Search dblp for Publications

export results for "R. Manmatha"

 download as .bib file

@article{DBLP:journals/pami/ZhuZWZHZMLS24,
  author       = {Yi Zhu and
                  Zhongyue Zhang and
                  Chongruo Wu and
                  Zhi Zhang and
                  Tong He and
                  Hang Zhang and
                  R. Manmatha and
                  Mu Li and
                  Alexander J. Smola},
  title        = {Improving Semantic Segmentation via Efficient Self-Training},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {46},
  number       = {3},
  pages        = {1589--1602},
  year         = {2024},
  url          = {https://doi.org/10.1109/TPAMI.2021.3138337},
  doi          = {10.1109/TPAMI.2021.3138337},
  timestamp    = {Thu, 29 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/ZhuZWZHZMLS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/AppalarajuTDSZM24,
  author       = {Srikar Appalaraju and
                  Peng Tang and
                  Qi Dong and
                  Nishant Sankaran and
                  Yichu Zhou and
                  R. Manmatha},
  editor       = {Michael J. Wooldridge and
                  Jennifer G. Dy and
                  Sriraam Natarajan},
  title        = {DocFormerv2: Local Features for Document Understanding},
  booktitle    = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
                  2024, Thirty-Sixth Conference on Innovative Applications of Artificial
                  Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
                  in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
                  Canada},
  pages        = {709--718},
  publisher    = {{AAAI} Press},
  year         = {2024},
  url          = {https://doi.org/10.1609/aaai.v38i2.27828},
  doi          = {10.1609/AAAI.V38I2.27828},
  timestamp    = {Tue, 02 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aaai/AppalarajuTDSZM24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ZhaoSATMMW24,
  author       = {Tianyang Zhao and
                  Kunwar Yashraj Singh and
                  Srikar Appalaraju and
                  Peng Tang and
                  Vijay Mahadevan and
                  R. Manmatha and
                  Ying Nian Wu},
  editor       = {Michael J. Wooldridge and
                  Jennifer G. Dy and
                  Sriraam Natarajan},
  title        = {No Head Left Behind - Multi-Head Alignment Distillation for Transformers},
  booktitle    = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI}
                  2024, Thirty-Sixth Conference on Innovative Applications of Artificial
                  Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances
                  in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver,
                  Canada},
  pages        = {7514--7524},
  publisher    = {{AAAI} Press},
  year         = {2024},
  url          = {https://doi.org/10.1609/aaai.v38i7.28583},
  doi          = {10.1609/AAAI.V38I7.28583},
  timestamp    = {Tue, 02 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/aaai/ZhaoSATMMW24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiZWMXMSTES24,
  author       = {Hao Li and
                  Yang Zou and
                  Ying Wang and
                  Orchid Majumder and
                  Yusheng Xie and
                  R. Manmatha and
                  Ashwin Swaminathan and
                  Zhuowen Tu and
                  Stefano Ermon and
                  Stefano Soatto},
  title        = {On the Scalability of Diffusion-based Text-to-Image Generation},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2024, Seattle, WA, USA, June 16-22, 2024},
  pages        = {9400--9409},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/CVPR52733.2024.00898},
  doi          = {10.1109/CVPR52733.2024.00898},
  timestamp    = {Wed, 02 Oct 2024 09:45:16 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/LiZWMXMSTES24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/MondalMMJ24,
  author       = {Ajoy Mondal and
                  Vijay Mahadevan and
                  R. Manmatha and
                  C. V. Jawahar},
  editor       = {Elisa H. Barney Smith and
                  Marcus Liwicki and
                  Liangrui Peng},
  title        = {{ICDAR} 2024 Competition on Recognition and {VQA} on Handwritten Documents},
  booktitle    = {Document Analysis and Recognition - {ICDAR} 2024 - 18th International
                  Conference, Athens, Greece, August 30 - September 4, 2024, Proceedings,
                  Part {VI}},
  series       = {Lecture Notes in Computer Science},
  volume       = {14809},
  pages        = {426--442},
  publisher    = {Springer},
  year         = {2024},
  url          = {https://doi.org/10.1007/978-3-031-70552-6\_26},
  doi          = {10.1007/978-3-031-70552-6\_26},
  timestamp    = {Tue, 17 Sep 2024 09:34:32 +0200},
  biburl       = {https://dblp.org/rec/conf/icdar/MondalMMJ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/TangAMXM24,
  author       = {Peng Tang and
                  Srikar Appalaraju and
                  R. Manmatha and
                  Yusheng Xie and
                  Vijay Mahadevan},
  editor       = {Yi Yang and
                  Aida Davani and
                  Avi Sil and
                  Anoop Kumar},
  title        = {Multiple-Question Multiple-Answer Text-VQA},
  booktitle    = {Proceedings of the 2024 Conference of the North American Chapter of
                  the Association for Computational Linguistics: Human Language Technologies:
                  Industry Track, {NAACL} 2024, Mexico City, Mexico, June 16-21, 2024},
  pages        = {73--88},
  publisher    = {Association for Computational Linguistics},
  year         = {2024},
  url          = {https://doi.org/10.18653/v1/2024.naacl-industry.7},
  doi          = {10.18653/V1/2024.NAACL-INDUSTRY.7},
  timestamp    = {Thu, 12 Sep 2024 13:29:32 +0200},
  biburl       = {https://dblp.org/rec/conf/naacl/TangAMXM24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/TangZLAMM24,
  author       = {Peng Tang and
                  Pengkai Zhu and
                  Tian Li and
                  Srikar Appalaraju and
                  Vijay Mahadevan and
                  R. Manmatha},
  editor       = {Kevin Duh and
                  Helena G{\'{o}}mez{-}Adorno and
                  Steven Bethard},
  title        = {{DEED:} Dynamic Early Exit on Decoder for Accelerating Encoder-Decoder
                  Transformer Models},
  booktitle    = {Findings of the Association for Computational Linguistics: {NAACL}
                  2024, Mexico City, Mexico, June 16-21, 2024},
  pages        = {116--131},
  publisher    = {Association for Computational Linguistics},
  year         = {2024},
  url          = {https://doi.org/10.18653/v1/2024.findings-naacl.9},
  doi          = {10.18653/V1/2024.FINDINGS-NAACL.9},
  timestamp    = {Thu, 12 Sep 2024 13:29:32 +0200},
  biburl       = {https://dblp.org/rec/conf/naacl/TangZLAMM24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-02883,
  author       = {Hao Li and
                  Yang Zou and
                  Ying Wang and
                  Orchid Majumder and
                  Yusheng Xie and
                  R. Manmatha and
                  Ashwin Swaminathan and
                  Zhuowen Tu and
                  Stefano Ermon and
                  Stefano Soatto},
  title        = {On the Scalability of Diffusion-based Text-to-Image Generation},
  journal      = {CoRR},
  volume       = {abs/2404.02883},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2404.02883},
  doi          = {10.48550/ARXIV.2404.02883},
  eprinttype    = {arXiv},
  eprint       = {2404.02883},
  timestamp    = {Mon, 13 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2404-02883.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2404-04469,
  author       = {Pei Wang and
                  Zhaowei Cai and
                  Hao Yang and
                  Ashwin Swaminathan and
                  R. Manmatha and
                  Stefano Soatto},
  title        = {Mixed-Query Transformer: {A} Unified Image Segmentation Architecture},
  journal      = {CoRR},
  volume       = {abs/2404.04469},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2404.04469},
  doi          = {10.48550/ARXIV.2404.04469},
  eprinttype    = {arXiv},
  eprint       = {2404.04469},
  timestamp    = {Wed, 15 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2404-04469.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2407-12594,
  author       = {Ofir Abramovich and
                  Niv Nayman and
                  Sharon Fogel and
                  Inbal Lavi and
                  Ron Litman and
                  Shahar Tsiper and
                  Royee Tichauer and
                  Srikar Appalaraju and
                  Shai Mazor and
                  R. Manmatha},
  title        = {VisFocus: Prompt-Guided Vision Encoders for OCR-Free Dense Document
                  Understanding},
  journal      = {CoRR},
  volume       = {abs/2407.12594},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2407.12594},
  doi          = {10.48550/ARXIV.2407.12594},
  eprinttype    = {arXiv},
  eprint       = {2407.12594},
  timestamp    = {Fri, 23 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2407-12594.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2408-09511,
  author       = {Chaofan Tao and
                  Gukyeong Kwon and
                  Varad Gunjal and
                  Hao Yang and
                  Zhaowei Cai and
                  Yonatan Dukler and
                  Ashwin Swaminathan and
                  R. Manmatha and
                  Colin J. Taylor and
                  Stefano Soatto},
  title        = {{NAVERO:} Unlocking Fine-Grained Semantics for Video-Language Compositionality},
  journal      = {CoRR},
  volume       = {abs/2408.09511},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2408.09511},
  doi          = {10.48550/ARXIV.2408.09511},
  eprinttype    = {arXiv},
  eprint       = {2408.09511},
  timestamp    = {Tue, 24 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2408-09511.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiuDCZSMM23,
  author       = {Jiang Liu and
                  Hui Ding and
                  Zhaowei Cai and
                  Yuting Zhang and
                  Ravi Kumar Satzoda and
                  Vijay Mahadevan and
                  R. Manmatha},
  title        = {PolyFormer: Referring Image Segmentation as Sequential Polygon Generation},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023},
  pages        = {18653--18663},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CVPR52729.2023.01789},
  doi          = {10.1109/CVPR52729.2023.01789},
  timestamp    = {Tue, 29 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/LiuDCZSMM23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/LiaoRLBZTSMM23,
  author       = {Haofu Liao and
                  Aruni RoyChowdhury and
                  Weijian Li and
                  Ankan Bansal and
                  Yuting Zhang and
                  Zhuowen Tu and
                  Ravi Kumar Satzoda and
                  R. Manmatha and
                  Vijay Mahadevan},
  title        = {DocTr: Document Transformer for Structured Information Extraction
                  in Documents},
  booktitle    = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023,
                  Paris, France, October 1-6, 2023},
  pages        = {19527--19537},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/ICCV51070.2023.01794},
  doi          = {10.1109/ICCV51070.2023.01794},
  timestamp    = {Tue, 23 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/LiaoRLBZTSMM23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-03432,
  author       = {Yash Patel and
                  Yusheng Xie and
                  Yi Zhu and
                  Srikar Appalaraju and
                  R. Manmatha},
  title        = {SimCon Loss with Multiple Views for Text Supervised Semantic Segmentation},
  journal      = {CoRR},
  volume       = {abs/2302.03432},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2302.03432},
  doi          = {10.48550/ARXIV.2302.03432},
  eprinttype    = {arXiv},
  eprint       = {2302.03432},
  timestamp    = {Thu, 15 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2302-03432.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2302-07387,
  author       = {Jiang Liu and
                  Hui Ding and
                  Zhaowei Cai and
                  Yuting Zhang and
                  Ravi Kumar Satzoda and
                  Vijay Mahadevan and
                  R. Manmatha},
  title        = {PolyFormer: Referring Image Segmentation as Sequential Polygon Generation},
  journal      = {CoRR},
  volume       = {abs/2302.07387},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2302.07387},
  doi          = {10.48550/ARXIV.2302.07387},
  eprinttype    = {arXiv},
  eprint       = {2302.07387},
  timestamp    = {Mon, 20 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2302-07387.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-01733,
  author       = {Srikar Appalaraju and
                  Peng Tang and
                  Qi Dong and
                  Nishant Sankaran and
                  Yichu Zhou and
                  R. Manmatha},
  title        = {DocFormerv2: Local Features for Document Understanding},
  journal      = {CoRR},
  volume       = {abs/2306.01733},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2306.01733},
  doi          = {10.48550/ARXIV.2306.01733},
  eprinttype    = {arXiv},
  eprint       = {2306.01733},
  timestamp    = {Mon, 12 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2306-01733.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-07929,
