default search action
Search dblp for Publications
export results for "R. Manmatha"
@article{DBLP:journals/pami/ZhuZWZHZMLS24, author = {Yi Zhu and Zhongyue Zhang and Chongruo Wu and Zhi Zhang and Tong He and Hang Zhang and R. Manmatha and Mu Li and Alexander J. Smola}, title = {Improving Semantic Segmentation via Efficient Self-Training}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {46}, number = {3}, pages = {1589--1602}, year = {2024}, url = {https://doi.org/10.1109/TPAMI.2021.3138337}, doi = {10.1109/TPAMI.2021.3138337}, timestamp = {Thu, 29 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/ZhuZWZHZMLS24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/AppalarajuTDSZM24, author = {Srikar Appalaraju and Peng Tang and Qi Dong and Nishant Sankaran and Yichu Zhou and R. Manmatha}, editor = {Michael J. Wooldridge and Jennifer G. Dy and Sriraam Natarajan}, title = {DocFormerv2: Local Features for Document Understanding}, booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI} 2024, Thirty-Sixth Conference on Innovative Applications of Artificial Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver, Canada}, pages = {709--718}, publisher = {{AAAI} Press}, year = {2024}, url = {https://doi.org/10.1609/aaai.v38i2.27828}, doi = {10.1609/AAAI.V38I2.27828}, timestamp = {Tue, 02 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aaai/AppalarajuTDSZM24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/ZhaoSATMMW24, author = {Tianyang Zhao and Kunwar Yashraj Singh and Srikar Appalaraju and Peng Tang and Vijay Mahadevan and R. Manmatha and Ying Nian Wu}, editor = {Michael J. Wooldridge and Jennifer G. Dy and Sriraam Natarajan}, title = {No Head Left Behind - Multi-Head Alignment Distillation for Transformers}, booktitle = {Thirty-Eighth {AAAI} Conference on Artificial Intelligence, {AAAI} 2024, Thirty-Sixth Conference on Innovative Applications of Artificial Intelligence, {IAAI} 2024, Fourteenth Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2014, February 20-27, 2024, Vancouver, Canada}, pages = {7514--7524}, publisher = {{AAAI} Press}, year = {2024}, url = {https://doi.org/10.1609/aaai.v38i7.28583}, doi = {10.1609/AAAI.V38I7.28583}, timestamp = {Tue, 02 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/aaai/ZhaoSATMMW24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/LiZWMXMSTES24, author = {Hao Li and Yang Zou and Ying Wang and Orchid Majumder and Yusheng Xie and R. Manmatha and Ashwin Swaminathan and Zhuowen Tu and Stefano Ermon and Stefano Soatto}, title = {On the Scalability of Diffusion-based Text-to-Image Generation}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2024, Seattle, WA, USA, June 16-22, 2024}, pages = {9400--9409}, publisher = {{IEEE}}, year = {2024}, url = {https://doi.org/10.1109/CVPR52733.2024.00898}, doi = {10.1109/CVPR52733.2024.00898}, timestamp = {Wed, 02 Oct 2024 09:45:16 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/LiZWMXMSTES24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdar/MondalMMJ24, author = {Ajoy Mondal and Vijay Mahadevan and R. Manmatha and C. V. Jawahar}, editor = {Elisa H. Barney Smith and Marcus Liwicki and Liangrui Peng}, title = {{ICDAR} 2024 Competition on Recognition and {VQA} on Handwritten Documents}, booktitle = {Document Analysis and Recognition - {ICDAR} 2024 - 18th International Conference, Athens, Greece, August 30 - September 4, 2024, Proceedings, Part {VI}}, series = {Lecture Notes in Computer Science}, volume = {14809}, pages = {426--442}, publisher = {Springer}, year = {2024}, url = {https://doi.org/10.1007/978-3-031-70552-6\_26}, doi = {10.1007/978-3-031-70552-6\_26}, timestamp = {Tue, 17 Sep 2024 09:34:32 +0200}, biburl = {https://dblp.org/rec/conf/icdar/MondalMMJ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/TangAMXM24, author = {Peng Tang and Srikar Appalaraju and R. Manmatha and Yusheng Xie and Vijay Mahadevan}, editor = {Yi Yang and Aida Davani and Avi Sil and Anoop Kumar}, title = {Multiple-Question Multiple-Answer Text-VQA}, booktitle = {Proceedings of the 2024 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies: Industry Track, {NAACL} 2024, Mexico City, Mexico, June 16-21, 2024}, pages = {73--88}, publisher = {Association for Computational Linguistics}, year = {2024}, url = {https://doi.org/10.18653/v1/2024.naacl-industry.7}, doi = {10.18653/V1/2024.NAACL-INDUSTRY.7}, timestamp = {Thu, 12 Sep 2024 13:29:32 +0200}, biburl = {https://dblp.org/rec/conf/naacl/TangAMXM24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/naacl/TangZLAMM24, author = {Peng Tang and Pengkai Zhu and Tian Li and Srikar Appalaraju and Vijay Mahadevan and R. Manmatha}, editor = {Kevin Duh and Helena G{\'{o}}mez{-}Adorno and Steven Bethard}, title = {{DEED:} Dynamic Early Exit on Decoder for Accelerating Encoder-Decoder Transformer Models}, booktitle = {Findings of the Association for Computational Linguistics: {NAACL} 2024, Mexico City, Mexico, June 16-21, 2024}, pages = {116--131}, publisher = {Association for Computational Linguistics}, year = {2024}, url = {https://doi.org/10.18653/v1/2024.findings-naacl.9}, doi = {10.18653/V1/2024.FINDINGS-NAACL.9}, timestamp = {Thu, 12 Sep 2024 13:29:32 +0200}, biburl = {https://dblp.org/rec/conf/naacl/TangZLAMM24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2404-02883, author = {Hao Li and Yang Zou and Ying Wang and Orchid Majumder and Yusheng Xie and R. Manmatha and Ashwin Swaminathan and Zhuowen Tu and Stefano Ermon and Stefano Soatto}, title = {On the Scalability of Diffusion-based Text-to-Image Generation}, journal = {CoRR}, volume = {abs/2404.02883}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2404.02883}, doi = {10.48550/ARXIV.2404.02883}, eprinttype = {arXiv}, eprint = {2404.02883}, timestamp = {Mon, 13 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2404-02883.