BibTeX records: Cliff Young

download as .bib file

@article{DBLP:journals/corr/abs-1910-01500,
  author    = {Peter Mattson and
               Christine Cheng and
               Cody Coleman and
               Greg Diamos and
               Paulius Micikevicius and
               David A. Patterson and
               Hanlin Tang and
               Gu{-}Yeon Wei and
               Peter Bailis and
               Victor Bittorf and
               David Brooks and
               Dehao Chen and
               Debojyoti Dutta and
               Udit Gupta and
               Kim M. Hazelwood and
               Andrew Hock and
               Xinyuan Huang and
               Bill Jia and
               Daniel Kang and
               David Kanter and
               Naveen Kumar and
               Jeffery Liao and
               Guokai Ma and
               Deepak Narayanan and
               Tayo Oguntebi and
               Gennady Pekhimenko and
               Lillian Pentecost and
               Vijay Janapa Reddi and
               Taylor Robie and
               Tom St. John and
               Carole{-}Jean Wu and
               Lingjie Xu and
               Cliff Young and
               Matei Zaharia},
  title     = {MLPerf Training Benchmark},
  journal   = {CoRR},
  volume    = {abs/1910.01500},
  year      = {2019},
  url       = {http://arxiv.org/abs/1910.01500},
  archivePrefix = {arXiv},
  eprint    = {1910.01500},
  timestamp = {Mon, 04 Nov 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/corr/abs-1910-01500.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/JouppiYPP18,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson},
  title     = {A domain-specific architecture for deep neural networks},
  journal   = {Commun. {ACM}},
  volume    = {61},
  number    = {9},
  pages     = {50--59},
  year      = {2018},
  url       = {https://doi.org/10.1145/3154484},
  doi       = {10.1145/3154484},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/cacm/JouppiYPP18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/DeanPY18,
  author    = {Jeff Dean and
               David A. Patterson and
               Cliff Young},
  title     = {A New Golden Age in Computer Architecture: Empowering the Machine-Learning
               Revolution},
  journal   = {{IEEE} Micro},
  volume    = {38},
  number    = {2},
  pages     = {21--29},
  year      = {2018},
  url       = {https://doi.org/10.1109/MM.2018.112130030},
  doi       = {10.1109/MM.2018.112130030},
  timestamp = {Fri, 11 May 2018 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/micro/DeanPY18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/JouppiYPP18,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson},
  title     = {Motivation for and Evaluation of the First Tensor Processing Unit},
  journal   = {{IEEE} Micro},
  volume    = {38},
  number    = {3},
  pages     = {10--19},
  year      = {2018},
  url       = {https://doi.org/10.1109/MM.2018.032271057},
  doi       = {10.1109/MM.2018.032271057},
  timestamp = {Tue, 29 May 2018 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/micro/JouppiYPP18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/ShazeerCPTVKHLH18,
  author    = {Noam Shazeer and
               Youlong Cheng and
               Niki Parmar and
               Dustin Tran and
               Ashish Vaswani and
               Penporn Koanantakool and
               Peter Hawkins and
               HyoukJoong Lee and
               Mingsheng Hong and
               Cliff Young and
               Ryan Sepassi and
               Blake A. Hechtman},
  editor    = {Samy Bengio and
               Hanna M. Wallach and
               Hugo Larochelle and
               Kristen Grauman and
               Nicol{\`{o}} Cesa{-}Bianchi and
               Roman Garnett},
  title     = {Mesh-TensorFlow: Deep Learning for Supercomputers},
  booktitle = {Advances in Neural Information Processing Systems 31: Annual Conference
               on Neural Information Processing Systems 2018, NeurIPS 2018, 3-8 December
               2018, Montr{\'{e}}al, Canada},
  pages     = {10435--10444},
  year      = {2018},
  url       = {http://papers.nips.cc/paper/8242-mesh-tensorflow-deep-learning-for-supercomputers},
  timestamp = {Fri, 06 Mar 2020 17:00:31 +0100},
  biburl    = {https://dblp.org/rec/conf/nips/ShazeerCPTVKHLH18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1811-02084,
  author    = {Noam Shazeer and
               Youlong Cheng and
               Niki Parmar and
               Dustin Tran and
               Ashish Vaswani and
               Penporn Koanantakool and
               Peter Hawkins and
               HyoukJoong Lee and
               Mingsheng Hong and
               Cliff Young and