  author       = {Haofu Liao and
                  Aruni RoyChowdhury and
                  Weijian Li and
                  Ankan Bansal and
                  Yuting Zhang and
                  Zhuowen Tu and
                  Ravi Kumar Satzoda and
                  R. Manmatha and
                  Vijay Mahadevan},
  title        = {DocTr: Document Transformer for Structured Information Extraction
                  in Documents},
  journal      = {CoRR},
  volume       = {abs/2307.07929},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2307.07929},
  doi          = {10.48550/ARXIV.2307.07929},
  eprinttype    = {arXiv},
  eprint       = {2307.07929},
  timestamp    = {Tue, 25 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2307-07929.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2308-02662,
  author       = {Arijit Ghosh and
                  Chandrima Kayal and
                  Manaswi Paraashar and
                  Manmatha Roy},
  title        = {Linear isomorphism testing of Boolean functions with small approximate
                  spectral norm},
  journal      = {CoRR},
  volume       = {abs/2308.02662},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2308.02662},
  doi          = {10.48550/ARXIV.2308.02662},
  eprinttype    = {arXiv},
  eprint       = {2308.02662},
  timestamp    = {Mon, 21 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2308-02662.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-08622,
  author       = {Peng Tang and
                  Srikar Appalaraju and
                  R. Manmatha and
                  Yusheng Xie and
                  Vijay Mahadevan},
  title        = {Multiple-Question Multiple-Answer Text-VQA},
  journal      = {CoRR},
  volume       = {abs/2311.08622},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2311.08622},
  doi          = {10.48550/ARXIV.2311.08622},
  eprinttype    = {arXiv},
  eprint       = {2311.08622},
  timestamp    = {Tue, 21 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2311-08622.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2311-08623,
  author       = {Peng Tang and
                  Pengkai Zhu and
                  Tian Li and
                  Srikar Appalaraju and
                  Vijay Mahadevan and
                  R. Manmatha},
  title        = {{DEED:} Dynamic Early Exit on Decoder for Accelerating Encoder-Decoder
                  Transformer Models},
  journal      = {CoRR},
  volume       = {abs/2311.08623},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2311.08623},
  doi          = {10.48550/ARXIV.2311.08623},
  eprinttype    = {arXiv},
  eprint       = {2311.08623},
  timestamp    = {Tue, 21 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2311-08623.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iacr/ChattopadhyayMMRT23,
  author       = {Anupam Chattopadhyay and
                  Subhamoy Maitra and
                  Bimal Mandal and
                  Manmatha Roy and
                  Deng Tang},
  title        = {Efficient Hardware Implementation for Maiorana-McFarland type Functions},
  journal      = {{IACR} Cryptol. ePrint Arch.},
  pages        = {1970},
  year         = {2023},
  url          = {https://eprint.iacr.org/2023/1970},
  timestamp    = {Wed, 10 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/iacr/ChattopadhyayMMRT23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/0005WZZLZSHMMLS22,
  author       = {Hang Zhang and
                  Chongruo Wu and
                  Zhongyue Zhang and
                  Yi Zhu and
                  Haibin Lin and
                  Zhi Zhang and
                  Yue Sun and
                  Tong He and
                  Jonas Mueller and
                  R. Manmatha and
                  Mu Li and
                  Alexander J. Smola},
  title        = {ResNeSt: Split-Attention Networks},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition Workshops,
                  {CVPR} Workshops 2022, New Orleans, LA, USA, June 19-20, 2022},
  pages        = {2735--2745},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CVPRW56347.2022.00309},
  doi          = {10.1109/CVPRW56347.2022.00309},
  timestamp    = {Wed, 10 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/0005WZZLZSHMMLS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/BitenLXAM22,
  author       = {Ali Furkan Biten and
                  Ron Litman and
                  Yusheng Xie and
                  Srikar Appalaraju and
                  R. Manmatha},
  title        = {LaTr: Layout-Aware Transformer for Scene-Text {VQA}},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
  pages        = {16527--16537},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CVPR52688.2022.01605},
  doi          = {10.1109/CVPR52688.2022.01605},
  timestamp    = {Wed, 05 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/BitenLXAM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/KittenplonLFBMP22,
  author       = {Yair Kittenplon and
                  Inbal Lavi and
                  Sharon Fogel and
                  Yarin Bar and
                  R. Manmatha and
                  Pietro Perona},
  title        = {Towards Weakly-Supervised Text Spotting using a Multi-Task Transformer},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
  pages        = {4594--4603},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CVPR52688.2022.00456},
  doi          = {10.1109/CVPR52688.2022.00456},
  timestamp    = {Tue, 04 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/KittenplonLFBMP22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/HoAJMV22,
  author       = {Chih{-}Hui Ho and
                  Srikar Appalaraju and
                  Bhavan Jasani and
                  R. Manmatha and
                  Nuno Vasconcelos},
  editor       = {Leonid Karlinsky and
                  Tomer Michaeli and
                  Ko Nishino},
  title        = {{YORO} - Lightweight End to End Visual Grounding},
  booktitle    = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
                  23-27, 2022, Proceedings, Part {VIII}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13808},
  pages        = {3--23},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-25085-9\_1},
  doi          = {10.1007/978-3-031-25085-9\_1},
  timestamp    = {Thu, 16 Feb 2023 11:51:10 +0100},
  biburl       = {https://dblp.org/rec/conf/eccv/HoAJMV22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/RonenTALMM22,
  author       = {Roi Ronen and
                  Shahar Tsiper and
                  Oron Anschel and
                  Inbal Lavi and
                  Amir Markovitz and
                  R. Manmatha},
  editor       = {Shai Avidan and
                  Gabriel J. Brostow and
                  Moustapha Ciss{\'{e}} and
                  Giovanni Maria Farinella and
                  Tal Hassner},
  title        = {{GLASS:} Global to Local Attention for Scene-Text Spotting},
  booktitle    = {Computer Vision - {ECCV} 2022 - 17th European Conference, Tel Aviv,
                  Israel, October 23-27, 2022, Proceedings, Part {XXVIII}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13688},
  pages        = {249--266},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-19815-1\_15},
  doi          = {10.1007/978-3-031-19815-1\_15},
  timestamp    = {Sun, 13 Nov 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/eccv/RonenTALMM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/SlossbergAMLATMWM22,
  author       = {Ron Slossberg and
                  Oron Anschel and
                  Amir Markovitz and
                  Ron Litman and
                  Aviad Aberdam and
                  Shahar Tsiper and
                  Shai Mazor and
                  Jon Wu and
                  R. Manmatha},
  editor       = {Leonid Karlinsky and
                  Tomer Michaeli and
                  Ko Nishino},
  title        = {On Calibration of Scene-Text Recognition Models},
  booktitle    = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October
                  23-27, 2022, Proceedings, Part {IV}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13804},
  pages        = {263--279},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-25069-9\_18},
  doi          = {10.1007/978-3-031-25069-9\_18},
  timestamp    = {Mon, 20 Feb 2023 17:49:54 +0100},
  biburl       = {https://dblp.org/rec/conf/eccv/SlossbergAMLATMWM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/indocrypt/MaitraMR22,
  author       = {Subhamoy Maitra and
                  Bimal Mandal and
                  Manmatha Roy},
  editor       = {Takanori Isobe and
                  Santanu Sarkar},
  title        = {Modifying Bent Functions to Obtain the Balanced Ones with High Nonlinearity},
  booktitle    = {Progress in Cryptology - {INDOCRYPT} 2022 - 23rd International Conference
                  on Cryptology in India, Kolkata, India, December 11-14, 2022, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {13774},
  pages        = {449--470},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-22912-1\_20},
  doi          = {10.1007/978-3-031-22912-1\_20},
  timestamp    = {Mon, 09 Jan 2023 17:58:33 +0100},
  biburl       = {https://dblp.org/rec/conf/indocrypt/MaitraMR22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2202-05508,
  author       = {Yair Kittenplon and
                  Inbal Lavi and
                  Sharon Fogel and
                  Yarin Bar and
                  R. Manmatha and
                  Pietro Perona},
  title        = {Towards Weakly-Supervised Text Spotting using a Multi-Task Transformer},
  journal      = {CoRR},
  volume       = {abs/2202.05508},
  year         = {2022},
  url          = {https://arxiv.org/abs/2202.05508},
  eprinttype    = {arXiv},
  eprint       = {2202.05508},
  timestamp    = {Fri, 18 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2202-05508.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-03364,
  author       = {Roi Ronen and
                  Shahar Tsiper and
                  Oron Anschel and
                  Inbal Lavi and
                  Amir Markovitz and
                  R. Manmatha},
  title        = {{GLASS:} Global to Local Attention for Scene-Text Spotting},
  journal      = {CoRR},
  volume       = {abs/2208.03364},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2208.03364},
  doi          = {10.48550/ARXIV.2208.03364},
  eprinttype    = {arXiv},
  eprint       = {2208.03364},
  timestamp    = {Wed, 10 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2208-03364.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-07912,
  author       = {Chih{-}Hui Ho and
                  Srikar Appalaraju and
                  Bhavan Jasani and
                  R. Manmatha and
                  Nuno Vasconcelos},
  title        = {{YORO} - Lightweight End to End Visual Grounding},
  journal      = {CoRR},
  volume       = {abs/2211.07912},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2211.07912},
  doi          = {10.48550/ARXIV.2211.07912},
  eprinttype    = {arXiv},
  eprint       = {2211.07912},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2211-07912.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/AberdamLTASMMP21,
  author       = {Aviad Aberdam and
                  Ron Litman and
                  Shahar Tsiper and
                  Oron Anschel and
                  Ron Slossberg and
                  Shai Mazor and
                  R. Manmatha and
                  Pietro Perona},
  title        = {Sequence-to-Sequence Contrastive Learning for Text Recognition},
  booktitle    = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
                  2021, virtual, June 19-25, 2021},
  pages        = {15302--15312},
  publisher    = {Computer Vision Foundation / {IEEE}},
  year         = {2021},
  url          = {https://openaccess.thecvf.com/content/CVPR2021/html/Aberdam\_Sequence-to-Sequence\_Contrastive\_Learning\_for\_Text\_Recognition\_CVPR\_2021\_paper.html},
  doi          = {10.1109/CVPR46437.2021.01505},
  timestamp    = {Mon, 18 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/AberdamLTASMMP21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/AppalarajuJKXM21,
  author       = {Srikar Appalaraju and
                  Bhavan Jasani and
                  Bhargava Urala Kota and
                  Yusheng Xie and
                  R. Manmatha},
  title        = {DocFormer: End-to-End Transformer for Document Understanding},
  booktitle    = {2021 {IEEE/CVF} International Conference on Computer Vision, {ICCV}
                  2021, Montreal, QC, Canada, October 10-17, 2021},
  pages        = {973--983},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/ICCV48922.2021.00103},
  doi          = {10.1109/ICCV48922.2021.00103},
  timestamp    = {Fri, 11 Mar 2022 10:01:27 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/AppalarajuJKXM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/PatelAM21,
  author       = {Yash Patel and
                  Srikar Appalaraju and
                  R. Manmatha},
  title        = {Saliency Driven Perceptual Image Compression},
  booktitle    = {{IEEE} Winter Conference on Applications of Computer Vision, {WACV}
                  2021, Waikoloa, HI, USA, January 3-8, 2021},
  pages        = {227--236},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/WACV48630.2021.00027},
  doi          = {10.1109/WACV48630.2021.00027},
  timestamp    = {Fri, 18 Jun 2021 10:51:54 +0200},
  biburl       = {https://dblp.org/rec/conf/wacv/PatelAM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-11539,
  author       = {Srikar Appalaraju and
                  Bhavan Jasani and
                  Bhargava Urala Kota and
                  Yusheng Xie and
                  R. Manmatha},