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2404-04469, author = {Pei Wang and Zhaowei Cai and Hao Yang and Ashwin Swaminathan and R. Manmatha and Stefano Soatto}, title = {Mixed-Query Transformer: {A} Unified Image Segmentation Architecture}, journal = {CoRR}, volume = {abs/2404.04469}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2404.04469}, doi = {10.48550/ARXIV.2404.04469}, eprinttype = {arXiv}, eprint = {2404.04469}, timestamp = {Wed, 15 May 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2404-04469.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2407-12594, author = {Ofir Abramovich and Niv Nayman and Sharon Fogel and Inbal Lavi and Ron Litman and Shahar Tsiper and Royee Tichauer and Srikar Appalaraju and Shai Mazor and R. Manmatha}, title = {VisFocus: Prompt-Guided Vision Encoders for OCR-Free Dense Document Understanding}, journal = {CoRR}, volume = {abs/2407.12594}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2407.12594}, doi = {10.48550/ARXIV.2407.12594}, eprinttype = {arXiv}, eprint = {2407.12594}, timestamp = {Fri, 23 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2407-12594.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2408-09511, author = {Chaofan Tao and Gukyeong Kwon and Varad Gunjal and Hao Yang and Zhaowei Cai and Yonatan Dukler and Ashwin Swaminathan and R. Manmatha and Colin J. Taylor and Stefano Soatto}, title = {{NAVERO:} Unlocking Fine-Grained Semantics for Video-Language Compositionality}, journal = {CoRR}, volume = {abs/2408.09511}, year = {2024}, url = {https://doi.org/10.48550/arXiv.2408.09511}, doi = {10.48550/ARXIV.2408.09511}, eprinttype = {arXiv}, eprint = {2408.09511}, timestamp = {Tue, 24 Sep 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2408-09511.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/LiuDCZSMM23, author = {Jiang Liu and Hui Ding and Zhaowei Cai and Yuting Zhang and Ravi Kumar Satzoda and Vijay Mahadevan and R. Manmatha}, title = {PolyFormer: Referring Image Segmentation as Sequential Polygon Generation}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2023, Vancouver, BC, Canada, June 17-24, 2023}, pages = {18653--18663}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/CVPR52729.2023.01789}, doi = {10.1109/CVPR52729.2023.01789}, timestamp = {Tue, 29 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/LiuDCZSMM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/LiaoRLBZTSMM23, author = {Haofu Liao and Aruni RoyChowdhury and Weijian Li and Ankan Bansal and Yuting Zhang and Zhuowen Tu and Ravi Kumar Satzoda and R. Manmatha and Vijay Mahadevan}, title = {DocTr: Document Transformer for Structured Information Extraction in Documents}, booktitle = {{IEEE/CVF} International Conference on Computer Vision, {ICCV} 2023, Paris, France, October 1-6, 2023}, pages = {19527--19537}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/ICCV51070.2023.01794}, doi = {10.1109/ICCV51070.2023.01794}, timestamp = {Tue, 23 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/LiaoRLBZTSMM23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2302-03432, author = {Yash Patel and Yusheng Xie and Yi Zhu and Srikar Appalaraju and R. Manmatha}, title = {SimCon Loss with Multiple Views for Text Supervised Semantic Segmentation}, journal = {CoRR}, volume = {abs/2302.03432}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2302.03432}, doi = {10.48550/ARXIV.2302.03432}, eprinttype = {arXiv}, eprint = {2302.03432}, timestamp = {Thu, 15 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2302-03432.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2302-07387, author = {Jiang Liu and Hui Ding and Zhaowei Cai and Yuting Zhang and Ravi Kumar Satzoda and Vijay Mahadevan and R. Manmatha}, title = {PolyFormer: Referring Image Segmentation as Sequential Polygon Generation}, journal = {CoRR}, volume = {abs/2302.07387}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2302.07387}, doi = {10.48550/ARXIV.2302.07387}, eprinttype = {arXiv}, eprint = {2302.07387}, timestamp = {Mon, 20 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2302-07387.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2306-01733, author = {Srikar Appalaraju and Peng Tang and Qi Dong and Nishant Sankaran and Yichu Zhou and R. Manmatha}, title = {DocFormerv2: Local Features for Document Understanding}, journal = {CoRR}, volume = {abs/2306.01733}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2306.01733}, doi = {10.48550/ARXIV.2306.01733}, eprinttype = {arXiv}, eprint = {2306.01733}, timestamp = {Mon, 12 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2306-01733.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2307-07929, author = {Haofu Liao and Aruni RoyChowdhury and Weijian Li and Ankan Bansal and Yuting Zhang and Zhuowen Tu and Ravi Kumar Satzoda and R. Manmatha and Vijay Mahadevan}, title = {DocTr: Document Transformer for Structured Information Extraction in Documents}, journal = {CoRR}, volume = {abs/2307.07929}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2307.07929}, doi = {10.48550/ARXIV.2307.07929}, eprinttype = {arXiv}, eprint = {2307.07929}, timestamp = {Tue, 25 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2307-07929.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2308-02662, author = {Arijit Ghosh and Chandrima Kayal and Manaswi Paraashar and Manmatha Roy}, title = {Linear isomorphism testing of Boolean functions with small approximate spectral norm}, journal = {CoRR}, volume = {abs/2308.02662}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2308.02662}, doi = {10.48550/ARXIV.2308.02662}, eprinttype = {arXiv}, eprint = {2308.02662}, timestamp = {Mon, 21 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2308-02662.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2311-08622, author = {Peng Tang and Srikar Appalaraju and R. Manmatha and Yusheng Xie and Vijay Mahadevan}, title = {Multiple-Question Multiple-Answer Text-VQA}, journal = {CoRR}, volume = {abs/2311.08622}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2311.08622}, doi = {10.48550/ARXIV.2311.08622}, eprinttype = {arXiv}, eprint = {2311.08622}, timestamp = {Tue, 21 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2311-08622.