               Ryan Sepassi and
               Blake A. Hechtman},
  title     = {Mesh-TensorFlow: Deep Learning for Supercomputers},
  journal   = {CoRR},
  volume    = {abs/1811.02084},
  year      = {2018},
  url       = {http://arxiv.org/abs/1811.02084},
  archivePrefix = {arXiv},
  eprint    = {1811.02084},
  timestamp = {Thu, 22 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/corr/abs-1811-02084.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/JouppiYPPABBBBB17,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson and
               Gaurav Agrawal and
               Raminder Bajwa and
               Sarah Bates and
               Suresh Bhatia and
               Nan Boden and
               Al Borchers and
               Rick Boyle and
               Pierre{-}luc Cantin and
               Clifford Chao and
               Chris Clark and
               Jeremy Coriell and
               Mike Daley and
               Matt Dau and
               Jeffrey Dean and
               Ben Gelb and
               Tara Vazir Ghaemmaghami and
               Rajendra Gottipati and
               William Gulland and
               Robert Hagmann and
               C. Richard Ho and
               Doug Hogberg and
               John Hu and
               Robert Hundt and
               Dan Hurt and
               Julian Ibarz and
               Aaron Jaffey and
               Alek Jaworski and
               Alexander Kaplan and
               Harshit Khaitan and
               Daniel Killebrew and
               Andy Koch and
               Naveen Kumar and
               Steve Lacy and
               James Laudon and
               James Law and
               Diemthu Le and
               Chris Leary and
               Zhuyuan Liu and
               Kyle Lucke and
               Alan Lundin and
               Gordon MacKean and
               Adriana Maggiore and
               Maire Mahony and
               Kieran Miller and
               Rahul Nagarajan and
               Ravi Narayanaswami and
               Ray Ni and
               Kathy Nix and
               Thomas Norrie and
               Mark Omernick and
               Narayana Penukonda and
               Andy Phelps and
               Jonathan Ross and
               Matt Ross and
               Amir Salek and
               Emad Samadiani and
               Chris Severn and
               Gregory Sizikov and
               Matthew Snelham and
               Jed Souter and
               Dan Steinberg and
               Andy Swing and
               Mercedes Tan and
               Gregory Thorson and
               Bo Tian and
               Horia Toma and
               Erick Tuttle and
               Vijay Vasudevan and
               Richard Walter and
               Walter Wang and
               Eric Wilcox and
               Doe Hyun Yoon},
  title     = {In-Datacenter Performance Analysis of a Tensor Processing Unit},
  booktitle = {Proceedings of the 44th Annual International Symposium on Computer
               Architecture, {ISCA} 2017, Toronto, ON, Canada, June 24-28, 2017},
  pages     = {1--12},
  publisher = {{ACM}},
  year      = {2017},
  url       = {https://doi.org/10.1145/3079856.3080246},
  doi       = {10.1145/3079856.3080246},
  timestamp = {Tue, 06 Nov 2018 11:07:00 +0100},
  biburl    = {https://dblp.org/rec/conf/isca/JouppiYPPABBBBB17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/JouppiYPPABBBBB17,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson and
               Gaurav Agrawal and
               Raminder Bajwa and
               Sarah Bates and
               Suresh Bhatia and
               Nan Boden and
               Al Borchers and
               Rick Boyle and
               Pierre{-}luc Cantin and
               Clifford Chao and
               Chris Clark and
               Jeremy Coriell and
               Mike Daley and
               Matt Dau and
               Jeffrey Dean and
               Ben Gelb and
               Tara Vazir Ghaemmaghami and
               Rajendra Gottipati and
               William Gulland and
               Robert Hagmann and
               Richard C. Ho and
               Doug Hogberg and
               John Hu and
               Robert Hundt and
               Dan Hurt and
               Julian Ibarz and
               Aaron Jaffey and
               Alek Jaworski and
               Alexander Kaplan and
               Harshit Khaitan and
               Andy Koch and
               Naveen Kumar and
               Steve Lacy and
               James Laudon and
               James Law and
               Diemthu Le and
               Chris Leary and
               Zhuyuan Liu and
               Kyle Lucke and