  title        = {DocFormer: End-to-End Transformer for Document Understanding},
  journal      = {CoRR},
  volume       = {abs/2106.11539},
  year         = {2021},
  url          = {https://arxiv.org/abs/2106.11539},
  eprinttype    = {arXiv},
  eprint       = {2106.11539},
  timestamp    = {Wed, 30 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2106-11539.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-12494,
  author       = {Ali Furkan Biten and
                  Ron Litman and
                  Yusheng Xie and
                  Srikar Appalaraju and
                  R. Manmatha},
  title        = {LaTr: Layout-Aware Transformer for Scene-Text {VQA}},
  journal      = {CoRR},
  volume       = {abs/2112.12494},
  year         = {2021},
  url          = {https://arxiv.org/abs/2112.12494},
  eprinttype    = {arXiv},
  eprint       = {2112.12494},
  timestamp    = {Tue, 04 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2112-12494.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LitmanATLMM20,
  author       = {Ron Litman and
                  Oron Anschel and
                  Shahar Tsiper and
                  Roee Litman and
                  Shai Mazor and
                  R. Manmatha},
  title        = {{SCATTER:} Selective Context Attentional Scene Text Recognizer},
  booktitle    = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020},
  pages        = {11959--11969},
  publisher    = {Computer Vision Foundation / {IEEE}},
  year         = {2020},
  url          = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Litman\_SCATTER\_Selective\_Context\_Attentional\_Scene\_Text\_Recognizer\_CVPR\_2020\_paper.html},
  doi          = {10.1109/CVPR42600.2020.01198},
  timestamp    = {Tue, 31 Aug 2021 14:00:04 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/LitmanATLMM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/space/MaitraMRT20,
  author       = {Subhamoy Maitra and
                  Bimal Mandal and
                  Manmatha Roy and
                  Deng Tang},
  editor       = {Lejla Batina and
                  Stjepan Picek and
                  Mainack Mondal},
  title        = {Experimental Results on Higher-Order Differential Spectra of 6 and
                  8-bit Invertible S-Boxes},
  booktitle    = {Security, Privacy, and Applied Cryptography Engineering - 10th International
                  Conference, {SPACE} 2020, Kolkata, India, December 17-21, 2020, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {12586},
  pages        = {226--237},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-66626-2\_12},
  doi          = {10.1007/978-3-030-66626-2\_12},
  timestamp    = {Tue, 05 Jan 2021 17:43:06 +0100},
  biburl       = {https://dblp.org/rec/conf/space/MaitraMRT20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2002-04988,
  author       = {Yash Patel and
                  Srikar Appalaraju and
                  R. Manmatha},
  title        = {Hierarchical Auto-Regressive Model for Image Compression Incorporating
                  Object Saliency and a Deep Perceptual Loss},
  journal      = {CoRR},
  volume       = {abs/2002.04988},
  year         = {2020},
  url          = {https://arxiv.org/abs/2002.04988},
  eprinttype    = {arXiv},
  eprint       = {2002.04988},
  timestamp    = {Fri, 14 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2002-04988.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2003-11288,
  author       = {Ron Litman and
                  Oron Anschel and
                  Shahar Tsiper and
                  Roee Litman and
                  Shai Mazor and
                  R. Manmatha},
  title        = {{SCATTER:} Selective Context Attentional Scene Text Recognizer},
  journal      = {CoRR},
  volume       = {abs/2003.11288},
  year         = {2020},
  url          = {https://arxiv.org/abs/2003.11288},
  eprinttype    = {arXiv},
  eprint       = {2003.11288},
  timestamp    = {Wed, 01 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2003-11288.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-08955,
  author       = {Hang Zhang and
                  Chongruo Wu and
                  Zhongyue Zhang and
                  Yi Zhu and
                  Zhi Zhang and
                  Haibin Lin and
                  Yue Sun and
                  Tong He and
                  Jonas Mueller and
                  R. Manmatha and
                  Mu Li and
                  Alexander J. Smola},
  title        = {ResNeSt: Split-Attention Networks},
  journal      = {CoRR},
  volume       = {abs/2004.08955},
  year         = {2020},
  url          = {https://arxiv.org/abs/2004.08955},
  eprinttype    = {arXiv},
  eprint       = {2004.08955},
  timestamp    = {Wed, 10 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2004-08955.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2004-14960,
  author       = {Yi Zhu and
                  Zhongyue Zhang and
                  Chongruo Wu and
                  Zhi Zhang and
                  Tong He and
                  Hang Zhang and
                  R. Manmatha and
                  Mu Li and
                  Alexander J. Smola},
  title        = {Improving Semantic Segmentation via Self-Training},
  journal      = {CoRR},
  volume       = {abs/2004.14960},
  year         = {2020},
  url          = {https://arxiv.org/abs/2004.14960},
  eprinttype    = {arXiv},
  eprint       = {2004.14960},
  timestamp    = {Wed, 10 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2004-14960.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-00398,
  author       = {Minesh Mathew and
                  Dimosthenis Karatzas and
                  R. Manmatha and
                  C. V. Jawahar},
  title        = {DocVQA: {A} Dataset for {VQA} on Document Images},
  journal      = {CoRR},
  volume       = {abs/2007.00398},
  year         = {2020},
  url          = {https://arxiv.org/abs/2007.00398},
  eprinttype    = {arXiv},
  eprint       = {2007.00398},
  timestamp    = {Mon, 06 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2007-00398.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2008-08899,
  author       = {Minesh Mathew and
                  Rub{\`{e}}n Tito and
                  Dimosthenis Karatzas and
                  R. Manmatha and
                  C. V. Jawahar},
  title        = {Document Visual Question Answering Challenge 2020},
  journal      = {CoRR},
  volume       = {abs/2008.08899},
  year         = {2020},
  url          = {https://arxiv.org/abs/2008.08899},
  eprinttype    = {arXiv},
  eprint       = {2008.08899},
  timestamp    = {Fri, 21 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2008-08899.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-06567,
  author       = {Yi Zhu and
                  Xinyu Li and
                  Chunhui Liu and
                  Mohammadreza Zolfaghari and
                  Yuanjun Xiong and
                  Chongruo Wu and
                  Zhi Zhang and
                  Joseph Tighe and
                  R. Manmatha and
                  Mu Li},
  title        = {A Comprehensive Study of Deep Video Action Recognition},
  journal      = {CoRR},
  volume       = {abs/2012.06567},
  year         = {2020},
  url          = {https://arxiv.org/abs/2012.06567},
  eprinttype    = {arXiv},
  eprint       = {2012.06567},
  timestamp    = {Wed, 10 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2012-06567.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-10873,
  author       = {Aviad Aberdam and
                  Ron Litman and
                  Shahar Tsiper and
                  Oron Anschel and
                  Ron Slossberg and
                  Shai Mazor and
                  R. Manmatha and
                  Pietro Perona},
  title        = {Sequence-to-Sequence Contrastive Learning for Text Recognition},
  journal      = {CoRR},
  volume       = {abs/2012.10873},
  year         = {2020},
  url          = {https://arxiv.org/abs/2012.10873},
  eprinttype    = {arXiv},
  eprint       = {2012.10873},
  timestamp    = {Mon, 04 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2012-10873.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2012-12643,
  author       = {Ron Slossberg and
                  Oron Anschel and
                  Amir Markovitz and
                  Ron Litman and
                  Aviad Aberdam and
                  Shahar Tsiper and
                  Shai Mazor and
                  Jon Wu and
                  R. Manmatha},
  title        = {On Calibration of Scene-Text Recognition Models},
  journal      = {CoRR},
  volume       = {abs/2012.12643},
  year         = {2020},
  url          = {https://arxiv.org/abs/2012.12643},
  eprinttype    = {arXiv},
  eprint       = {2012.12643},
  timestamp    = {Tue, 05 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2012-12643.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jois/DixitRP19,
  author       = {Anil Kumar Dixit and
                  Manmatha K. Roul and
                  Bikash C. Panda},
  title        = {Mathematical Model Using Soft Computing Techniques for Different Thermal
                  Insulation Materials},
  journal      = {J. Intell. Syst.},
  volume       = {28},
  number       = {5},
  pages        = {821--833},
  year         = {2019},
  url          = {https://doi.org/10.1515/jisys-2017-0103},
  doi          = {10.1515/JISYS-2017-0103},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jois/DixitRP19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/YalnizM19,
  author       = {Ismet Zeki Yalniz and
                  R. Manmatha},
  title        = {Dependence Models for Searching Text in Document Images},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {41},
  number       = {1},
  pages        = {49--63},
  year         = {2019},
  url          = {https://doi.org/10.1109/TPAMI.2017.2780108},
  doi          = {10.1109/TPAMI.2017.2780108},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pami/YalnizM19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-02244,
  author       = {Son Tran and
                  Ming Du and
                  Sampath Chanda and
                  R. Manmatha and
                  Cj Taylor},
  title        = {Searching for Apparel Products from Images in the Wild},
  journal      = {CoRR},
  volume       = {abs/1907.02244},
  year         = {2019},
  url          = {http://arxiv.org/abs/1907.02244},
  eprinttype    = {arXiv},
  eprint       = {1907.02244},
  timestamp    = {Mon, 08 Jul 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1907-02244.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-08310,
  author       = {Yash Patel and
                  Srikar Appalaraju and
                  R. Manmatha},
  title        = {Deep Perceptual Compression},
  journal      = {CoRR},
  volume       = {abs/1907.08310},
  year         = {2019},
  url          = {http://arxiv.org/abs/1907.08310},
  eprinttype    = {arXiv},
  eprint       = {1907.08310},
  timestamp    = {Tue, 23 Jul 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1907-08310.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1908-04187,
  author       = {Yash Patel and
                  Srikar Appalaraju and
                  R. Manmatha},
  title        = {Human Perceptual Evaluations for Image Compression},
  journal      = {CoRR},
  volume       = {abs/1908.04187},
  year         = {2019},
  url          = {http://arxiv.org/abs/1908.04187},
  eprinttype    = {arXiv},
  eprint       = {1908.04187},
  timestamp    = {Mon, 19 Aug 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1908-04187.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WuZHMSK18,
  author       = {Chao{-}Yuan Wu and
                  Manzil Zaheer and
                  Hexiang Hu and
                  R. Manmatha and
                  Alexander J. Smola and
                  Philipp Kr{\"{a}}henb{\"{u}}hl},
  title        = {Compressed Video Action Recognition},
  booktitle    = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018},
  pages        = {6026--6035},
  publisher    = {Computer Vision Foundation / {IEEE} Computer Society},
  year         = {2018},
  url          = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Wu\_Compressed\_Video\_Action\_CVPR\_2018\_paper.html},
  doi          = {10.1109/CVPR.2018.00631},
  timestamp    = {Sun, 06 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/WuZHMSK18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/ManmathaWSK17,
  author       = {R. Manmatha and
                  Chao{-}Yuan Wu and
                  Alexander J. Smola and
                  Philipp Kr{\"{a}}henb{\"{u}}hl},
  title        = {Sampling Matters in Deep Embedding Learning},
  booktitle    = {{IEEE} International Conference on Computer Vision, {ICCV} 2017, Venice,
                  Italy, October 22-29, 2017},
  pages        = {2859--2867},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/ICCV.2017.309},
  doi          = {10.1109/ICCV.2017.309},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/ManmathaWSK17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WuMSK17,
  author       = {Chao{-}Yuan Wu and
                  R. Manmatha and
                  Alexander J. Smola and
                  Philipp Kr{\"{a}}henb{\"{u}}hl},
  title        = {Sampling Matters in Deep Embedding Learning},
  journal      = {CoRR},
  volume       = {abs/1706.07567},
  year         = {2017},
  url          = {http://arxiv.org/abs/1706.07567},
  eprinttype    = {arXiv},
  eprint       = {1706.07567},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/WuMSK17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1712-00636,
  author       = {Chao{-}Yuan Wu and
                  Manzil Zaheer and
                  Hexiang Hu and
                  R. Manmatha and
                  Alexander J. Smola and
