mueller and
Michael Theobald and
Cliff Young and
Joseph Gagliardo and
Martin M. Deneroff and
Ron O. Dror and
David E. Shaw},
title = {Hierarchical simulation-based verification of Anton, a special-purpose
parallel machine},
booktitle = {26th International Conference on Computer Design, {ICCD} 2008, 12-15
October 2008, Lake Tahoe, CA, USA, Proceedings},
pages = {340--347},
publisher = {{IEEE} Computer Society},
year = {2008},
url = {https://doi.org/10.1109/ICCD.2008.4751883},
doi = {10.1109/ICCD.2008.4751883},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/iccd/GrossmanSHITBSWMTYGDDS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07,
author = {David E. Shaw and
Martin M. Deneroff and
Ron O. Dror and
Jeffrey Kuskin and
Richard H. Larson and
John K. Salmon and
Cliff Young and
Brannon Batson and
Kevin J. Bowers and
Jack C. Chao and
Michael P. Eastwood and
Joseph Gagliardo and
J. P. Grossman and
C. Richard Ho and
Doug Ierardi and
Istv{\'{a}}n Kolossv{\'{a}}ry and
John L. Klepeis and
Timothy Layman and
Christine McLeavey and
Mark A. Moraes and
Rolf Mueller and
Edward C. Priest and
Yibing Shan and
Jochen Spengler and
Michael Theobald and
Brian Towles and
Stanley C. Wang},
editor = {Dean M. Tullsen and
Brad Calder},
title = {Anton, a special-purpose machine for molecular dynamics simulation},
booktitle = {34th International Symposium on Computer Architecture {(ISCA} 2007),
June 9-13, 2007, San Diego, California, {USA}},
pages = {1--12},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1250662.1250664},
doi = {10.1145/1250662.1250664},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/Young06,
author = {Cliff Young},
editor = {Atul Adya and
Erich M. Nahum},
title = {Architectures and Algorithms for Biomolecular Simulation},
booktitle = {Proceedings of the 2006 {USENIX} Annual Technical Conference, Boston,
MA, USA, May 30 - June 3, 2006},
publisher = {{USENIX}},
year = {2006},
url = {http://www.usenix.org/events/usenix06/tech/mp3/young.mp3},
timestamp = {Mon, 01 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/usenix/Young06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0013596,
author = {Joseph A. Fisher and
Paolo Faraboschi and
Cliff Young},
title = {Embedded computing - a {VLIW} approach to architecture, compilers,
and tools},
publisher = {Morgan Kaufmann},
year = {2005},
isbn = {978-1-55860-766-8},
timestamp = {Fri, 01 Apr 2011 01:00:00 +0200},
biburl = {https://dblp.org/rec/books/daglib/0013596.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pieee/FaraboschiFY01,
author = {Paolo Faraboschi and
Joseph A. Fisher and
Cliff Young},
title = {Instruction scheduling for instruction level parallel processors},
journal = {Proc. {IEEE}},
volume = {89},
number = {11},
pages = {1638--1659},
year = {2001},
url = {https://doi.org/10.1109/5.964443},
doi = {10.1109/5.964443},
timestamp = {Thu, 23 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/pieee/FaraboschiFY01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotos/YoungLSRPPNMG01,
author = {Cliff Young and
Yagati N. Lakshman and
Tom Szymanski and
John H. Reppy and
David L. Presotto and
Rob Pike and
Girija J. Narlikar and
Sape J. Mullender and
Eric Grosse},
title = {Protium, an Infrastructure for Partitioned Applications},
booktitle = {Proceedings of HotOS-VIII: 8th Workshop on Hot Topics in Operating
Systems, May 20-23, 2001, Elmau/Oberbayern, Germany},
pages = {47--52},
publisher = {{IEEE} Computer Society},
year = {2001},
url = {https://doi.org/10.1109/HOTOS.2001.990060},
doi = {10.1109/HOTOS.2001.990060},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hotos/YoungLSRPPNMG01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jilp/SavariY00,
author = {Serap A. Savari and
Cliff Young},
title = {Comparing and Combining Profiles},
journal = {J. Instr. Level Parallelism},
volume = {2},
year = {2000},
url = {http://www.jilp.org/vol2/v2paper4.pdf},
timestamp = {Mon, 11 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jilp/SavariY00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/KaxirasY00,
author = {Stefanos Kaxiras and
Cliff Young},
title = {Coherence Communication Prediction in Shared-Memory Multiprocessors},
booktitle = {Proceedings of the Sixth International Symposium on High-Performance
Computer Architecture, Toulouse, France, January 8-12, 2000},
pages = {156--167},
publisher = {{IEEE} Computer Society},
year = {2000},
url = {https://doi.org/10.1109/HPCA.2000.824347},
doi = {10.1109/HPCA.2000.824347},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/hpca/KaxirasY00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toplas/YoungS99,
author = {Cliff Young and
Michael D. Smith},
title = {Static correlated branch prediction},
journal = {{ACM} Trans. Program. Lang. Syst.},
volume = {21},
number = {5},
pages = {1028--1075},
year = {1999},
url = {https://doi.org/10.1145/330249.330255},