               Alan Lundin and
               Gordon MacKean and
               Adriana Maggiore and
               Maire Mahony and
               Kieran Miller and
               Rahul Nagarajan and
               Ravi Narayanaswami and
               Ray Ni and
               Kathy Nix and
               Thomas Norrie and
               Mark Omernick and
               Narayana Penukonda and
               Andy Phelps and
               Jonathan Ross and
               Amir Salek and
               Emad Samadiani and
               Chris Severn and
               Gregory Sizikov and
               Matthew Snelham and
               Jed Souter and
               Dan Steinberg and
               Andy Swing and
               Mercedes Tan and
               Gregory Thorson and
               Bo Tian and
               Horia Toma and
               Erick Tuttle and
               Vijay Vasudevan and
               Richard Walter and
               Walter Wang and
               Eric Wilcox and
               Doe Hyun Yoon},
  title     = {In-Datacenter Performance Analysis of a Tensor Processing Unit},
  journal   = {CoRR},
  volume    = {abs/1704.04760},
  year      = {2017},
  url       = {http://arxiv.org/abs/1704.04760},
  archivePrefix = {arXiv},
  eprint    = {1704.04760},
  timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/corr/JouppiYPPABBBBB17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WuSCLNMKCGMKSJL16,
  author    = {Yonghui Wu and
               Mike Schuster and
               Zhifeng Chen and
               Quoc V. Le and
               Mohammad Norouzi and
               Wolfgang Macherey and
               Maxim Krikun and
               Yuan Cao and
               Qin Gao and
               Klaus Macherey and
               Jeff Klingner and
               Apurva Shah and
               Melvin Johnson and
               Xiaobing Liu and
               Lukasz Kaiser and
               Stephan Gouws and
               Yoshikiyo Kato and
               Taku Kudo and
               Hideto Kazawa and
               Keith Stevens and
               George Kurian and
               Nishant Patil and
               Wei Wang and
               Cliff Young and
               Jason Smith and
               Jason Riesa and
               Alex Rudnick and
               Oriol Vinyals and
               Greg Corrado and
               Macduff Hughes and
               Jeffrey Dean},
  title     = {Google's Neural Machine Translation System: Bridging the Gap between
               Human and Machine Translation},
  journal   = {CoRR},
  volume    = {abs/1609.08144},
  year      = {2016},
  url       = {http://arxiv.org/abs/1609.08144},
  archivePrefix = {arXiv},
  eprint    = {1609.08144},
  timestamp = {Thu, 14 Mar 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/corr/WuSCLNMKCGMKSJL16.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14,
  author    = {David E. Shaw and
               J. P. Grossman and
               Joseph A. Bank and
               Brannon Batson and
               J. Adam Butts and
               Jack C. Chao and
               Martin M. Deneroff and
               Ron O. Dror and
               Amos Even and
               Christopher H. Fenton and
               Anthony Forte and
               Joseph Gagliardo and
               Gennette Gill and
               Brian Greskamp and
               Richard C. Ho and
               Douglas J. Ierardi and
               Lev Iserovich and
               Jeffrey Kuskin and
               Richard H. Larson and
               Timothy Layman and
               Li{-}Siang Lee and
               Adam K. Lerer and
               Chester Li and
               Daniel Killebrew and
               Kenneth M. Mackenzie and
               Shark Yeuk{-}Hai Mok and
               Mark A. Moraes and
               Rolf Mueller and
               Lawrence J. Nociolo and
               Jon L. Peticolas and
               Terry Quan and
               Daniel Ramot and
               John K. Salmon and
               Daniele Paolo Scarpazza and
               U. Ben Schafer and
               Naseer Siddique and
               Christopher W. Snyder and
               Jochen Spengler and
               Ping Tak Peter Tang and
               Michael Theobald and
               Horia Toma and
               Brian Towles and
               Benjamin Vitale and
               Stanley C. Wang and
               Cliff Young},
  editor    = {Trish Damkroger and
               Jack J. Dongarra},
  title     = {Anton 2: Raising the Bar for Performance and Programmability in a
               Special-Purpose Molecular Dynamics Supercomputer},
  booktitle = {International Conference for High Performance Computing, Networking,