                  Philipp Kr{\"{a}}henb{\"{u}}hl},
  title        = {Compressed Video Action Recognition},
  journal      = {CoRR},
  volume       = {abs/1712.00636},
  year         = {2017},
  url          = {http://arxiv.org/abs/1712.00636},
  eprinttype    = {arXiv},
  eprint       = {1712.00636},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1712-00636.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/MurthySCMC16,
  author       = {Venkatesh N. Murthy and
                  Vivek K. Singh and
                  Terrence Chen and
                  R. Manmatha and
                  Dorin Comaniciu},
  title        = {Deep Decision Network for Multi-class Image Classification},
  booktitle    = {2016 {IEEE} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2016, Las Vegas, NV, USA, June 27-30, 2016},
  pages        = {2240--2248},
  publisher    = {{IEEE} Computer Society},
  year         = {2016},
  url          = {https://doi.org/10.1109/CVPR.2016.246},
  doi          = {10.1109/CVPR.2016.246},
  timestamp    = {Thu, 05 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/MurthySCMC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/YalnizGM16,
  author       = {Ismet Zeki Yalniz and
                  Douglas Gray and
                  R. Manmatha},
  editor       = {Gang Hua and
                  Herv{\'{e}} J{\'{e}}gou},
  title        = {Efficient Exploration of Text Regions in Natural Scene Images Using
                  Adaptive Image Sampling},
  booktitle    = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
                  October 8-10 and 15-16, 2016, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {9913},
  pages        = {427--439},
  publisher    = {Springer},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-46604-0\_31},
  doi          = {10.1007/978-3-319-46604-0\_31},
  timestamp    = {Tue, 14 May 2019 10:00:45 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/YalnizGM16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/MurthySCM16,
  author       = {Venkatesh N. Murthy and
                  Avinash Sharma and
                  Visesh Chari and
                  R. Manmatha},
  editor       = {John R. Kender and
                  John R. Smith and
                  Jiebo Luo and
                  Susanne Boll and
                  Winston H. Hsu},
  title        = {Image Annotation using Multi-scale Hypergraph Heat Diffusion Framework},
  booktitle    = {Proceedings of the 2016 {ACM} on International Conference on Multimedia
                  Retrieval, {ICMR} 2016, New York, New York, USA, June 6-9, 2016},
  pages        = {299--303},
  publisher    = {{ACM}},
  year         = {2016},
  url          = {https://doi.org/10.1145/2911996.2912055},
  doi          = {10.1145/2911996.2912055},
  timestamp    = {Wed, 18 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mir/MurthySCM16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyMJRRMK15,
  author       = {Martin Halvey and
                  Philip J. McParlane and
                  Joemon M. Jose and
                  Keith van Rijsbergen and
                  Stefan M. R{\"{u}}ger and
                  R. Manmatha and
                  Mohan S. Kankanhalli},
  title        = {{ICMR} 2014: 4th {ACM} International Conference on Multimedia Retrieval},
  journal      = {{SIGIR} Forum},
  volume       = {49},
  number       = {1},
  pages        = {10--15},
  year         = {2015},
  url          = {https://doi.org/10.1145/2795403.2795407},
  doi          = {10.1145/2795403.2795407},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sigir/HalveyMJRRMK15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/MurthyMM15,
  author       = {Venkatesh N. Murthy and
                  Subhransu Maji and
                  R. Manmatha},
  editor       = {Alexander G. Hauptmann and
                  Chong{-}Wah Ngo and
                  Xiangyang Xue and
                  Yu{-}Gang Jiang and
                  Cees Snoek and
                  Nuno Vasconcelos},
  title        = {Automatic Image Annotation using Deep Learning Representations},
  booktitle    = {Proceedings of the 5th {ACM} on International Conference on Multimedia
                  Retrieval, Shanghai, China, June 23-26, 2015},
  pages        = {603--606},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {https://doi.org/10.1145/2671188.2749391},
  doi          = {10.1145/2671188.2749391},
  timestamp    = {Tue, 01 Oct 2024 17:31:10 +0200},
  biburl       = {https://dblp.org/rec/conf/mir/MurthyMM15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/SankarMJ14,
  author       = {K. Pramod Sankar and
                  R. Manmatha and
                  C. V. Jawahar},
  title        = {Large scale document image retrieval by automatic word annotation},
  journal      = {Int. J. Document Anal. Recognit.},
  volume       = {17},
  number       = {1},
  pages        = {1--17},
  year         = {2014},
  url          = {https://doi.org/10.1007/s10032-013-0207-2},
  doi          = {10.1007/S10032-013-0207-2},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijdar/SankarMJ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mva/MoeslundJJM14,
  author       = {Thomas B. Moeslund and
                  Omar Javed and
                  Yu{-}Gang Jiang and
                  R. Manmatha},
  title        = {Special issue on Multimedia Event Detection},
  journal      = {Mach. Vis. Appl.},
  volume       = {25},
  number       = {1},
  pages        = {1--4},
  year         = {2014},
  url          = {https://doi.org/10.1007/s00138-013-0586-x},
  doi          = {10.1007/S00138-013-0586-X},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/mva/MoeslundJJM14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/MotaMFL14,
  author       = {David Fern{\'{a}}ndez Mota and
                  R. Manmatha and
                  Alicia Forn{\'{e}}s and
                  Josep Llad{\'{o}}s},
  editor       = {Jean{-}Yves Ramel and
                  Marcus Liwicki and
                  Jean{-}Marc Ogier and
                  Koichi Kise and
                  Ray Smith},
  title        = {Sequential Word Spotting in Historical Handwritten Documents},
  booktitle    = {11th {IAPR} International Workshop on Document Analysis Systems, {DAS}
                  2014, Tours, France, April 7-10, 2014},
  pages        = {101--105},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://doi.org/10.1109/DAS.2014.18},
  doi          = {10.1109/DAS.2014.18},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/das/MotaMFL14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/CanM14,
  author       = {Ethem F. Can and
                  R. Manmatha},
  editor       = {Mohan S. Kankanhalli and
                  Stefan M. R{\"{u}}ger and
                  R. Manmatha and
                  Joemon M. Jose and
                  Keith van Rijsbergen},
  title        = {Modeling Concept Dependencies for Event Detection},
  booktitle    = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow,
                  United Kingdom - April 01 - 04, 2014},
  pages        = {289},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2578726.2578763},
  doi          = {10.1145/2578726.2578763},
  timestamp    = {Thu, 15 Jul 2021 17:18:30 +0200},
  biburl       = {https://dblp.org/rec/conf/mir/CanM14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mir/MurthyCM14,
  author       = {Venkatesh N. Murthy and
                  Ethem F. Can and
                  R. Manmatha},
  editor       = {Mohan S. Kankanhalli and
                  Stefan M. R{\"{u}}ger and
                  R. Manmatha and
                  Joemon M. Jose and
                  Keith van Rijsbergen},
  title        = {A Hybrid Model for Automatic Image Annotation},
  booktitle    = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow,
                  United Kingdom - April 01 - 04, 2014},
  pages        = {369},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2578726.2578774},
  doi          = {10.1145/2578726.2578774},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mir/MurthyCM14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CanCM14,
  author       = {Ethem F. Can and
                  W. Bruce Croft and
                  R. Manmatha},
  editor       = {Shlomo Geva and
                  Andrew Trotman and
                  Peter Bruza and
                  Charles L. A. Clarke and
                  Kalervo J{\"{a}}rvelin},
  title        = {Incorporating query-specific feedback into learning-to-rank models},
  booktitle    = {The 37th International {ACM} {SIGIR} Conference on Research and Development
                  in Information Retrieval, {SIGIR} '14, Gold Coast , QLD, Australia
                  - July 06 - 11, 2014},
  pages        = {1035--1038},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {https://doi.org/10.1145/2600428.2609503},
  doi          = {10.1145/2600428.2609503},
  timestamp    = {Tue, 06 Nov 2018 11:07:24 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/CanCM14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mir/2014,
  editor       = {Mohan S. Kankanhalli and
                  Stefan M. R{\"{u}}ger and
                  R. Manmatha and
                  Joemon M. Jose and
                  Keith van Rijsbergen},
  title        = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow,
                  United Kingdom - April 01 - 04, 2014},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {http://dl.acm.org/citation.cfm?id=2578726},
  isbn         = {978-1-4503-2782-4},
  timestamp    = {Thu, 15 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mir/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/CanOM13,
  author       = {Ethem F. Can and
                  H{\"{u}}seyin Oktay and
                  R. Manmatha},
  editor       = {Qi He and
                  Arun Iyengar and
                  Wolfgang Nejdl and
                  Jian Pei and
                  Rajeev Rastogi},
  title        = {Predicting retweet count using visual cues},
  booktitle    = {22nd {ACM} International Conference on Information and Knowledge Management,
                  CIKM'13, San Francisco, CA, USA, October 27 - November 1, 2013},
  pages        = {1481--1484},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2505515.2507824},
  doi          = {10.1145/2505515.2507824},
  timestamp    = {Mon, 19 Aug 2024 08:36:26 +0200},
  biburl       = {https://dblp.org/rec/conf/cikm/CanOM13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/CanM13,
  author       = {Ethem F. Can and
                  R. Manmatha},
  title        = {Formulating Action Recognition as a Ranking Problem},
  booktitle    = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
                  Workshops 2013, Portland, OR, USA, June 23-28, 2013},
  pages        = {251--256},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/CVPRW.2013.44},
  doi          = {10.1109/CVPRW.2013.44},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/CanM13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/WemhoenerYM13,
  author       = {David Wemhoener and
                  Ismet Zeki Yalniz and
                  R. Manmatha},
  title        = {Creating an Improved Version Using Noisy {OCR} from Multiple Editions},
  booktitle    = {12th International Conference on Document Analysis and Recognition,
                  {ICDAR} 2013, Washington, DC, USA, August 25-28, 2013},
  pages        = {160--164},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/ICDAR.2013.39},
  doi          = {10.1109/ICDAR.2013.39},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/WemhoenerYM13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/Allan0FMMW13,
  author       = {James Allan and
                  Jeff Dalton and
                  John Foley and
                  R. Manmatha and
                  Venkatesh N. Murthy and
                  David Wemhoener},
  editor       = {Paul Over and
                  Jon Fiscus and
                  Gregory A. Sanders and
                  Barbara Shaw and
                  George Awad and
                  Martial Michel and
                  Alan F. Smeaton and
                  Wessel Kraaij and
                  Georges Qu{\'{e}}not},
  title        = {Short Text Queries for Video Retrieval Multimedia event Detection
                  at {TRECVID} 2013},
  booktitle    = {2013 {TREC} Video Retrieval Evaluation, {TRECVID} 2013, Gaithersburg,
                  MD, USA, November 20-22, 2013},
  publisher    = {National Institute of Standards and Technology {(NIST)}},
  year         = {2013},
  url          = {https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/umass.pdf},
  timestamp    = {Mon, 10 May 2021 15:09:49 +0200},
  biburl       = {https://dblp.org/rec/conf/trecvid/Allan0FMMW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/LiuCJYCZDSAMFSD13,
  author       = {Jingen Liu and
                  Hui Cheng and
                  Omar Javed and
                  Qian Yu and
                  Ishani Chakraborty and
                  Weiyu Zhang and
                  Ajay Divakaran and
                  Harpreet S. Sawhney and
                  James Allan and
                  R. Manmatha and
                  John Foley and
                  Mubarak Shah and
                  Afshin Dehghan and
                  Michael Witbrock and
                  Jon Curtis and
                  Gerald Friedland},
  editor       = {Paul Over and
                  Jon Fiscus and
                  Gregory A. Sanders and
                  Barbara Shaw and
                  George Awad and
                  Martial Michel and
                  Alan F. Smeaton and
                  Wessel Kraaij and
                  Georges Qu{\'{e}}not},
  title        = {SRI-Sarnoff {AURORA} System at {TRECVID} 2013 Multimedia Event Detection