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2311-08623, author = {Peng Tang and Pengkai Zhu and Tian Li and Srikar Appalaraju and Vijay Mahadevan and R. Manmatha}, title = {{DEED:} Dynamic Early Exit on Decoder for Accelerating Encoder-Decoder Transformer Models}, journal = {CoRR}, volume = {abs/2311.08623}, year = {2023}, url = {https://doi.org/10.48550/arXiv.2311.08623}, doi = {10.48550/ARXIV.2311.08623}, eprinttype = {arXiv}, eprint = {2311.08623}, timestamp = {Tue, 21 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2311-08623.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/iacr/ChattopadhyayMMRT23, author = {Anupam Chattopadhyay and Subhamoy Maitra and Bimal Mandal and Manmatha Roy and Deng Tang}, title = {Efficient Hardware Implementation for Maiorana-McFarland type Functions}, journal = {{IACR} Cryptol. ePrint Arch.}, pages = {1970}, year = {2023}, url = {https://eprint.iacr.org/2023/1970}, timestamp = {Wed, 10 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/iacr/ChattopadhyayMMRT23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/0005WZZLZSHMMLS22, author = {Hang Zhang and Chongruo Wu and Zhongyue Zhang and Yi Zhu and Haibin Lin and Zhi Zhang and Yue Sun and Tong He and Jonas Mueller and R. Manmatha and Mu Li and Alexander J. Smola}, title = {ResNeSt: Split-Attention Networks}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition Workshops, {CVPR} Workshops 2022, New Orleans, LA, USA, June 19-20, 2022}, pages = {2735--2745}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CVPRW56347.2022.00309}, doi = {10.1109/CVPRW56347.2022.00309}, timestamp = {Wed, 10 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/0005WZZLZSHMMLS22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/BitenLXAM22, author = {Ali Furkan Biten and Ron Litman and Yusheng Xie and Srikar Appalaraju and R. Manmatha}, title = {LaTr: Layout-Aware Transformer for Scene-Text {VQA}}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022}, pages = {16527--16537}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CVPR52688.2022.01605}, doi = {10.1109/CVPR52688.2022.01605}, timestamp = {Wed, 05 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/BitenLXAM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/KittenplonLFBMP22, author = {Yair Kittenplon and Inbal Lavi and Sharon Fogel and Yarin Bar and R. Manmatha and Pietro Perona}, title = {Towards Weakly-Supervised Text Spotting using a Multi-Task Transformer}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022}, pages = {4594--4603}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CVPR52688.2022.00456}, doi = {10.1109/CVPR52688.2022.00456}, timestamp = {Tue, 04 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/KittenplonLFBMP22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/HoAJMV22, author = {Chih{-}Hui Ho and Srikar Appalaraju and Bhavan Jasani and R. Manmatha and Nuno Vasconcelos}, editor = {Leonid Karlinsky and Tomer Michaeli and Ko Nishino}, title = {{YORO} - Lightweight End to End Visual Grounding}, booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October 23-27, 2022, Proceedings, Part {VIII}}, series = {Lecture Notes in Computer Science}, volume = {13808}, pages = {3--23}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-25085-9\_1}, doi = {10.1007/978-3-031-25085-9\_1}, timestamp = {Thu, 16 Feb 2023 11:51:10 +0100}, biburl = {https://dblp.org/rec/conf/eccv/HoAJMV22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/RonenTALMM22, author = {Roi Ronen and Shahar Tsiper and Oron Anschel and Inbal Lavi and Amir Markovitz and R. Manmatha}, editor = {Shai Avidan and Gabriel J. Brostow and Moustapha Ciss{\'{e}} and Giovanni Maria Farinella and Tal Hassner}, title = {{GLASS:} Global to Local Attention for Scene-Text Spotting}, booktitle = {Computer Vision - {ECCV} 2022 - 17th European Conference, Tel Aviv, Israel, October 23-27, 2022, Proceedings, Part {XXVIII}}, series = {Lecture Notes in Computer Science}, volume = {13688}, pages = {249--266}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-19815-1\_15}, doi = {10.1007/978-3-031-19815-1\_15}, timestamp = {Sun, 13 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/eccv/RonenTALMM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/SlossbergAMLATMWM22, author = {Ron Slossberg and Oron Anschel and Amir Markovitz and Ron Litman and Aviad Aberdam and Shahar Tsiper and Shai Mazor and Jon Wu and R. Manmatha}, editor = {Leonid Karlinsky and Tomer Michaeli and Ko Nishino}, title = {On Calibration of Scene-Text Recognition Models}, booktitle = {Computer Vision - {ECCV} 2022 Workshops - Tel Aviv, Israel, October 23-27, 2022, Proceedings, Part {IV}}, series = {Lecture Notes in Computer Science}, volume = {13804}, pages = {263--279}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-25069-9\_18}, doi = {10.1007/978-3-031-25069-9\_18}, timestamp = {Mon, 20 Feb 2023 17:49:54 +0100}, biburl = {https://dblp.org/rec/conf/eccv/SlossbergAMLATMWM22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/indocrypt/MaitraMR22, author = {Subhamoy Maitra and Bimal Mandal and Manmatha Roy}, editor = {Takanori Isobe and Santanu Sarkar}, title = {Modifying Bent Functions to Obtain the Balanced Ones with High Nonlinearity}, booktitle = {Progress in Cryptology - {INDOCRYPT} 2022 - 23rd International Conference on Cryptology in India, Kolkata, India, December 11-14, 2022, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {13774}, pages = {449--470}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-3-031-22912-1\_20}, doi = {10.1007/978-3-031-22912-1\_20}, timestamp = {Mon, 09 Jan 2023 17:58:33 +0100}, biburl = {https://dblp.org/rec/conf/indocrypt/MaitraMR22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2202-05508, author = {Yair Kittenplon and Inbal Lavi and Sharon Fogel and Yarin Bar and R. Manmatha and Pietro Perona}, title = {Towards Weakly-Supervised Text Spotting using a Multi-Task Transformer}, journal = {CoRR}, volume = {abs/2202.05508}, year = {2022}, url = {https://arxiv.org/abs/2202.05508}, eprinttype = {arXiv}, eprint = {2202.05508}, timestamp = {Fri, 18 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2202-05508.