               Storage and Analysis, {SC} 2014, New Orleans, LA, USA, November 16-21,
               2014},
  pages     = {41--53},
  publisher = {{IEEE} Computer Society},
  year      = {2014},
  url       = {https://doi.org/10.1109/SC.2014.9},
  doi       = {10.1109/SC.2014.9},
  timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
  biburl    = {https://dblp.org/rec/conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/GrossmanKBTDILSTYS13,
  author    = {J. P. Grossman and
               Jeffrey Kuskin and
               Joseph A. Bank and
               Michael Theobald and
               Ron O. Dror and
               Douglas J. Ierardi and
               Richard H. Larson and
               U. Ben Schafer and
               Brian Towles and
               Cliff Young and
               David E. Shaw},
  editor    = {Vivek Sarkar and
               Rastislav Bod{\'{\i}}k},
  title     = {Hardware support for fine-grained event-driven computation in Anton
               2},
  booktitle = {Architectural Support for Programming Languages and Operating Systems,
               {ASPLOS} '13, Houston, TX, {USA} - March 16 - 20, 2013},
  pages     = {549--560},
  publisher = {{ACM}},
  year      = {2013},
  url       = {https://doi.org/10.1145/2451116.2451175},
  doi       = {10.1145/2451116.2451175},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/asplos/GrossmanKBTDILSTYS13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/micro/DrorGMTCSYBBSKLMS11,
  author    = {Ron O. Dror and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Brian Towles and
               Edmond Chow and
               John K. Salmon and
               Cliff Young and
               Joseph A. Bank and
               Brannon Batson and
               Martin M. Deneroff and
               Jeffrey Kuskin and
               Richard H. Larson and
               Mark A. Moraes and
               David E. Shaw},
  title     = {Overcoming Communication Latency Barriers in Massively Parallel Scientific
               Computation},
  journal   = {{IEEE} Micro},
  volume    = {31},
  number    = {3},
  pages     = {8--19},
  year      = {2011},
  url       = {https://doi.org/10.1109/MM.2011.38},
  doi       = {10.1109/MM.2011.38},
  timestamp = {Sat, 20 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/micro/DrorGMTCSYBBSKLMS11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/parallel/DrorYS11,
  author    = {Ron O. Dror and
               Cliff Young and
               David E. Shaw},
  editor    = {David A. Padua},
  title     = {Anton, {A} Special-Purpose Molecular Simulation Machine},
  booktitle = {Encyclopedia of Parallel Computing},
  pages     = {60--71},
  publisher = {Springer},
  year      = {2011},
  url       = {https://doi.org/10.1007/978-0-387-09766-4\_199},
  doi       = {10.1007/978-0-387-09766-4\_199},
  timestamp = {Wed, 12 Jul 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/reference/parallel/DrorYS11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/parallel/FisherFY11,
  author    = {Joseph A. Fisher and
               Paolo Faraboschi and
               Cliff Young},
  editor    = {David A. Padua},
  title     = {{VLIW} Processors},
  booktitle = {Encyclopedia of Parallel Computing},
  pages     = {2135--2142},
  publisher = {Springer},
  year      = {2011},
  url       = {https://doi.org/10.1007/978-0-387-09766-4\_471},
  doi       = {10.1007/978-0-387-09766-4\_471},
  timestamp = {Wed, 12 Jul 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/reference/parallel/FisherFY11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/DrorGMTCSYBBDKLMS10,
  author    = {Ron O. Dror and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Brian Towles and
               Edmond Chow and
               John K. Salmon and
               Cliff Young and
               Joseph A. Bank and
               Brannon Batson and
               Martin M. Deneroff and
               Jeffrey Kuskin and
               Richard H. Larson and
               Mark A. Moraes and
               David E. Shaw},
  title     = {Exploiting 162-Nanosecond End-to-End Communication Latency on Anton},
  booktitle = {Conference on High Performance Computing Networking, Storage and Analysis,
               {SC} 2010, New Orleans, LA, USA, November 13-19, 2010},
  pages     = {1--12},
  publisher = {{IEEE}},
  year      = {2010},
  url       = {https://doi.org/10.1109/SC.2010.23},
  doi       = {10.1109/SC.2010.23},
  timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
  biburl    = {https://dblp.org/rec/conf/sc/DrorGMTCSYBBDKLMS10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09,
  author    = {David E. Shaw and
               Ron O. Dror and