                  and Recounting},
  booktitle    = {2013 {TREC} Video Retrieval Evaluation, {TRECVID} 2013, Gaithersburg,
                  MD, USA, November 20-22, 2013},
  publisher    = {National Institute of Standards and Technology {(NIST)}},
  year         = {2013},
  url          = {https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/sriaurora\_med\_mer.pdf},
  timestamp    = {Tue, 07 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/trecvid/LiuCJYCZDSAMFSD13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icdar/2013hip,
  editor       = {Volkmar Frinken and
                  Bill Barrett and
                  R. Manmatha and
                  Volker M{\"{a}}rgner},
  title        = {Proceedings of the 2nd International Workshop on Historical Document
                  Imaging and Processing, HIP@ICDAR 2013, Washington, DC, USA, August
                  24, 2013},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2501115},
  doi          = {10.1145/2501115},
  isbn         = {978-1-4503-2115-0},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/2013hip.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/FrinkenFMB12,
  author       = {Volkmar Frinken and
                  Andreas Fischer and
                  R. Manmatha and
                  Horst Bunke},
  title        = {A Novel Word Spotting Method Based on Recurrent Neural Networks},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {34},
  number       = {2},
  pages        = {211--224},
  year         = {2012},
  url          = {https://doi.org/10.1109/TPAMI.2011.113},
  doi          = {10.1109/TPAMI.2011.113},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/FrinkenFMB12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/YalnizM12,
  author       = {Ismet Zeki Yalniz and
                  R. Manmatha},
  editor       = {Michael Blumenstein and
                  Umapada Pal and
                  Seiichi Uchida},
  title        = {An Efficient Framework for Searching Text in Noisy Document Images},
  booktitle    = {10th {IAPR} International Workshop on Document Analysis Systems, {DAS}
                  2012, Gold Coast, Queenslands, Australia, March 27-29, 2012},
  pages        = {48--52},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://doi.org/10.1109/DAS.2012.18},
  doi          = {10.1109/DAS.2012.18},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/das/YalnizM12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfhr/FernandezLFM12,
  author       = {David Fern{\'{a}}ndez and
                  Josep Llad{\'{o}}s and
                  Alicia Forn{\'{e}}s and
                  R. Manmatha},
  title        = {On Influence of Line Segmentation in Efficient Word Segmentation in
                  Old Manuscripts},
  booktitle    = {2012 International Conference on Frontiers in Handwriting Recognition,
                  {ICFHR} 2012, Bari, Italy, September 18-20, 2012},
  pages        = {763--768},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICFHR.2012.247},
  doi          = {10.1109/ICFHR.2012.247},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icfhr/FernandezLFM12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CartrightCDDGKWYAMS12,
  author       = {Marc{-}Allen Cartright and
                  Ethem F. Can and
                  William Dabney and
                  Jeff Dalton and
                  Logan Giorda and
                  Kriste Krstovski and
                  Xiaoye Wu and
                  Ismet Zeki Yalniz and
                  James Allan and
                  R. Manmatha and
                  David A. Smith},
  editor       = {William R. Hersh and
                  Jamie Callan and
                  Yoelle Maarek and
                  Mark Sanderson},
  title        = {A framework for manipulating and searching multiple retrieval types},
  booktitle    = {The 35th International {ACM} {SIGIR} conference on research and development
                  in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16,
                  2012},
  pages        = {1001},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {https://doi.org/10.1145/2348283.2348426},
  doi          = {10.1145/2348283.2348426},
  timestamp    = {Wed, 14 Nov 2018 10:58:10 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/CartrightCDDGKWYAMS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YalnizM12,
  author       = {Ismet Zeki Yalniz and
                  R. Manmatha},
  editor       = {William R. Hersh and
                  Jamie Callan and
                  Yoelle Maarek and
                  Mark Sanderson},
  title        = {Finding translations in scanned book collections},
  booktitle    = {The 35th International {ACM} {SIGIR} conference on research and development
                  in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16,
                  2012},
  pages        = {465--474},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {https://doi.org/10.1145/2348283.2348347},
  doi          = {10.1145/2348283.2348347},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/YalnizM12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/ChengLAJYTDSMAH12,
  author       = {Hui Cheng and
                  Jingen Liu and
                  Saad Ali and
                  Omar Javed and
                  Qian Yu and
                  Amir Tamrakar and
                  Ajay Divakaran and
                  Harpreet S. Sawhney and
                  R. Manmatha and
                  James Allan and
                  Alexander G. Hauptmann and
                  Mubarak Shah and
                  Subhabrata Bhattacharya and
                  Afshin Dehghan and
                  Gerald Friedland and
                  Benjamin Elizalde and
                  Trevor Darrell and
                  Michael Witbrock and
                  Jon Curtis},
  editor       = {Paul Over and
                  Jonathan G. Fiscus and
                  Gregory A. Sanders and
                  Barbara Shaw and
                  George Awad and
                  Martial Michel and
                  Alan F. Smeaton and
                  Wessel Kraaij and
                  Georges Qu{\'{e}}not},
  title        = {SRI-Sarnoff {AURORA} System at {TRECVID} 2012 Multimedia Event Detection
                  and Recounting},
  booktitle    = {2012 {TREC} Video Retrieval Evaluation, {TRECVID} 2012, Gaithersburg,
                  MD, USA, November 26-28, 2012},
  publisher    = {National Institute of Standards and Technology {(NIST)}},
  year         = {2012},
  url          = {https://www-nlpir.nist.gov/projects/tvpubs/tv12.papers/aurora.pdf},
  timestamp    = {Sun, 05 Apr 2020 14:39:22 +0200},
  biburl       = {https://dblp.org/rec/conf/trecvid/ChengLAJYTDSMAH12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/SmithMA11,
  author       = {David A. Smith and
                  R. Manmatha and
                  James Allan},
  editor       = {Gabriella Kazai and
                  Carsten Eickhoff and
                  Peter Brusilovsky},
  title        = {Mining relational structure from millions of books: position paper},
  booktitle    = {Proceedings of the 4th {ACM} Workshop on Online books, complementary
                  social media and crowdsourcing, BooksOnline 2011, Glasgow, United
                  Kingdom, October 24, 2011},
  pages        = {49--54},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2064058.2064069},
  doi          = {10.1145/2064058.2064069},
  timestamp    = {Wed, 04 May 2022 13:03:26 +0200},
  biburl       = {https://dblp.org/rec/conf/cikm/SmithMA11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/YalnizCM11,
  author       = {Ismet Zeki Yalniz and
                  Ethem F. Can and
                  R. Manmatha},
  editor       = {Craig Macdonald and
                  Iadh Ounis and
                  Ian Ruthven},
  title        = {Partial duplicate detection for large book collections},
  booktitle    = {Proceedings of the 20th {ACM} Conference on Information and Knowledge
                  Management, {CIKM} 2011, Glasgow, United Kingdom, October 24-28, 2011},
  pages        = {469--474},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2063576.2063647},
  doi          = {10.1145/2063576.2063647},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cikm/YalnizCM11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/JainFJM11,
  author       = {Raman Jain and
                  Volkmar Frinken and
                  C. V. Jawahar and
                  Raghavan Manmatha},
  title        = {{BLSTM} Neural Network Based Word Retrieval for Hindi Documents},
  booktitle    = {2011 International Conference on Document Analysis and Recognition,
                  {ICDAR} 2011, Beijing, China, September 18-21, 2011},
  pages        = {83--87},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICDAR.2011.26},
  doi          = {10.1109/ICDAR.2011.26},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/JainFJM11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/YalnizM11,
  author       = {Ismet Zeki Yalniz and
                  Raghavan Manmatha},
  title        = {A Fast Alignment Scheme for Automatic {OCR} Evaluation of Books},
  booktitle    = {2011 International Conference on Document Analysis and Recognition,
                  {ICDAR} 2011, Beijing, China, September 18-21, 2011},
  pages        = {754--758},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICDAR.2011.157},
  doi          = {10.1109/ICDAR.2011.157},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/YalnizM11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trecvid/ChengTAYJLDSHSB11,
  author       = {Hui Cheng and
                  Amir Tamrakar and
                  Saad Ali and
                  Qian Yu and
                  Omar Javed and
                  Jingen Liu and
                  Ajay Divakaran and
                  Harpreet S. Sawhney and
                  Alexander G. Hauptmann and
                  Mubarak Shah and
                  Subhabrata Bhattacharya and
                  Michael Witbrock and
                  Jon Curtis and
                  Gerald Friedland and
                  Robert Mertens and
                  Trevor Darrell and
                  R. Manmatha and
                  James Allan},
  editor       = {Paul Over and
                  George Awad and
                  Jonathan G. Fiscus and
                  Brian Antonishek and
                  Martial Michel and
                  Alan F. Smeaton and
                  Wessel Kraaij and
                  Georges Qu{\'{e}}not},
  title        = {Team SRI-Sarnoff's {AURORA} System @ {TRECVID} 2011},
  booktitle    = {2011 {TREC} Video Retrieval Evaluation, {TRECVID} 2011, Gaithersburg,
                  MD, USA, December 5-7, 2011},
  publisher    = {National Institute of Standards and Technology {(NIST)}},
  year         = {2011},
  url          = {https://www-nlpir.nist.gov/projects/tvpubs/tv11.papers/sri-aurora.pdf},
  timestamp    = {Thu, 11 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/trecvid/ChengTAYJLDSHSB11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icdar/2011hip,
  editor       = {Bill Barrett and
                  Michael S. Brown and
                  R. Manmatha and
                  Jake Gehring},
  title        = {Proceedings of the 2011 Workshop on Historical Document Imaging and
                  Processing, HIP@ICDAR 2011, Beijing, China, September 16-17, 2011},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2037342},
  doi          = {10.1145/2037342},
  isbn         = {978-1-4503-0916-5},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/2011hip.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/LlorenteMR10,
  author       = {Ainhoa Llorente and
                  Raghavan Manmatha and
                  Stefan M. R{\"{u}}ger},
  editor       = {Shipeng Li and
                  Xinbo Gao and
                  Nicu Sebe},
  title        = {Image retrieval using Markov Random Fields and global image features},
  booktitle    = {Proceedings of the 9th {ACM} International Conference on Image and
                  Video Retrieval, {CIVR} 2010, Xi'an, China, July 5-7, 2010},
  pages        = {243--250},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1816041.1816078},
  doi          = {10.1145/1816041.1816078},
  timestamp    = {Tue, 20 Apr 2021 16:59:22 +0200},
  biburl       = {https://dblp.org/rec/conf/civr/LlorenteMR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/SankarJM10,
  author       = {K. Pramod Sankar and
                  C. V. Jawahar and
                  Raghavan Manmatha},
  editor       = {David S. Doermann and
                  Venu Govindaraju and
                  Daniel P. Lopresti and
                  Premkumar Natarajan},
  title        = {Nearest neighbor based collection {OCR}},
  booktitle    = {The Ninth {IAPR} International Workshop on Document Analysis Systems,
                  {DAS} 2010, June 9-11, 2010, Boston, Massachusetts, {USA}},
  series       = {{ACM} International Conference Proceeding Series},
  pages        = {207--214},
  publisher    = {{ACM}},
  year         = {2010},
  url          = {https://doi.org/10.1145/1815330.1815357},
  doi          = {10.1145/1815330.1815357},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/das/SankarJM10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icfhr/FrinkenFBM10,
  author       = {Volkmar Frinken and
                  Andreas Fischer and
                  Horst Bunke and
                  R. Manmatha},
  title        = {Adapting {BLSTM} Neural Network Based Keyword Spotting Trained on
                  Modern Data to Historical Documents},
  booktitle    = {International Conference on Frontiers in Handwriting Recognition,
                  {ICFHR} 2010, Kolkata, India, 16-18 November 2010},