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2208-03364, author = {Roi Ronen and Shahar Tsiper and Oron Anschel and Inbal Lavi and Amir Markovitz and R. Manmatha}, title = {{GLASS:} Global to Local Attention for Scene-Text Spotting}, journal = {CoRR}, volume = {abs/2208.03364}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2208.03364}, doi = {10.48550/ARXIV.2208.03364}, eprinttype = {arXiv}, eprint = {2208.03364}, timestamp = {Wed, 10 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2208-03364.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2211-07912, author = {Chih{-}Hui Ho and Srikar Appalaraju and Bhavan Jasani and R. Manmatha and Nuno Vasconcelos}, title = {{YORO} - Lightweight End to End Visual Grounding}, journal = {CoRR}, volume = {abs/2211.07912}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2211.07912}, doi = {10.48550/ARXIV.2211.07912}, eprinttype = {arXiv}, eprint = {2211.07912}, timestamp = {Sun, 04 Aug 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2211-07912.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/AberdamLTASMMP21, author = {Aviad Aberdam and Ron Litman and Shahar Tsiper and Oron Anschel and Ron Slossberg and Shai Mazor and R. Manmatha and Pietro Perona}, title = {Sequence-to-Sequence Contrastive Learning for Text Recognition}, booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2021, virtual, June 19-25, 2021}, pages = {15302--15312}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2021}, url = {https://openaccess.thecvf.com/content/CVPR2021/html/Aberdam\_Sequence-to-Sequence\_Contrastive\_Learning\_for\_Text\_Recognition\_CVPR\_2021\_paper.html}, doi = {10.1109/CVPR46437.2021.01505}, timestamp = {Mon, 18 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/AberdamLTASMMP21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/AppalarajuJKXM21, author = {Srikar Appalaraju and Bhavan Jasani and Bhargava Urala Kota and Yusheng Xie and R. Manmatha}, title = {DocFormer: End-to-End Transformer for Document Understanding}, booktitle = {2021 {IEEE/CVF} International Conference on Computer Vision, {ICCV} 2021, Montreal, QC, Canada, October 10-17, 2021}, pages = {973--983}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/ICCV48922.2021.00103}, doi = {10.1109/ICCV48922.2021.00103}, timestamp = {Fri, 11 Mar 2022 10:01:27 +0100}, biburl = {https://dblp.org/rec/conf/iccv/AppalarajuJKXM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wacv/PatelAM21, author = {Yash Patel and Srikar Appalaraju and R. Manmatha}, title = {Saliency Driven Perceptual Image Compression}, booktitle = {{IEEE} Winter Conference on Applications of Computer Vision, {WACV} 2021, Waikoloa, HI, USA, January 3-8, 2021}, pages = {227--236}, publisher = {{IEEE}}, year = {2021}, url = {https://doi.org/10.1109/WACV48630.2021.00027}, doi = {10.1109/WACV48630.2021.00027}, timestamp = {Fri, 18 Jun 2021 10:51:54 +0200}, biburl = {https://dblp.org/rec/conf/wacv/PatelAM21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2106-11539, author = {Srikar Appalaraju and Bhavan Jasani and Bhargava Urala Kota and Yusheng Xie and R. Manmatha}, title = {DocFormer: End-to-End Transformer for Document Understanding}, journal = {CoRR}, volume = {abs/2106.11539}, year = {2021}, url = {https://arxiv.org/abs/2106.11539}, eprinttype = {arXiv}, eprint = {2106.11539}, timestamp = {Wed, 30 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-11539.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2112-12494, author = {Ali Furkan Biten and Ron Litman and Yusheng Xie and Srikar Appalaraju and R. Manmatha}, title = {LaTr: Layout-Aware Transformer for Scene-Text {VQA}}, journal = {CoRR}, volume = {abs/2112.12494}, year = {2021}, url = {https://arxiv.org/abs/2112.12494}, eprinttype = {arXiv}, eprint = {2112.12494}, timestamp = {Tue, 04 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2112-12494.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/LitmanATLMM20, author = {Ron Litman and Oron Anschel and Shahar Tsiper and Roee Litman and Shai Mazor and R. Manmatha}, title = {{SCATTER:} Selective Context Attentional Scene Text Recognizer}, booktitle = {2020 {IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2020, Seattle, WA, USA, June 13-19, 2020}, pages = {11959--11969}, publisher = {Computer Vision Foundation / {IEEE}}, year = {2020}, url = {https://openaccess.thecvf.com/content\_CVPR\_2020/html/Litman\_SCATTER\_Selective\_Context\_Attentional\_Scene\_Text\_Recognizer\_CVPR\_2020\_paper.html}, doi = {10.1109/CVPR42600.2020.01198}, timestamp = {Tue, 31 Aug 2021 14:00:04 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/LitmanATLMM20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/space/MaitraMRT20, author = {Subhamoy Maitra and Bimal Mandal and Manmatha Roy and Deng Tang}, editor = {Lejla Batina and Stjepan Picek and Mainack Mondal}, title = {Experimental Results on Higher-Order Differential Spectra of 6 and 8-bit Invertible S-Boxes}, booktitle = {Security, Privacy, and Applied Cryptography Engineering - 10th International Conference, {SPACE} 2020, Kolkata, India, December 17-21, 2020, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {12586}, pages = {226--237}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-3-030-66626-2\_12}, doi = {10.1007/978-3-030-66626-2\_12}, timestamp = {Tue, 05 Jan 2021 17:43:06 +0100}, biburl = {https://dblp.org/rec/conf/space/MaitraMRT20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2002-04988, author = {Yash Patel and Srikar Appalaraju and R. Manmatha}, title = {Hierarchical Auto-Regressive Model for Image Compression Incorporating Object Saliency and a Deep Perceptual Loss}, journal = {CoRR}, volume = {abs/2002.04988}, year = {2020}, url = {https://arxiv.org/abs/2002.04988}, eprinttype = {arXiv}, eprint = {2002.04988}, timestamp = {Fri, 14 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2002-04988.