               John K. Salmon and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Joseph A. Bank and
               Cliff Young and
               Martin M. Deneroff and
               Brannon Batson and
               Kevin J. Bowers and
               Edmond Chow and
               Michael P. Eastwood and
               Doug Ierardi and
               John L. Klepeis and
               Jeffrey Kuskin and
               Richard H. Larson and
               Kresten Lindorff{-}Larsen and
               Paul Maragakis and
               Mark A. Moraes and
               Stefano Piana and
               Yibing Shan and
               Brian Towles},
  title     = {Millisecond-scale molecular dynamics simulations on Anton},
  booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
               {SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
  publisher = {{ACM}},
  year      = {2009},
  url       = {https://doi.org/10.1145/1654059.1654099},
  doi       = {10.1145/1654059.1654099},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09a,
  author    = {David E. Shaw and
               Ron O. Dror and
               John K. Salmon and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Joseph A. Bank and
               Cliff Young and
               Martin M. Deneroff and
               Brannon Batson and
               Kevin J. Bowers and
               Edmond Chow and
               Michael P. Eastwood and
               Doug Ierardi and
               John L. Klepeis and
               Jeffrey Kuskin and
               Richard H. Larson and
               Kresten Lindorff{-}Larsen and
               Paul Maragakis and
               Mark A. Moraes and
               Stefano Piana and
               Yibing Shan and
               Brian Towles},
  title     = {Millisecond-scale molecular dynamics simulations on Anton},
  booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
               {SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
  publisher = {{ACM}},
  year      = {2009},
  url       = {https://doi.org/10.1145/1654059.1654126},
  doi       = {10.1145/1654059.1654126},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sc/YoungBDGSS09,
  author    = {Cliff Young and
               Joseph A. Bank and
               Ron O. Dror and
               J. P. Grossman and
               John K. Salmon and
               David E. Shaw},
  title     = {A 32x32x32, spatially distributed 3D {FFT} in four microseconds on
               Anton},
  booktitle = {Proceedings of the {ACM/IEEE} Conference on High Performance Computing,
               {SC} 2009, November 14-20, 2009, Portland, Oregon, {USA}},
  publisher = {{ACM}},
  year      = {2009},
  url       = {https://doi.org/10.1145/1654059.1654083},
  doi       = {10.1145/1654059.1654083},
  timestamp = {Tue, 06 Nov 2018 16:59:29 +0100},
  biburl    = {https://dblp.org/rec/conf/sc/YoungBDGSS09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08,
  author    = {David E. Shaw and
               Martin M. Deneroff and
               Ron O. Dror and
               Jeffrey Kuskin and
               Richard H. Larson and
               John K. Salmon and
               Cliff Young and
               Brannon Batson and
               Kevin J. Bowers and
               Jack C. Chao and
               Michael P. Eastwood and
               Joseph Gagliardo and
               J. P. Grossman and
               Richard C. Ho and
               Doug Ierardi and
               Istv{\'{a}}n Kolossv{\'{a}}ry and
               John L. Klepeis and
               Timothy Layman and
               Christine McLeavey and
               Mark A. Moraes and
               Rolf Mueller and
               Edward C. Priest and
               Yibing Shan and
               Jochen Spengler and
               Michael Theobald and
               Brian Towles and
               Stanley C. Wang},
  title     = {Anton, a special-purpose machine for molecular dynamics simulation},
  journal   = {Commun. {ACM}},
  volume    = {51},
  number    = {7},
  pages     = {91--97},
  year      = {2008},
  url       = {https://doi.org/10.1145/1364782.1364802},
  doi       = {10.1145/1364782.1364802},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/codes/GrossmanYBMISDS08,
  author    = {J. P. Grossman and
               Cliff Young and
               Joseph A. Bank and
               Kenneth M. Mackenzie and
               Doug Ierardi and
               John K. Salmon and
               Ron O. Dror and
               David E. Shaw},
  editor    = {Catherine H. Gebotys and
               Grant Martin},
  title     = {Simulation and embedded software development for Anton, a parallel
               machine with heterogeneous multicore ASICs},