  pages        = {352--357},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICFHR.2010.61},
  doi          = {10.1109/ICFHR.2010.61},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icfhr/FrinkenFBM10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/HoweFM09,
  author       = {Nicholas R. Howe and
                  Shaolei Feng and
                  R. Manmatha},
  title        = {Finding words in alphabet soup: Inference on freeform character recognition
                  for historical scripts},
  journal      = {Pattern Recognit.},
  volume       = {42},
  number       = {12},
  pages        = {3338--3347},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.patcog.2009.01.012},
  doi          = {10.1016/J.PATCOG.2009.01.012},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/HoweFM09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/RasagnaKJM09,
  author       = {Venkat Rasagna and
                  Anand Kumar and
                  C. V. Jawahar and
                  Raghavan Manmatha},
  title        = {Robust Recognition of Documents by Fusing Results of Word Clusters},
  booktitle    = {10th International Conference on Document Analysis and Recognition,
                  {ICDAR} 2009, Barcelona, Spain, 26-29 July 2009},
  pages        = {566--570},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/ICDAR.2009.135},
  doi          = {10.1109/ICDAR.2009.135},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/RasagnaKJM09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/FengM08,
  author       = {Shaolei Feng and
                  Raghavan Manmatha},
  editor       = {Jiebo Luo and
                  Ling Guan and
                  Alan Hanjalic and
                  Mohan S. Kankanhalli and
                  Ivan Lee},
  title        = {A discrete direct retrieval model for image and video retrieval},
  booktitle    = {Proceedings of the 7th {ACM} International Conference on Image and
                  Video Retrieval, {CIVR} 2008, Niagara Falls, Canada, July 7-9, 2008},
  pages        = {427--436},
  publisher    = {{ACM}},
  year         = {2008},
  url          = {https://doi.org/10.1145/1386352.1386407},
  doi          = {10.1145/1386352.1386407},
  timestamp    = {Wed, 26 Jun 2024 21:42:22 +0200},
  biburl       = {https://dblp.org/rec/conf/civr/FengM08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sensys/YanGM08,
  author       = {Tingxin Yan and
                  Deepak Ganesan and
                  R. Manmatha},
  editor       = {Tarek F. Abdelzaher and
                  Margaret Martonosi and
                  Adam Wolisz},
  title        = {Distributed image search in camera sensor networks},
  booktitle    = {Proceedings of the 6th International Conference on Embedded Networked
                  Sensor Systems, SenSys 2008, Raleigh, NC, USA, November 5-7, 2008},
  pages        = {155--168},
  publisher    = {{ACM}},
  year         = {2008},
  url          = {https://doi.org/10.1145/1460412.1460428},
  doi          = {10.1145/1460412.1460428},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sensys/YanGM08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/wiley/Manmatha08,
  author       = {R. Manmatha},
  editor       = {Benjamin W. Wah},
  title        = {Document Image Analysis and Recognition},
  booktitle    = {Wiley Encyclopedia of Computer Science and Engineering},
  publisher    = {John Wiley {\&} Sons, Inc.},
  year         = {2008},
  url          = {https://doi.org/10.1002/9780470050118.ecse667},
  doi          = {10.1002/9780470050118.ECSE667},
  timestamp    = {Tue, 16 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/reference/wiley/Manmatha08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/KornfieldMA07,
  author       = {E. Micah Kornfield and
                  R. Manmatha and
                  James Allan},
  title        = {Further explorations in text alignment with handwritten documents},
  journal      = {Int. J. Document Anal. Recognit.},
  volume       = {10},
  number       = {1},
  pages        = {39--52},
  year         = {2007},
  url          = {https://doi.org/10.1007/s10032-006-0019-8},
  doi          = {10.1007/S10032-006-0019-8},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijdar/KornfieldMA07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/RathM07,
  author       = {Toni M. Rath and
                  R. Manmatha},
  title        = {Word spotting for historical documents},
  journal      = {Int. J. Document Anal. Recognit.},
  volume       = {9},
  number       = {2-4},
  pages        = {139--152},
  year         = {2007},
  url          = {https://doi.org/10.1007/s10032-006-0027-8},
  doi          = {10.1007/S10032-006-0027-8},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijdar/RathM07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdar/RathM07a,
  author       = {Toni M. Rath and
                  R. Manmatha},
  title        = {Word spotting for historical documents},
  journal      = {Int. J. Document Anal. Recognit.},
  volume       = {9},
  number       = {2-4},
  pages        = {299},
  year         = {2007},
  url          = {https://doi.org/10.1007/s10032-006-0035-8},
  doi          = {10.1007/S10032-006-0035-8},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijdar/RathM07a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/accv/KumarJM07,
  author       = {Anand Kumar and
                  C. V. Jawahar and
                  R. Manmatha},
  editor       = {Yasushi Yagi and
                  Sing Bing Kang and
                  In{-}So Kweon and
                  Hongbin Zha},
  title        = {Efficient Search in Document Image Collections},
  booktitle    = {Computer Vision - {ACCV} 2007, 8th Asian Conference on Computer Vision,
                  Tokyo, Japan, November 18-22, 2007, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {4843},
  pages        = {586--595},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-76386-4\_55},
  doi          = {10.1007/978-3-540-76386-4\_55},
  timestamp    = {Tue, 14 May 2019 10:00:50 +0200},
  biburl       = {https://dblp.org/rec/conf/accv/KumarJM07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/das/RothfederMR06,
  author       = {Jamie L. Rothfeder and
                  R. Manmatha and
                  Toni M. Rath},
  editor       = {Horst Bunke and
                  A. Lawrence Spitz},
  title        = {Aligning Transcripts to Automatically Segmented Handwritten Manuscripts},
  booktitle    = {Document Analysis Systems VII, 7th International Workshop, {DAS} 2006,
                  Nelson, New Zealand, February 13-15, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3872},
  pages        = {84--95},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11669487\_8},
  doi          = {10.1007/11669487\_8},
  timestamp    = {Tue, 14 May 2019 10:00:52 +0200},
  biburl       = {https://dblp.org/rec/conf/das/RothfederMR06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dial/FengMM06,
  author       = {Shaolei Feng and
                  R. Manmatha and
                  Andrew McCallum},
  title        = {Exploring the Use of Conditional Random Field Models and HMMs for
                  Historical Handwritten Document Recognition},
  booktitle    = {Second International Workshop on Document Image Analysis for Libraries
                  {(DIAL} 2006), 27-28 April 2006, Lyon, France},
  pages        = {30--37},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/DIAL.2006.19},
  doi          = {10.1109/DIAL.2006.19},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dial/FengMM06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dmin/XieNRH06,
  author       = {Ying Xie and
                  Manmathasivaram Nagarajan and
                  Vijay V. Raghavan and
                  Hisham Haddad},
  editor       = {Sven F. Crone and
                  Stefan Lessmann and
                  Robert Stahlbock},
  title        = {On Novelty Evaluation of Potentially Useful Patterns},
  booktitle    = {Proceedings of the 2006 International Conference on Data Mining, {DMIN}
                  2006, Las Vegas, Nevada, USA, June 26-29, 2006},
  pages        = {211--217},
  publisher    = {{CSREA} Press},
  year         = {2006},
  timestamp    = {Mon, 28 Sep 2015 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dmin/XieNRH06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jcdl/FengM06,
  author       = {Shaolei Feng and
                  R. Manmatha},
  editor       = {Gary Marchionini and
                  Michael L. Nelson and
                  Catherine C. Marshall},
  title        = {A hierarchical, HMM-based automatic evaluation of {OCR} accuracy for
                  a digital library of books},
  booktitle    = {{ACM/IEEE} Joint Conference on Digital Libraries, {JCDL} 2006, Chapel
                  Hill, NC, USA, June 11-15, 2006, Proceedings},
  pages        = {109--118},
  publisher    = {{ACM}},
  year         = {2006},
  url          = {https://doi.org/10.1145/1141753.1141776},
  doi          = {10.1145/1141753.1141776},
  timestamp    = {Wed, 16 Oct 2019 14:14:56 +0200},
  biburl       = {https://dblp.org/rec/conf/jcdl/FengM06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/ManmathaR05,
  author       = {R. Manmatha and
                  Jamie L. Rothfeder},
  title        = {A Scale Space Approach for Automatically Segmenting Words from Historical
                  Handwritten Documents},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {27},
  number       = {8},
  pages        = {1212--1225},
  year         = {2005},
  url          = {https://doi.org/10.1109/TPAMI.2005.150},
  doi          = {10.1109/TPAMI.2005.150},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/ManmathaR05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ManmathaRH05,
  author       = {Raghavan Manmatha and
                  Stefan M. R{\"{u}}ger and
                  Alexander G. Hauptmann},
  title        = {Multimedia information retrieval: workshop report},
  journal      = {{SIGIR} Forum},
  volume       = {39},
  number       = {2},
  pages        = {40--41},
  year         = {2005},
  url          = {https://doi.org/10.1145/1113343.1113352},
  doi          = {10.1145/1113343.1113352},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sigir/ManmathaRH05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/MohantyRLM05,
  author       = {Natasha Mohanty and
                  Toni M. Rath and
                  Audrey Lee and
                  R. Manmatha},
  editor       = {Wee Kheng Leow and
                  Michael S. Lew and
                  Tat{-}Seng Chua and
                  Wei{-}Ying Ma and
                  Lekha Chaisorn and
                  Erwin M. Bakker},
  title        = {Learning Shapes for Image Classification and Retrieval},
  booktitle    = {Image and Video Retrieval, 4th International Conference, {CIVR} 2005,
                  Singapore, July 20-22, 2005, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3568},
  pages        = {589--598},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11526346\_62},
  doi          = {10.1007/11526346\_62},
  timestamp    = {Tue, 14 May 2019 10:00:44 +0200},
  biburl       = {https://dblp.org/rec/conf/civr/MohantyRLM05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/ChangMC05,
  author       = {Shih{-}Fu Chang and
                  R. Manmatha and
                  Tat{-}Seng Chua},
  title        = {Combining text and audio-visual features in video indexing},
  booktitle    = {2005 {IEEE} International Conference on Acoustics, Speech, and Signal
                  Processing, {ICASSP} '05, Philadelphia, Pennsylvania, USA, March 18-23,
                  2005},
  pages        = {1005--1008},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICASSP.2005.1416476},
  doi          = {10.1109/ICASSP.2005.1416476},
  timestamp    = {Mon, 22 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/ChangMC05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/FengM05,
  author       = {Shaolei Feng and
                  Raghavan Manmatha},
  title        = {Classification Models for Historical Manuscript Recognition},
  booktitle    = {Eighth International Conference on Document Analysis and Recognition
                  {(ICDAR} 2005), 29 August - 1 September 2005, Seoul, Korea},
  pages        = {528--532},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICDAR.2005.73},
  doi          = {10.1109/ICDAR.2005.73},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/FengM05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/IyengarDFIKKKMNPPV05,
  author       = {Giridharan Iyengar and
                  Pinar Duygulu and
                  Shaolei Feng and
                  Pavel Ircing and
                  Sanjeev Khudanpur and
                  Dietrich Klakow and
                  M. R. Krause and
                  Raghavan Manmatha and
                  Harriet J. Nock and
                  D. Petkova and
                  Brock Pytlik and
                  Paola Virga},
  editor       = {HongJiang Zhang and
                  Tat{-}Seng Chua and
                  Ralf Steinmetz and
                  Mohan S. Kankanhalli and
                  Lynn Wilcox},
  title        = {Joint visual-text modeling for automatic retrieval of multimedia documents},
  booktitle    = {Proceedings of the 13th {ACM} International Conference on Multimedia,
                  Singapore, November 6-11, 2005},
  pages        = {21--30},
  publisher    = {{ACM}},
  year         = {2005},
  url          = {https://doi.org/10.1145/1101149.1101154},
  doi          = {10.1145/1101149.1101154},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mm/IyengarDFIKKKMNPPV05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/HoweRM05,
  author       = {Nicholas R. Howe and
                  Toni M. Rath and