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2003-11288, author = {Ron Litman and Oron Anschel and Shahar Tsiper and Roee Litman and Shai Mazor and R. Manmatha}, title = {{SCATTER:} Selective Context Attentional Scene Text Recognizer}, journal = {CoRR}, volume = {abs/2003.11288}, year = {2020}, url = {https://arxiv.org/abs/2003.11288}, eprinttype = {arXiv}, eprint = {2003.11288}, timestamp = {Wed, 01 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2003-11288.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2004-08955, author = {Hang Zhang and Chongruo Wu and Zhongyue Zhang and Yi Zhu and Zhi Zhang and Haibin Lin and Yue Sun and Tong He and Jonas Mueller and R. Manmatha and Mu Li and Alexander J. Smola}, title = {ResNeSt: Split-Attention Networks}, journal = {CoRR}, volume = {abs/2004.08955}, year = {2020}, url = {https://arxiv.org/abs/2004.08955}, eprinttype = {arXiv}, eprint = {2004.08955}, timestamp = {Wed, 10 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2004-08955.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2004-14960, author = {Yi Zhu and Zhongyue Zhang and Chongruo Wu and Zhi Zhang and Tong He and Hang Zhang and R. Manmatha and Mu Li and Alexander J. Smola}, title = {Improving Semantic Segmentation via Self-Training}, journal = {CoRR}, volume = {abs/2004.14960}, year = {2020}, url = {https://arxiv.org/abs/2004.14960}, eprinttype = {arXiv}, eprint = {2004.14960}, timestamp = {Wed, 10 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2004-14960.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2007-00398, author = {Minesh Mathew and Dimosthenis Karatzas and R. Manmatha and C. V. Jawahar}, title = {DocVQA: {A} Dataset for {VQA} on Document Images}, journal = {CoRR}, volume = {abs/2007.00398}, year = {2020}, url = {https://arxiv.org/abs/2007.00398}, eprinttype = {arXiv}, eprint = {2007.00398}, timestamp = {Mon, 06 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2007-00398.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2008-08899, author = {Minesh Mathew and Rub{\`{e}}n Tito and Dimosthenis Karatzas and R. Manmatha and C. V. Jawahar}, title = {Document Visual Question Answering Challenge 2020}, journal = {CoRR}, volume = {abs/2008.08899}, year = {2020}, url = {https://arxiv.org/abs/2008.08899}, eprinttype = {arXiv}, eprint = {2008.08899}, timestamp = {Fri, 21 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2008-08899.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2012-06567, author = {Yi Zhu and Xinyu Li and Chunhui Liu and Mohammadreza Zolfaghari and Yuanjun Xiong and Chongruo Wu and Zhi Zhang and Joseph Tighe and R. Manmatha and Mu Li}, title = {A Comprehensive Study of Deep Video Action Recognition}, journal = {CoRR}, volume = {abs/2012.06567}, year = {2020}, url = {https://arxiv.org/abs/2012.06567}, eprinttype = {arXiv}, eprint = {2012.06567}, timestamp = {Wed, 10 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2012-06567.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2012-10873, author = {Aviad Aberdam and Ron Litman and Shahar Tsiper and Oron Anschel and Ron Slossberg and Shai Mazor and R. Manmatha and Pietro Perona}, title = {Sequence-to-Sequence Contrastive Learning for Text Recognition}, journal = {CoRR}, volume = {abs/2012.10873}, year = {2020}, url = {https://arxiv.org/abs/2012.10873}, eprinttype = {arXiv}, eprint = {2012.10873}, timestamp = {Mon, 04 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2012-10873.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2012-12643, author = {Ron Slossberg and Oron Anschel and Amir Markovitz and Ron Litman and Aviad Aberdam and Shahar Tsiper and Shai Mazor and Jon Wu and R. Manmatha}, title = {On Calibration of Scene-Text Recognition Models}, journal = {CoRR}, volume = {abs/2012.12643}, year = {2020}, url = {https://arxiv.org/abs/2012.12643}, eprinttype = {arXiv}, eprint = {2012.12643}, timestamp = {Tue, 05 Jan 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2012-12643.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jois/DixitRP19, author = {Anil Kumar Dixit and Manmatha K. Roul and Bikash C. Panda}, title = {Mathematical Model Using Soft Computing Techniques for Different Thermal Insulation Materials}, journal = {J. Intell. Syst.}, volume = {28}, number = {5}, pages = {821--833}, year = {2019}, url = {https://doi.org/10.1515/jisys-2017-0103}, doi = {10.1515/JISYS-2017-0103}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jois/DixitRP19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/YalnizM19, author = {Ismet Zeki Yalniz and R. Manmatha}, title = {Dependence Models for Searching Text in Document Images}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {41}, number = {1}, pages = {49--63}, year = {2019}, url = {https://doi.org/10.1109/TPAMI.2017.2780108}, doi = {10.1109/TPAMI.2017.2780108}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pami/YalnizM19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1907-02244, author = {Son Tran and Ming Du and Sampath Chanda and R. Manmatha and Cj Taylor}, title = {Searching for Apparel Products from Images in the Wild}, journal = {CoRR}, volume = {abs/1907.02244}, year = {2019}, url = {http://arxiv.org/abs/1907.02244}, eprinttype = {arXiv}, eprint = {1907.02244}, timestamp = {Mon, 08 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1907-02244.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1907-08310, author = {Yash Patel and Srikar Appalaraju and R. Manmatha}, title = {Deep Perceptual Compression}, journal = {CoRR}, volume = {abs/1907.08310}, year = {2019}, url = {http://arxiv.org/abs/1907.08310}, eprinttype = {arXiv}, eprint = {1907.08310}, timestamp = {Tue, 23 Jul 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1907-08310.