doi = {10.1145/330249.330255},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/toplas/YoungS99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/YoungS98,
author = {Cliff Young and
Michael D. Smith},
editor = {James O. Bondi and
Jim Smith},
title = {Better Global Scheduling Using Path Profiles},
booktitle = {Proceedings of the 31st Annual {IEEE/ACM} International Symposium
on Microarchitecture, {MICRO} 31, Dallas, Texas, USA, November 30
- December 2, 1998},
pages = {115--123},
publisher = {{ACM/IEEE} Computer Society},
year = {1998},
url = {https://doi.org/10.1109/MICRO.1998.742774},
doi = {10.1109/MICRO.1998.742774},
timestamp = {Tue, 31 May 2022 14:39:58 +0200},
biburl = {https://dblp.org/rec/conf/micro/YoungS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pldi/YoungJKS97,
author = {Cliff Young and
David S. Johnson and
David R. Karger and
Michael D. Smith},
editor = {Marina C. Chen and
Ron K. Cytron and
A. Michael Berman},
title = {Near-optimal Intraprocedural Branch Alignment},
booktitle = {Proceedings of the {ACM} {SIGPLAN} '97 Conference on Programming Language
Design and Implementation (PLDI), Las Vegas, Nevada, USA, June 15-18,
1997},
pages = {183--193},
publisher = {{ACM}},
year = {1997},
url = {https://doi.org/10.1145/258915.258932},
doi = {10.1145/258915.258932},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/pldi/YoungJKS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/Gloy96,
author = {Nicholas C. Gloy and
Cliff Young and
J. Bradley Chen and
Michael D. Smith},
editor = {Jean{-}Loup Baer},
title = {An Analysis of Dynamic Branch Prediction Schemes on System Workloads},
booktitle = {Proceedings of the 23rd Annual International Symposium on Computer
Architecture, Philadelphia, PA, USA, May 22-24, 1996},
pages = {12--21},
publisher = {{ACM}},
year = {1996},
url = {https://doi.org/10.1145/232973.232977},
doi = {10.1145/232973.232977},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isca/Gloy96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/YoungGS95,
author = {Cliff Young and
Nicholas C. Gloy and
Michael D. Smith},
editor = {David A. Patterson},
title = {A Comparative Analysis of Schemes for Correlated Branch Prediction},
booktitle = {Proceedings of the 22nd Annual International Symposium on Computer
Architecture, {ISCA} '95, Santa Margherita Ligure, Italy, June 22-24,
1995},
pages = {276--286},
publisher = {{ACM}},
year = {1995},
url = {https://doi.org/10.1145/223982.224438},
doi = {10.1145/223982.224438},
timestamp = {Thu, 13 Apr 2023 19:55:42 +0200},
biburl = {https://dblp.org/rec/conf/isca/YoungGS95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/GloySY95,
author = {Nicholas C. Gloy and
Michael D. Smith and
Cliff Young},
editor = {Trevor N. Mudge and
Kemal Ebcioglu},
title = {Performance issues in correlated branch prediction schemes},
booktitle = {Proceedings of the 28th Annual International Symposium on Microarchitecture,
Ann Arbor, Michigan, USA, November 29 - December 1, 1995},
pages = {3--14},
publisher = {{ACM} / {IEEE} Computer Society},
year = {1995},
url = {https://doi.org/10.1109/MICRO.1995.476808},
doi = {10.1109/MICRO.1995.476808},
timestamp = {Tue, 31 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/micro/GloySY95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/YoungS94,
author = {Cliff Young and
Michael D. Smith},
editor = {Forest Baskett and
Douglas W. Clark},
title = {Improving the Accuracy of Static Branch Prediction Using Branch Correlation},
booktitle = {{ASPLOS-VI} Proceedings - Sixth International Conference on Architectural
Support for Programming Languages and Operating Systems, San Jose,
California, USA, October 4-7, 1994},
pages = {232--241},
publisher = {{ACM} Press},
year = {1994},
url = {https://doi.org/10.1145/195473.195549},
doi = {10.1145/195473.195549},
timestamp = {Wed, 07 Jul 2021 13:23:09 +0200},
biburl = {https://dblp.org/rec/conf/asplos/YoungS94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/BlackwellCCCGKKLLMPTYZ94,
author = {Trevor Blackwell and
Kee Chan and
Koling Chang and
Thomas Charuhas and
James Gwertzman and
Brad Karp and
H. T. Kung and
David Li and
Dong Lin and
Robert Tappan Morris and
Rob Polansky and
Diane Tang and
Cliff Young and
John Zao},
title = {Secure Short-Cut Routing for Mobile {IP}},
booktitle = {{USENIX} Summer 1994 Technical Conference, Boston, Massachusetts,
USA, June 6-10, 1994, Conference Proceeding},
pages = {305--316},
publisher = {{USENIX} Association},
year = {1994},
url = {https://www.usenix.org/conference/usenix-summer-1994-technical-conference/secure-short-cut-routing-mobile-ip},
timestamp = {Mon, 01 Feb 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/usenix/BlackwellCCCGKKLLMPTYZ94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-02-06 23:45 CET by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