                  R. Manmatha},
  editor       = {Ricardo A. Baeza{-}Yates and
                  Nivio Ziviani and
                  Gary Marchionini and
                  Alistair Moffat and
                  John Tait},
  title        = {Boosted decision trees for word recognition in handwritten document
                  retrieval},
  booktitle    = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR}
                  Conference on Research and Development in Information Retrieval, Salvador,
                  Brazil, August 15-19, 2005},
  pages        = {377--383},
  publisher    = {{ACM}},
  year         = {2005},
  url          = {https://doi.org/10.1145/1076034.1076099},
  doi          = {10.1145/1076034.1076099},
  timestamp    = {Tue, 06 Nov 2018 11:07:23 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/HoweRM05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/JeonM04,
  author       = {Jiwoon Jeon and
                  R. Manmatha},
  title        = {Using Maximum Entropy for Automatic Image Annotation},
  booktitle    = {Image and Video Retrieval: Third International Conference, {CIVR}
                  2004, Dublin, Ireland, July 21-23, 2004. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3115},
  pages        = {24--32},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-27814-6\_7},
  doi          = {10.1007/978-3-540-27814-6\_7},
  timestamp    = {Tue, 14 May 2019 10:00:44 +0200},
  biburl       = {https://dblp.org/rec/conf/civr/JeonM04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/civr/MetzlerM04,
  author       = {Donald Metzler and
                  R. Manmatha},
  title        = {An Inference Network Approach to Image Retrieval},
  booktitle    = {Image and Video Retrieval: Third International Conference, {CIVR}
                  2004, Dublin, Ireland, July 21-23, 2004. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3115},
  pages        = {42--50},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-27814-6\_9},
  doi          = {10.1007/978-3-540-27814-6\_9},
  timestamp    = {Tue, 23 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/civr/MetzlerM04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/FengML04,
  author       = {Shaolei Feng and
                  Raghavan Manmatha and
                  Victor Lavrenko},
  title        = {Multiple Bernoulli Relevance Models for Image and Video Annotation},
  booktitle    = {2004 {IEEE} Computer Society Conference on Computer Vision and Pattern
                  Recognition {(CVPR} 2004), with CD-ROM, 27 June - 2 July 2004, Washington,
                  DC, {USA}},
  pages        = {1002--1009},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.ieeecomputersociety.org/10.1109/CVPR.2004.171},
  doi          = {10.1109/CVPR.2004.171},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/FengML04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dial/KornfieldMA04,
  author       = {E. Micah Kornfield and
                  R. Manmatha and
                  James Allan},
  title        = {Text Alignment with Handwritten Documents},
  booktitle    = {1st International Workshop on Document Image Analysis for Libraries
                  {(DIAL} 2004), 23-24 January 2004, Palo Alto, CA, {USA}},
  pages        = {195--211},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/DIAL.2004.1263249},
  doi          = {10.1109/DIAL.2004.1263249},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dial/KornfieldMA04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dial/LavrenkoRM04,
  author       = {Victor Lavrenko and
                  Toni M. Rath and
                  R. Manmatha},
  title        = {Holistic Word Recognition for Handwritten Historical Documents},
  booktitle    = {1st International Workshop on Document Image Analysis for Libraries
                  {(DIAL} 2004), 23-24 January 2004, Palo Alto, CA, {USA}},
  pages        = {278--287},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/DIAL.2004.1263256},
  doi          = {10.1109/DIAL.2004.1263256},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dial/LavrenkoRM04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/LavrenkoFM04,
  author       = {Victor Lavrenko and
                  Shaolei Feng and
                  Raghavan Manmatha},
  title        = {Statistical models for automatic video annotation and retrieval},
  booktitle    = {2004 {IEEE} International Conference on Acoustics, Speech, and Signal
                  Processing, {ICASSP} 2004, Montreal, Quebec, Canada, May 17-21, 2004},
  pages        = {1044--1047},
  publisher    = {{IEEE}},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICASSP.2004.1326727},
  doi          = {10.1109/ICASSP.2004.1326727},
  timestamp    = {Mon, 22 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/LavrenkoFM04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RathML04,
  author       = {Toni M. Rath and
                  R. Manmatha and
                  Victor Lavrenko},
  editor       = {Mark Sanderson and
                  Kalervo J{\"{a}}rvelin and
                  James Allan and
                  Peter Bruza},
  title        = {A search engine for historical manuscript images},
  booktitle    = {{SIGIR} 2004: Proceedings of the 27th Annual International {ACM} {SIGIR}
                  Conference on Research and Development in Information Retrieval, Sheffield,
                  UK, July 25-29, 2004},
  pages        = {369--376},
  publisher    = {{ACM}},
  year         = {2004},
  url          = {https://doi.org/10.1145/1008992.1009056},
  doi          = {10.1145/1008992.1009056},
  timestamp    = {Tue, 06 Nov 2018 11:07:22 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/RathML04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
  author       = {James Allan and
                  Jay Aslam and
                  Nicholas J. Belkin and
                  Chris Buckley and
                  James P. Callan and
                  W. Bruce Croft and
                  Susan T. Dumais and
                  Norbert Fuhr and
                  Donna Harman and
                  David J. Harper and
                  Djoerd Hiemstra and
                  Thomas Hofmann and
                  Eduard H. Hovy and
                  Wessel Kraaij and
                  John D. Lafferty and
                  Victor Lavrenko and
                  David D. Lewis and
                  Liz Liddy and
                  R. Manmatha and
                  Andrew McCallum and
                  Jay M. Ponte and
                  John M. Prager and
                  Dragomir R. Radev and
                  Philip Resnik and
                  Stephen E. Robertson and
                  Ronald Rosenfeld and
                  Salim Roukos and
                  Mark Sanderson and
                  Richard M. Schwartz and
                  Amit Singhal and
                  Alan F. Smeaton and
                  Howard R. Turtle and
                  Ellen M. Voorhees and
                  Ralph M. Weischedel and
                  Jinxi Xu and
                  ChengXiang Zhai},
  title        = {Challenges in information retrieval and language modeling: report
                  of a workshop held at the center for intelligent information retrieval,
                  University of Massachusetts Amherst, September 2002},
  journal      = {{SIGIR} Forum},
  volume       = {37},
  number       = {1},
  pages        = {31--47},
  year         = {2003},
  url          = {https://doi.org/10.1145/945546.945549},
  doi          = {10.1145/945546.945549},
  timestamp    = {Sun, 22 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/RathM03,
  author       = {Toni M. Rath and
                  R. Manmatha},
  title        = {Word Image Matching Using Dynamic Time Warping},
  booktitle    = {2003 {IEEE} Computer Society Conference on Computer Vision and Pattern
                  Recognition {(CVPR} 2003), 16-22 June 2003, Madison, WI, {USA}},
  pages        = {521--527},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/CVPR.2003.1211511},
  doi          = {10.1109/CVPR.2003.1211511},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/RathM03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdar/RathM03,
  author       = {Toni M. Rath and
                  R. Manmatha},
  title        = {Features for Word Spotting in Historical Manuscripts},
  booktitle    = {7th International Conference on Document Analysis and Recognition
                  {(ICDAR} 2003), 2-Volume Set, 3-6 August 2003, Edinburgh, Scotland,
                  {UK}},
  pages        = {218--222},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/ICDAR.2003.1227662},
  doi          = {10.1109/ICDAR.2003.1227662},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icdar/RathM03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnp/HannaLM03,
  author       = {Katrina M. Hanna and
                  Brian Neil Levine and
                  R. Manmatha},
  title        = {Mobile Distributed Information Retrieval for Highly-Partitioned Networks},
  booktitle    = {11th {IEEE} International Conference on Network Protocols {(ICNP}
                  2003), 4-7 November 2003, Atlanta, GA, {USA}},
  pages        = {38},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/ICNP.2003.1249755},
  doi          = {10.1109/ICNP.2003.1249755},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icnp/HannaLM03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nips/LavrenkoMJ03,
  author       = {Victor Lavrenko and
                  R. Manmatha and
                  Jiwoon Jeon},
  editor       = {Sebastian Thrun and
                  Lawrence K. Saul and
                  Bernhard Sch{\"{o}}lkopf},
  title        = {A Model for Learning the Semantics of Pictures},
  booktitle    = {Advances in Neural Information Processing Systems 16 [Neural Information
                  Processing Systems, {NIPS} 2003, December 8-13, 2003, Vancouver and
                  Whistler, British Columbia, Canada]},
  pages        = {553--560},
  publisher    = {{MIT} Press},
  year         = {2003},
  url          = {https://proceedings.neurips.cc/paper/2003/hash/0bf727e907c5fc9d5356f11e4c45d613-Abstract.html},
  timestamp    = {Mon, 16 May 2022 15:41:51 +0200},
  biburl       = {https://dblp.org/rec/conf/nips/LavrenkoMJ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/JeonLM03,
  author       = {Jiwoon Jeon and
                  Victor Lavrenko and
                  R. Manmatha},
  editor       = {Charles L. A. Clarke and
                  Gordon V. Cormack and
                  Jamie Callan and
                  David Hawking and
                  Alan F. Smeaton},
  title        = {Automatic image annotation and retrieval using cross-media relevance
                  models},
  booktitle    = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
                  Conference on Research and Development in Information Retrieval, July
                  28 - August 1, 2003, Toronto, Canada},
  pages        = {119--126},
  publisher    = {{ACM}},
  year         = {2003},
  url          = {https://doi.org/10.1145/860435.860459},
  doi          = {10.1145/860435.860459},
  timestamp    = {Tue, 06 Nov 2018 11:07:23 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/JeonLM03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ManmathaFA02,
  author       = {R. Manmatha and
                  Ao Feng and
                  James Allan},
  editor       = {Kalervo J{\"{a}}rvelin and
                  Micheline Beaulieu and
                  Ricardo A. Baeza{-}Yates and
                  Sung{-}Hyon Myaeng},
  title        = {A critical examination of TDT's cost function},
  booktitle    = {{SIGIR} 2002: Proceedings of the 25th Annual International {ACM} {SIGIR}
                  Conference on Research and Development in Information Retrieval, August
                  11-15, 2002, Tampere, Finland},
  pages        = {403--404},
  publisher    = {{ACM}},
  year         = {2002},
  url          = {https://doi.org/10.1145/564376.564465},
  doi          = {10.1145/564376.564465},
  timestamp    = {Wed, 07 Nov 2018 14:52:44 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/ManmathaFA02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/DasM01,
  author       = {Madirakshi Das and
                  R. Manmatha},
  title        = {Automatic Segmentation and Indexing in a Database of Bird Images},
  booktitle    = {Proceedings of the Eighth International Conference On Computer Vision
                  (ICCV-01), Vancouver, British Columbia, Canada, July 7-14, 2001 -
                  Volume 2},
  pages        = {351--358},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://doi.org/10.1109/ICCV.2001.937647},
  doi          = {10.1109/ICCV.2001.937647},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/DasM01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ManmathaRF01,
  author       = {R. Manmatha and
                  Toni M. Rath and
                  Fangfang Feng},
  editor       = {W. Bruce Croft and
                  David J. Harper and
                  Donald H. Kraft and
                  Justin Zobel},
  title        = {Modeling Score Distributions for Combining the Outputs of Search Engines},
  booktitle    = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
                  Conference on Research and Development in Information Retrieval, September
                  9-13, 2001, New Orleans, Louisiana, {USA}},
  pages        = {267--275},
  publisher    = {{ACM}},
  year         = {2001},
  url          = {https://doi.org/10.1145/383952.384005},
  doi          = {10.1145/383952.384005},
  timestamp    = {Tue, 06 Nov 2018 11:07:24 +0100},
  biburl       = {https://dblp.org/rec/conf/sigir/ManmathaRF01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/expert/DasMR99,