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1908-04187, author = {Yash Patel and Srikar Appalaraju and R. Manmatha}, title = {Human Perceptual Evaluations for Image Compression}, journal = {CoRR}, volume = {abs/1908.04187}, year = {2019}, url = {http://arxiv.org/abs/1908.04187}, eprinttype = {arXiv}, eprint = {1908.04187}, timestamp = {Mon, 19 Aug 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1908-04187.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/WuZHMSK18, author = {Chao{-}Yuan Wu and Manzil Zaheer and Hexiang Hu and R. Manmatha and Alexander J. Smola and Philipp Kr{\"{a}}henb{\"{u}}hl}, title = {Compressed Video Action Recognition}, booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018}, pages = {6026--6035}, publisher = {Computer Vision Foundation / {IEEE} Computer Society}, year = {2018}, url = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Wu\_Compressed\_Video\_Action\_CVPR\_2018\_paper.html}, doi = {10.1109/CVPR.2018.00631}, timestamp = {Sun, 06 Oct 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/WuZHMSK18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/ManmathaWSK17, author = {R. Manmatha and Chao{-}Yuan Wu and Alexander J. Smola and Philipp Kr{\"{a}}henb{\"{u}}hl}, title = {Sampling Matters in Deep Embedding Learning}, booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2017, Venice, Italy, October 22-29, 2017}, pages = {2859--2867}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/ICCV.2017.309}, doi = {10.1109/ICCV.2017.309}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/ManmathaWSK17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/WuMSK17, author = {Chao{-}Yuan Wu and R. Manmatha and Alexander J. Smola and Philipp Kr{\"{a}}henb{\"{u}}hl}, title = {Sampling Matters in Deep Embedding Learning}, journal = {CoRR}, volume = {abs/1706.07567}, year = {2017}, url = {http://arxiv.org/abs/1706.07567}, eprinttype = {arXiv}, eprint = {1706.07567}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/WuMSK17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1712-00636, author = {Chao{-}Yuan Wu and Manzil Zaheer and Hexiang Hu and R. Manmatha and Alexander J. Smola and Philipp Kr{\"{a}}henb{\"{u}}hl}, title = {Compressed Video Action Recognition}, journal = {CoRR}, volume = {abs/1712.00636}, year = {2017}, url = {http://arxiv.org/abs/1712.00636}, eprinttype = {arXiv}, eprint = {1712.00636}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1712-00636.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/MurthySCMC16, author = {Venkatesh N. Murthy and Vivek K. Singh and Terrence Chen and R. Manmatha and Dorin Comaniciu}, title = {Deep Decision Network for Multi-class Image Classification}, booktitle = {2016 {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2016, Las Vegas, NV, USA, June 27-30, 2016}, pages = {2240--2248}, publisher = {{IEEE} Computer Society}, year = {2016}, url = {https://doi.org/10.1109/CVPR.2016.246}, doi = {10.1109/CVPR.2016.246}, timestamp = {Thu, 05 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/MurthySCMC16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/YalnizGM16, author = {Ismet Zeki Yalniz and Douglas Gray and R. Manmatha}, editor = {Gang Hua and Herv{\'{e}} J{\'{e}}gou}, title = {Efficient Exploration of Text Regions in Natural Scene Images Using Adaptive Image Sampling}, booktitle = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands, October 8-10 and 15-16, 2016, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {9913}, pages = {427--439}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-46604-0\_31}, doi = {10.1007/978-3-319-46604-0\_31}, timestamp = {Tue, 14 May 2019 10:00:45 +0200}, biburl = {https://dblp.org/rec/conf/eccv/YalnizGM16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mir/MurthySCM16, author = {Venkatesh N. Murthy and Avinash Sharma and Visesh Chari and R. Manmatha}, editor = {John R. Kender and John R. Smith and Jiebo Luo and Susanne Boll and Winston H. Hsu}, title = {Image Annotation using Multi-scale Hypergraph Heat Diffusion Framework}, booktitle = {Proceedings of the 2016 {ACM} on International Conference on Multimedia Retrieval, {ICMR} 2016, New York, New York, USA, June 6-9, 2016}, pages = {299--303}, publisher = {{ACM}}, year = {2016}, url = {https://doi.org/10.1145/2911996.2912055}, doi = {10.1145/2911996.2912055}, timestamp = {Wed, 18 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mir/MurthySCM16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/HalveyMJRRMK15, author = {Martin Halvey and Philip J. McParlane and Joemon M. Jose and Keith van Rijsbergen and Stefan M. R{\"{u}}ger and R. Manmatha and Mohan S. Kankanhalli}, title = {{ICMR} 2014: 4th {ACM} International Conference on Multimedia Retrieval}, journal = {{SIGIR} Forum}, volume = {49}, number = {1}, pages = {10--15}, year = {2015}, url = {https://doi.org/10.1145/2795403.2795407}, doi = {10.1145/2795403.2795407}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sigir/HalveyMJRRMK15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mir/MurthyMM15, author = {Venkatesh N. Murthy and Subhransu Maji and R. Manmatha}, editor = {Alexander G. Hauptmann and Chong{-}Wah Ngo and Xiangyang Xue and Yu{-}Gang Jiang and Cees Snoek and Nuno Vasconcelos}, title = {Automatic Image Annotation using Deep Learning Representations}, booktitle = {Proceedings of the 5th {ACM} on International Conference on Multimedia Retrieval, Shanghai, China, June 23-26, 2015}, pages = {603--606}, publisher = {{ACM}}, year = {2015}, url = {https://doi.org/10.1145/2671188.2749391}, doi = {10.1145/2671188.2749391}, timestamp = {Tue, 01 Oct 2024 17:31:10 +0200}, biburl = {https://dblp.org/rec/conf/mir/MurthyMM15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijdar/SankarMJ14, author = {K. Pramod Sankar and R. Manmatha and C. V. Jawahar}, title = {Large scale document image retrieval by automatic word annotation}, journal = {Int. J. Document Anal. Recognit.