  booktitle = {Proceedings of the 6th International Conference on Hardware/Software
               Codesign and System Synthesis, {CODES+ISSS} 2008, Atlanta, GA, USA,
               October 19-24, 2008},
  pages     = {125--130},
  publisher = {{ACM}},
  year      = {2008},
  url       = {https://doi.org/10.1145/1450135.1450165},
  doi       = {10.1145/1450135.1450165},
  timestamp = {Mon, 26 Nov 2018 12:14:45 +0100},
  biburl    = {https://dblp.org/rec/conf/codes/GrossmanYBMISDS08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/LarsonSDDYGSKS08,
  author    = {Richard H. Larson and
               John K. Salmon and
               Ron O. Dror and
               Martin M. Deneroff and
               Cliff Young and
               J. P. Grossman and
               Yibing Shan and
               John L. Klepeis and
               David E. Shaw},
  title     = {High-throughput pairwise point interactions in Anton, a specialized
               machine for molecular dynamics simulation},
  booktitle = {14th International Conference on High-Performance Computer Architecture
               {(HPCA-14} 2008), 16-20 February 2008, Salt Lake City, UT, {USA}},
  pages     = {331--342},
  publisher = {{IEEE} Computer Society},
  year      = {2008},
  url       = {https://doi.org/10.1109/HPCA.2008.4658650},
  doi       = {10.1109/HPCA.2008.4658650},
  timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl    = {https://dblp.org/rec/conf/hpca/LarsonSDDYGSKS08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/KuskinYGBDDS08,
  author    = {Jeffrey Kuskin and
               Cliff Young and
               J. P. Grossman and
               Brannon Batson and
               Martin M. Deneroff and
               Ron O. Dror and
               David E. Shaw},
  title     = {Incorporating flexibility in Anton, a specialized machine for molecular
               dynamics simulation},
  booktitle = {14th International Conference on High-Performance Computer Architecture
               {(HPCA-14} 2008), 16-20 February 2008, Salt Lake City, UT, {USA}},
  pages     = {343--354},
  publisher = {{IEEE} Computer Society},
  year      = {2008},
  url       = {https://doi.org/10.1109/HPCA.2008.4658651},
  doi       = {10.1109/HPCA.2008.4658651},
  timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl    = {https://dblp.org/rec/conf/hpca/KuskinYGBDDS08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccd/GrossmanSHITBSWMTYGDDS08,
  author    = {J. P. Grossman and
               John K. Salmon and
               Richard C. Ho and
               Doug Ierardi and
               Brian Towles and
               Brannon Batson and
               Jochen Spengler and
               Stanley C. Wang and
               Rolf Mueller and
               Michael Theobald and
               Cliff Young and
               Joseph Gagliardo and
               Martin M. Deneroff and
               Ron O. Dror and
               David E. Shaw},
  title     = {Hierarchical simulation-based verification of Anton, a special-purpose
               parallel machine},
  booktitle = {26th International Conference on Computer Design, {ICCD} 2008, 12-15
               October 2008, Lake Tahoe, CA, USA, Proceedings},
  pages     = {340--347},
  publisher = {{IEEE} Computer Society},
  year      = {2008},
  url       = {https://doi.org/10.1109/ICCD.2008.4751883},
  doi       = {10.1109/ICCD.2008.4751883},
  timestamp = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl    = {https://dblp.org/rec/conf/iccd/GrossmanSHITBSWMTYGDDS08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07,
  author    = {David E. Shaw and
               Martin M. Deneroff and
               Ron O. Dror and
               Jeffrey Kuskin and
               Richard H. Larson and
               John K. Salmon and
               Cliff Young and
               Brannon Batson and
               Kevin J. Bowers and
               Jack C. Chao and
               Michael P. Eastwood and
               Joseph Gagliardo and
               J. P. Grossman and
               Richard C. Ho and
               Doug Ierardi and
               Istv{\'{a}}n Kolossv{\'{a}}ry and
               John L. Klepeis and
               Timothy Layman and
               Christine McLeavey and
               Mark A. Moraes and
               Rolf Mueller and
               Edward C. Priest and
               Yibing Shan and
               Jochen Spengler and
               Michael Theobald and
               Brian Towles and
               Stanley C. Wang},
  editor    = {Dean M. Tullsen and
               Brad Calder},
  title     = {Anton, a special-purpose machine for molecular dynamics simulation},
  booktitle = {34th International Symposium on Computer Architecture {(ISCA} 2007),