  author       = {Madirakshi Das and
                  R. Manmatha and
                  Edward M. Riseman},
  title        = {Indexing Flower Patent Images Using Domain Knowledge},
  journal      = {{IEEE} Intell. Syst.},
  volume       = {14},
  number       = {5},
  pages        = {24--33},
  year         = {1999},
  url          = {https://doi.org/10.1109/5254.796084},
  doi          = {10.1109/5254.796084},
  timestamp    = {Fri, 06 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/expert/DasMR99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/WuMR99,
  author       = {Victor Wu and
                  R. Manmatha and
                  Edward M. Riseman},
  title        = {TextFinder: An Automatic System to Detect and Recognize Text In Images},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {21},
  number       = {11},
  pages        = {1224--1229},
  year         = {1999},
  url          = {https://doi.org/10.1109/34.809116},
  doi          = {10.1109/34.809116},
  timestamp    = {Wed, 17 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pami/WuMR99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR99,
  author       = {Rohini K. Srihari and
                  Zhongfei Zhang and
                  R. Manmatha and
                  Chandu Ravela},
  title        = {Indexing and Retrieval, SIGIR'99 Workshop Summary},
  journal      = {{SIGIR} Forum},
  volume       = {33},
  number       = {1},
  pages        = {34--35},
  year         = {1999},
  url          = {https://doi.org/10.1145/331403.331412},
  doi          = {10.1145/331403.331412},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sigir/SrihariZMR99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/scalespace/ManmathaS99,
  author       = {R. Manmatha and
                  Nitin Srimal},
  editor       = {Mads Nielsen and
                  Peter Johansen and
                  Ole Fogh Olsen and
                  Joachim Weickert},
  title        = {Scale Space Technique for Word Segmentation in Handwritten Documents},
  booktitle    = {Scale-Space Theories in Computer Vision, Second International Conference,
                  Scale-Space'99, Corfu, Greece, September 26-27, 1999, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1682},
  pages        = {22--33},
  publisher    = {Springer},
  year         = {1999},
  url          = {https://doi.org/10.1007/3-540-48236-9\_3},
  doi          = {10.1007/3-540-48236-9\_3},
  timestamp    = {Tue, 14 May 2019 10:00:52 +0200},
  biburl       = {https://dblp.org/rec/conf/scalespace/ManmathaS99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR98,
  author       = {Rohini K. Srihari and
                  Zhongfei Zhang and
                  R. Manmatha and
                  Chandu Ravela},
  title        = {Multimedia Indexing and Retrieval, Summary Report},
  journal      = {{SIGIR} Forum},
  volume       = {32},
  number       = {2},
  pages        = {29--30},
  year         = {1998},
  url          = {https://doi.org/10.1145/305110.305130},
  doi          = {10.1145/305110.305130},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sigir/SrihariZMR98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/drr/WuM98,
  author       = {Victor Wu and
                  Raghavan Manmatha},
  editor       = {Daniel P. Lopresti and
                  Jiangying Zhou},
  title        = {Document image cleanup and binarization},
  booktitle    = {Document Recognition V, San Jose, CA, USA, January 24, 1998},
  series       = {{SPIE} Proceedings},
  volume       = {3305},
  pages        = {263},
  publisher    = {{SPIE}},
  year         = {1998},
  url          = {https://doi.org/10.1117/12.304638},
  doi          = {10.1117/12.304638},
  timestamp    = {Wed, 24 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/drr/WuM98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hvei/ManmathaRC98,
  author       = {Raghavan Manmatha and
                  S. Chandu Ravela and
                  Y. Chitti},
  editor       = {Bernice E. Rogowitz and
                  Thrasyvoulos N. Pappas},
  title        = {Computing local and global similarity in images},
  booktitle    = {Human Vision and Electronic Imaging III, San Jose, CA, USA, January
                  24, 1998},
  series       = {{SPIE} Proceedings},
  volume       = {3299},
  pages        = {540--551},
  publisher    = {{SPIE}},
  year         = {1998},
  url          = {https://doi.org/10.1117/12.320145},
  doi          = {10.1117/12.320145},
  timestamp    = {Sun, 21 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hvei/ManmathaRC98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/RavelaM98,
  author       = {Srinivas Ravela and
                  R. Manmatha},
  title        = {Retrieving Images by Appearance},
  booktitle    = {Proceedings of the Sixth International Conference on Computer Vision
                  (ICCV-98), Bombay, India, January 4-7, 1998},
  pages        = {608--613},
  publisher    = {{IEEE} Computer Society},
  year         = {1998},
  url          = {https://doi.org/10.1109/ICCV.1998.710780},
  doi          = {10.1109/ICCV.1998.710780},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/RavelaM98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/DasMR98,
  author       = {Madirakshi Das and
                  Raghavan Manmatha and
                  Edward M. Riseman},
  title        = {Indexing flowers by color names using domain knowledge-driven segmentation},
  booktitle    = {Proceedings Fourth {IEEE} Workshop on Applications of Computer Vision,
                  {WACV} 1998, October 19-21, 1998, Princeton, New Jersey, {USA}},
  pages        = {94--99},
  publisher    = {{IEEE} Computer Society},
  year         = {1998},
  url          = {https://doi.org/10.1109/ACV.1998.732864},
  doi          = {10.1109/ACV.1998.732864},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/wacv/DasMR98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wacv/RavelaM98,
  author       = {Srinivas Ravela and
                  Raghavan Manmatha},
  title        = {On computing global similarity in images},
  booktitle    = {Proceedings Fourth {IEEE} Workshop on Applications of Computer Vision,
                  {WACV} 1998, October 19-21, 1998, Princeton, New Jersey, {USA}},
  pages        = {82--87},
  publisher    = {{IEEE} Computer Society},
  year         = {1998},
  url          = {https://doi.org/10.1109/ACV.1998.732862},
  doi          = {10.1109/ACV.1998.732862},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/wacv/RavelaM98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dl/WuMR97,
  author       = {Victor Wu and
                  R. Manmatha and
                  Edward M. Riseman},
  title        = {Finding Text in Images},
  booktitle    = {Proceedings of the 2nd {ACM} International Conference on Digital Libraries,
                  July 25-28, 1997, Philadelphia, PA, {USA}},
  pages        = {3--12},
  publisher    = {{ACM}},
  year         = {1997},
  url          = {https://doi.org/10.1145/263690.263766},
  doi          = {10.1145/263690.263766},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dl/WuMR97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hvei/ManmathaR97,
  author       = {Raghavan Manmatha and
                  S. Chandu Ravela},
  editor       = {Bernice E. Rogowitz and
                  Thrasyvoulos N. Pappas},
  title        = {Syntactic characterization of appearance and its application to image
                  retrieval},
  booktitle    = {Human Vision and Electronic Imaging II, San Jose, CA, USA, February
                  8, 1997},
  series       = {{SPIE} Proceedings},
  volume       = {3016},
  pages        = {484--495},
  publisher    = {{SPIE}},
  year         = {1997},
  url          = {https://doi.org/10.1117/12.274546},
  doi          = {10.1117/12.274546},
  timestamp    = {Sun, 21 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hvei/ManmathaR97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RavelaM97,
  author       = {Srinivas Ravela and
                  R. Manmatha},
  editor       = {Nicholas J. Belkin and
                  Arcot Desai Narasimhalu and
                  Peter Willett and
                  William R. Hersh and
                  Fazli Can and
                  Ellen M. Voorhees},
  title        = {Image Retrieval by Appearance},
  booktitle    = {{SIGIR} '97: Proceedings of the 20th Annual International {ACM} {SIGIR}
                  Conference on Research and Development in Information Retrieval, July
                  27-31, 1997, Philadelphia, PA, {USA}},
  pages        = {278--285},
  publisher    = {{ACM}},
  year         = {1997},
  url          = {https://doi.org/10.1145/258525.258589},
  doi          = {10.1145/258525.258589},
  timestamp    = {Tue, 19 Sep 2023 11:58:25 +0200},
  biburl       = {https://dblp.org/rec/conf/sigir/RavelaM97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ManmathaHR96,
  author       = {R. Manmatha and
                  Chengfeng Han and
                  Edward M. Riseman},
  title        = {Word Spotting: {A} New Approach to Indexing Handwriting},
  booktitle    = {1996 Conference on Computer Vision and Pattern Recognition {(CVPR}
                  '96), June 18-20, 1996 San Francisco, CA, {USA}},
  pages        = {631--637},
  publisher    = {{IEEE} Computer Society},
  year         = {1996},
  url          = {https://doi.org/10.1109/CVPR.1996.517139},
  doi          = {10.1109/CVPR.1996.517139},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/ManmathaHR96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dl/ManmathaHRC96,
  author       = {R. Manmatha and
                  Chengfeng Han and
                  Edward M. Riseman and
                  W. Bruce Croft},
  title        = {Indexing Handwriting Using Word Matching},
  booktitle    = {Proceedings of the 1st {ACM} International Conference on Digital Libraries,
                  March 20-23, 1996, Bethesda, Maryland, {USA}},
  pages        = {151--159},
  publisher    = {{ACM}},
  year         = {1996},
  url          = {https://doi.org/10.1145/226931.226960},
  doi          = {10.1145/226931.226960},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dl/ManmathaHRC96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/RavelaMR96,
  author       = {Srinivas Ravela and
                  R. Manmatha and
                  Edward M. Riseman},
  editor       = {Bernard F. Buxton and
                  Roberto Cipolla},
  title        = {Image Retrieval Using Scale-Space Matching},
  booktitle    = {Computer Vision - ECCV'96, 4th European Conference on Computer Vision,
                  Cambridge, UK, April 15-18, 1996, Proceedings, Volume {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {1064},
  pages        = {273--282},
  publisher    = {Springer},
  year         = {1996},
  url          = {https://doi.org/10.1007/BFb0015543},
  doi          = {10.1007/BFB0015543},
  timestamp    = {Tue, 14 May 2019 10:00:45 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/RavelaMR96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Manmatha94,
  author       = {R. Manmatha},
  title        = {A framework for recovering affine transforms using points, lines or
                  image brightnesses},
  booktitle    = {Conference on Computer Vision and Pattern Recognition, {CVPR} 1994,
                  21-23 June, 1994, Seattle, WA, {USA}},
  pages        = {141--146},
  publisher    = {{IEEE}},
  year         = {1994},
  url          = {https://doi.org/10.1109/CVPR.1994.323821},
  doi          = {10.1109/CVPR.1994.323821},
  timestamp    = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/Manmatha94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/Manmatha94,
  author       = {R. Manmatha},
  editor       = {Jan{-}Olof Eklundh},
  title        = {Measuring the Affine Transform Using Gaussian Filters},
  booktitle    = {Computer Vision - ECCV'94, Third European Conference on Computer Vision,
                  Stockholm, Sweden, May 2-6, 1994, Proceedings, Volume {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {801},
  pages        = {159--164},
  publisher    = {Springer},
  year         = {1994},
  url          = {https://doi.org/10.1007/BFb0028346},
  doi          = {10.1007/BFB0028346},
  timestamp    = {Tue, 14 May 2019 10:00:45 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/Manmatha94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ManmathaO93,
  author       = {Raghavan Manmatha and
                  John Oliensis},
  title        = {Extracting affine deformations from image patches. I. Finding scale
                  and rotation},
  booktitle    = {Conference on Computer Vision and Pattern Recognition, {CVPR} 1993,
                  15-17 June, 1993, New York, NY, {USA}},
  pages        = {754--755},
  publisher    = {{IEEE}},
  year         = {1993},
  url          = {https://doi.org/10.1109/CVPR.1993.341158},
  doi          = {10.1109/CVPR.1993.341158},
  timestamp    = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/ManmathaO93.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/DuttaMWR89,
  author       = {Rabindranath Dutta and
                  R. Manmatha and
                  Lance R. Williams and
                  Edward M. Riseman},
  title        = {A data set for quantitative motion analysis},
  booktitle    = {{IEEE} Computer Society Conference on Computer Vision and Pattern
                  Recognition, {CVPR} 1989, 4-8 June, 1989, San Diego, CA, {USA}},
  pages        = {159--164},
  publisher    = {{IEEE}},
  year         = {1989},
  url          = {https://doi.org/10.1109/CVPR.1989.37844},
  doi          = {10.1109/CVPR.1989.37844},
  timestamp    = {Tue, 30 Mar 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/DuttaMWR89.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}