               June 9-13, 2007, San Diego, California, {USA}},
  pages     = {1--12},
  publisher = {{ACM}},
  year      = {2007},
  url       = {https://doi.org/10.1145/1250662.1250664},
  doi       = {10.1145/1250662.1250664},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/Young06,
  author    = {Cliff Young},
  editor    = {Atul Adya and
               Erich M. Nahum},
  title     = {Architectures and Algorithms for Biomolecular Simulation},
  booktitle = {Proceedings of the 2006 {USENIX} Annual Technical Conference, Boston,
               MA, USA, May 30 - June 3, 2006},
  publisher = {{USENIX}},
  year      = {2006},
  url       = {http://www.usenix.org/events/usenix06/tech/mp3/young.mp3},
  timestamp = {Wed, 04 Jul 2018 13:06:34 +0200},
  biburl    = {https://dblp.org/rec/conf/usenix/Young06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/daglib/0013596,
  author    = {Joseph A. Fisher and
               Paolo Faraboschi and
               Cliff Young},
  title     = {Embedded computing - a {VLIW} approach to architecture, compilers,
               and tools},
  publisher = {Morgan Kaufmann},
  year      = {2005},
  isbn      = {978-1-55860-766-8},
  timestamp = {Fri, 01 Apr 2011 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/books/daglib/0013596.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hotos/YoungLSRPPNMG01,
  author    = {Cliff Young and
               Yagati N. Lakshman and
               Tom Szymanski and
               John H. Reppy and
               David L. Presotto and
               Rob Pike and
               Girija J. Narlikar and
               Sape J. Mullender and
               Eric Grosse},
  title     = {Protium, an Infrastructure for Partitioned Applications},
  booktitle = {Proceedings of HotOS-VIII: 8th Workshop on Hot Topics in Operating
               Systems, May 20-23, 2001, Elmau/Oberbayern, Germany},
  pages     = {47--52},
  publisher = {{IEEE} Computer Society},
  year      = {2001},
  url       = {https://doi.org/10.1109/HOTOS.2001.990060},
  doi       = {10.1109/HOTOS.2001.990060},
  timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl    = {https://dblp.org/rec/conf/hotos/YoungLSRPPNMG01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jilp/SavariY00,
  author    = {Serap A. Savari and
               Cliff Young},
  title     = {Comparing and Combining Profiles},
  journal   = {J. Instruction-Level Parallelism},
  volume    = {2},
  year      = {2000},
  url       = {http://www.jilp.org/vol2/v2paper4.pdf},
  timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jilp/SavariY00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hpca/KaxirasY00,
  author    = {Stefanos Kaxiras and
               Cliff Young},
  title     = {Coherence Communication Prediction in Shared-Memory Multiprocessors},
  booktitle = {Proceedings of the Sixth International Symposium on High-Performance
               Computer Architecture, Toulouse, France, January 8-12, 2000},
  pages     = {156--167},
  publisher = {{IEEE} Computer Society},
  year      = {2000},
  url       = {https://doi.org/10.1109/HPCA.2000.824347},
  doi       = {10.1109/HPCA.2000.824347},
  timestamp = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl    = {https://dblp.org/rec/conf/hpca/KaxirasY00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/toplas/YoungS99,
  author    = {Cliff Young and
               Michael D. Smith},
  title     = {Static correlated branch prediction},
  journal   = {{ACM} Trans. Program. Lang. Syst.},
  volume    = {21},
  number    = {5},
  pages     = {1028--1075},
  year      = {1999},
  url       = {https://doi.org/10.1145/330249.330255},
  doi       = {10.1145/330249.330255},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/toplas/YoungS99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/YoungS98,
  author    = {Cliff Young and
               Michael D. Smith},
  editor    = {James O. Bondi and
               Jim Smith},
  title     = {Better Global Scheduling Using Path Profiles},
  booktitle = {Proceedings of the 31st Annual {IEEE/ACM} International Symposium
               on Microarchitecture, {MICRO} 31, Dallas, Texas, USA, November 30
               - December 2, 1998},
  pages     = {115--123},
  publisher = {{ACM/IEEE} Computer Society},
  year      = {1998},
  url       = {https://doi.org/10.1109/MICRO.1998.742774},
  doi       = {10.1109/MICRO.1998.742774},
  timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
  biburl    = {https://dblp.org/rec/conf/micro/YoungS98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pldi/YoungJKS97,
  author    = {Cliff Young and
               David S. Johnson and
               David R. Karger and
               Michael D. Smith},
  editor    = {Marina C. Chen and
               Ron K. Cytron and
               A. Michael Berman},
  title     = {Near-optimal Intraprocedural Branch Alignment},
  booktitle = {Proceedings of the {ACM} {SIGPLAN} '97 Conference on Programming Language
               Design and Implementation (PLDI), Las Vegas, Nevada, USA, June 15-18,
               1997},
  pages     = {183--193},
  publisher = {{ACM}},
  year      = {1997},
  url       = {https://doi.org/10.1145/258915.258932},
  doi       = {10.1145/258915.258932},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/pldi/YoungJKS97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/Gloy96,
  author    = {Nicholas C. Gloy and
               Cliff Young and
               J. Bradley Chen and
               Michael D. Smith},
  editor    = {Jean{-}Loup Baer},
  title     = {An Analysis of Dynamic Branch Prediction Schemes on System Workloads},
  booktitle = {Proceedings of the 23rd Annual International Symposium on Computer
               Architecture, Philadelphia, PA, USA, May 22-24, 1996},
  pages     = {12--21},
  publisher = {{ACM}},
  year      = {1996},
  url       = {https://doi.org/10.1145/232973.232977},
  doi       = {10.1145/232973.232977},
  timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
  biburl    = {https://dblp.org/rec/conf/isca/Gloy96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isca/YoungGS95,
  author    = {Cliff Young and
               Nicholas C. Gloy and
               Michael D. Smith},
  editor    = {David A. Patterson},
  title     = {A Comparative Analysis of Schemes for Correlated Branch Prediction},
  booktitle = {Proceedings of the 22nd Annual International Symposium on Computer
               Architecture, {ISCA} '95, Santa Margherita Ligure, Italy, June 22-24,
               1995},
  pages     = {276--286},
  publisher = {{ACM}},
  year      = {1995},
  url       = {https://doi.org/10.1145/223982.224438},
  doi       = {10.1145/223982.224438},
  timestamp = {Wed, 16 Oct 2019 14:14:49 +0200},
  biburl    = {https://dblp.org/rec/conf/isca/YoungGS95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micro/GloySY95,
  author    = {Nicholas C. Gloy and
               Michael D. Smith and
               Cliff Young},
  editor    = {Trevor N. Mudge and
               Kemal Ebcioglu},
  title     = {Performance issues in correlated branch prediction schemes},
  booktitle = {Proceedings of the 28th Annual International Symposium on Microarchitecture,
               Ann Arbor, Michigan, USA, November 29 - December 1, 1995},
  pages     = {3--14},
  publisher = {{ACM} / {IEEE} Computer Society},
  year      = {1995},
  url       = {https://doi.org/10.1109/MICRO.1995.476808},
  doi       = {10.1109/MICRO.1995.476808},
  timestamp = {Wed, 16 Oct 2019 14:14:55 +0200},
  biburl    = {https://dblp.org/rec/conf/micro/GloySY95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/YoungS94,
  author    = {Cliff Young and
               Michael D. Smith},
  editor    = {Forest Baskett and
               Douglas W. Clark},
  title     = {Improving the Accuracy of Static Branch Prediction Using Branch Correlation},
  booktitle = {{ASPLOS-VI} Proceedings - Sixth International Conference on Architectural
               Support for Programming Languages and Operating Systems, San Jose,
               California, USA, October 4-7, 1994},
  pages     = {232--241},
  publisher = {{ACM} Press},
  year      = {1994},
  url       = {https://doi.org/10.1145/195473.195549},
  doi       = {10.1145/195473.195549},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/asplos/YoungS94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/usenix/BlackwellCCCGKKLLMPTYZ94,
  author    = {Trevor Blackwell and
               Kee Chan and
               Koling Chang and
               Thomas Charuhas and
               James Gwertzman and
               Brad Karp and
               H. T. Kung and
               David Li and
               Dong Lin and
               Robert Tappan Morris and
               Rob Polansky and
               Diane Tang and
               Cliff Young and
               John Zao},
  title     = {Secure Short-Cut Routing for Mobile {IP}},
  booktitle = {{USENIX} Summer 1994 Technical Conference, Boston, Massachusetts,
               USA, June 6-10, 1994, Conference Proceeding},
  pages     = {305--316},
  publisher = {{USENIX} Association},
  year      = {1994},
  url       = {https://www.usenix.org/conference/usenix-summer-1994-technical-conference/secure-short-cut-routing-mobile-ip},
  timestamp = {Wed, 04 Jul 2018 13:06:34 +0200},
  biburl    = {https://dblp.org/rec/conf/usenix/BlackwellCCCGKKLLMPTYZ94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of Schloss Dagstuhl - Leibniz Center for Informatics