}, volume = {17}, number = {1}, pages = {1--17}, year = {2014}, url = {https://doi.org/10.1007/s10032-013-0207-2}, doi = {10.1007/S10032-013-0207-2}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijdar/SankarMJ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/mva/MoeslundJJM14, author = {Thomas B. Moeslund and Omar Javed and Yu{-}Gang Jiang and R. Manmatha}, title = {Special issue on Multimedia Event Detection}, journal = {Mach. Vis. Appl.}, volume = {25}, number = {1}, pages = {1--4}, year = {2014}, url = {https://doi.org/10.1007/s00138-013-0586-x}, doi = {10.1007/S00138-013-0586-X}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/mva/MoeslundJJM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/das/MotaMFL14, author = {David Fern{\'{a}}ndez Mota and R. Manmatha and Alicia Forn{\'{e}}s and Josep Llad{\'{o}}s}, editor = {Jean{-}Yves Ramel and Marcus Liwicki and Jean{-}Marc Ogier and Koichi Kise and Ray Smith}, title = {Sequential Word Spotting in Historical Handwritten Documents}, booktitle = {11th {IAPR} International Workshop on Document Analysis Systems, {DAS} 2014, Tours, France, April 7-10, 2014}, pages = {101--105}, publisher = {{IEEE} Computer Society}, year = {2014}, url = {https://doi.org/10.1109/DAS.2014.18}, doi = {10.1109/DAS.2014.18}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/das/MotaMFL14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mir/CanM14, author = {Ethem F. Can and R. Manmatha}, editor = {Mohan S. Kankanhalli and Stefan M. R{\"{u}}ger and R. Manmatha and Joemon M. Jose and Keith van Rijsbergen}, title = {Modeling Concept Dependencies for Event Detection}, booktitle = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow, United Kingdom - April 01 - 04, 2014}, pages = {289}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2578726.2578763}, doi = {10.1145/2578726.2578763}, timestamp = {Thu, 15 Jul 2021 17:18:30 +0200}, biburl = {https://dblp.org/rec/conf/mir/CanM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mir/MurthyCM14, author = {Venkatesh N. Murthy and Ethem F. Can and R. Manmatha}, editor = {Mohan S. Kankanhalli and Stefan M. R{\"{u}}ger and R. Manmatha and Joemon M. Jose and Keith van Rijsbergen}, title = {A Hybrid Model for Automatic Image Annotation}, booktitle = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow, United Kingdom - April 01 - 04, 2014}, pages = {369}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2578726.2578774}, doi = {10.1145/2578726.2578774}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mir/MurthyCM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/CanCM14, author = {Ethem F. Can and W. Bruce Croft and R. Manmatha}, editor = {Shlomo Geva and Andrew Trotman and Peter Bruza and Charles L. A. Clarke and Kalervo J{\"{a}}rvelin}, title = {Incorporating query-specific feedback into learning-to-rank models}, booktitle = {The 37th International {ACM} {SIGIR} Conference on Research and Development in Information Retrieval, {SIGIR} '14, Gold Coast , QLD, Australia - July 06 - 11, 2014}, pages = {1035--1038}, publisher = {{ACM}}, year = {2014}, url = {https://doi.org/10.1145/2600428.2609503}, doi = {10.1145/2600428.2609503}, timestamp = {Tue, 06 Nov 2018 11:07:24 +0100}, biburl = {https://dblp.org/rec/conf/sigir/CanCM14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/mir/2014, editor = {Mohan S. Kankanhalli and Stefan M. R{\"{u}}ger and R. Manmatha and Joemon M. Jose and Keith van Rijsbergen}, title = {International Conference on Multimedia Retrieval, {ICMR} '14, Glasgow, United Kingdom - April 01 - 04, 2014}, publisher = {{ACM}}, year = {2014}, url = {http://dl.acm.org/citation.cfm?id=2578726}, isbn = {978-1-4503-2782-4}, timestamp = {Thu, 15 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mir/2014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cikm/CanOM13, author = {Ethem F. Can and H{\"{u}}seyin Oktay and R. Manmatha}, editor = {Qi He and Arun Iyengar and Wolfgang Nejdl and Jian Pei and Rajeev Rastogi}, title = {Predicting retweet count using visual cues}, booktitle = {22nd {ACM} International Conference on Information and Knowledge Management, CIKM'13, San Francisco, CA, USA, October 27 - November 1, 2013}, pages = {1481--1484}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2505515.2507824}, doi = {10.1145/2505515.2507824}, timestamp = {Mon, 19 Aug 2024 08:36:26 +0200}, biburl = {https://dblp.org/rec/conf/cikm/CanOM13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/CanM13, author = {Ethem F. Can and R. Manmatha}, title = {Formulating Action Recognition as a Ranking Problem}, booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} Workshops 2013, Portland, OR, USA, June 23-28, 2013}, pages = {251--256}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/CVPRW.2013.44}, doi = {10.1109/CVPRW.2013.44}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/CanM13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdar/WemhoenerYM13, author = {David Wemhoener and Ismet Zeki Yalniz and R. Manmatha}, title = {Creating an Improved Version Using Noisy {OCR} from Multiple Editions}, booktitle = {12th International Conference on Document Analysis and Recognition, {ICDAR} 2013, Washington, DC, USA, August 25-28, 2013}, pages = {160--164}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/ICDAR.2013.39}, doi = {10.1109/ICDAR.2013.39}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/WemhoenerYM13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trecvid/Allan0FMMW13, author = {James Allan and Jeff Dalton and John Foley and R. Manmatha and Venkatesh N. Murthy and David Wemhoener}, editor = {Paul Over and Jon Fiscus and Gregory A. Sanders and Barbara Shaw and George Awad and Martial Michel and Alan F. Smeaton and Wessel Kraaij and Georges Qu{\'{e}}not}, title = {Short Text Queries for Video Retrieval Multimedia event Detection at {TRECVID} 2013}, booktitle = {2013 {TREC} Video Retrieval Evaluation, {TRECVID} 2013, Gaithersburg, MD, USA, November 20-22, 2013}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2013}, url = {https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/umass.pdf}, timestamp = {Mon, 10 May 2021 15:09:49 +0200}, biburl = {https://dblp.org/rec/conf/trecvid/Allan0FMMW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trecvid/LiuCJYCZDSAMFSD13, author = {Jingen Liu and Hui Cheng and Omar Javed and Qian Yu and Ishani Chakraborty and Weiyu Zhang and Ajay Divakaran and Harpreet S. Sawhney and James Allan and R. Manmatha and John Foley and Mubarak Shah and Afshin Dehghan and Michael Witbrock and Jon Curtis and Gerald Friedland}, editor = {Paul Over and Jon Fiscus and Gregory A. Sanders and Barbara Shaw and George Awad and Martial Michel and Alan F. Smeaton and Wessel Kraaij and Georges Qu{\'{e}}not}, title = {SRI-Sarnoff {AURORA} System at {TRECVID} 2013 Multimedia Event Detection and Recounting}, booktitle = {2013 {TREC} Video Retrieval Evaluation, {TRECVID} 2013, Gaithersburg, MD, USA, November 20-22, 2013}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2013}, url = {https://www-nlpir.nist.gov/projects/tvpubs/tv13.papers/sriaurora\_med\_mer.pdf}, timestamp = {Tue, 07 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/trecvid/LiuCJYCZDSAMFSD13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icdar/2013hip, editor = {Volkmar Frinken and Bill Barrett and R. Manmatha and Volker M{\"{a}}rgner}, title = {Proceedings of the 2nd International Workshop on Historical Document Imaging and Processing, HIP@ICDAR 2013, Washington, DC, USA, August 24, 2013}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2501115}, doi = {10.1145/2501115}, isbn = {978-1-4503-2115-0}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/2013hip.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/FrinkenFMB12, author = {Volkmar Frinken and Andreas Fischer and R. Manmatha and Horst Bunke}, title = {A Novel Word Spotting Method Based on Recurrent Neural Networks}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {34}, number = {2}, pages = {211--224}, year = {2012}, url = {https://doi.org/10.1109/TPAMI.2011.113}, doi = {10.1109/TPAMI.2011.113}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/FrinkenFMB12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/das/YalnizM12, author = {Ismet Zeki Yalniz and R. Manmatha}, editor = {Michael Blumenstein and Umapada Pal and Seiichi Uchida}, title = {An Efficient Framework for Searching Text in Noisy Document Images}, booktitle = {10th {IAPR} International Workshop on Document Analysis Systems, {DAS} 2012, Gold Coast, Queenslands, Australia, March 27-29, 2012}, pages = {48--52}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/DAS.2012.18}, doi = {10.1109/DAS.2012.18}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/das/YalnizM12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icfhr/FernandezLFM12, author = {David Fern{\'{a}}ndez and Josep Llad{\'{o}}s and Alicia Forn{\'{e}}s and R. Manmatha}, title = {On Influence of Line Segmentation in Efficient Word Segmentation in Old Manuscripts}, booktitle = {2012 International Conference on Frontiers in Handwriting Recognition, {ICFHR} 2012, Bari, Italy, September 18-20, 2012}, pages = {763--768}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/ICFHR.2012.247}, doi = {10.1109/ICFHR.2012.247}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icfhr/FernandezLFM12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/CartrightCDDGKWYAMS12, author = {Marc{-}Allen Cartright and Ethem F. Can and William Dabney and Jeff Dalton and Logan Giorda and Kriste Krstovski and Xiaoye Wu and Ismet Zeki Yalniz and James Allan and R. Manmatha and David A. Smith}, editor = {William R. Hersh and Jamie Callan and Yoelle Maarek and Mark Sanderson}, title = {A framework for manipulating and searching multiple retrieval types}, booktitle = {The 35th International {ACM} {SIGIR} conference on research and development in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16, 2012}, pages = {1001}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2348283.2348426}, doi = {10.1145/2348283.2348426}, timestamp = {Wed, 14 Nov 2018 10:58:10 +0100}, biburl = {https://dblp.org/rec/conf/sigir/CartrightCDDGKWYAMS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/YalnizM12, author = {Ismet Zeki Yalniz and R. Manmatha}, editor = {William R. Hersh and Jamie Callan and Yoelle Maarek and Mark Sanderson}, title = {Finding translations in scanned book collections}, booktitle = {The 35th International {ACM} {SIGIR} conference on research and development in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16, 2012}, pages = {465--474}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2348283.2348347}, doi = {10.1145/2348283.2348347}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sigir/YalnizM12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trecvid/ChengLAJYTDSMAH12, author = {Hui Cheng and Jingen Liu and Saad Ali and Omar Javed and Qian Yu and Amir Tamrakar and Ajay Divakaran and Harpreet S. Sawhney and R. Manmatha and James Allan and Alexander G. Hauptmann and Mubarak Shah and Subhabrata Bhattacharya and Afshin Dehghan and Gerald Friedland and Benjamin Elizalde and Trevor Darrell and Michael Witbrock and Jon Curtis}, editor = {Paul Over and Jonathan G. Fiscus and Gregory A. Sanders and Barbara Shaw and George Awad and Martial Michel and Alan F. Smeaton and Wessel Kraaij and Georges Qu{\'{e}}not}, title = {SRI-Sarnoff {AURORA} System at {TRECVID} 2012 Multimedia Event Detection and Recounting}, booktitle = {2012 {TREC} Video Retrieval Evaluation, {TRECVID} 2012, Gaithersburg, MD, USA, November 26-28, 2012}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2012}, url = {https://www-nlpir.nist.gov/projects/tvpubs/tv12.papers/aurora.pdf}, timestamp = {Sun, 05 Apr 2020 14:39:22 +0200}, biburl = {https://dblp.org/rec/conf/trecvid/ChengLAJYTDSMAH12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cikm/SmithMA11, author = {David A. Smith and R. Manmatha and James Allan}, editor = {Gabriella Kazai and Carsten Eickhoff and Peter Brusilovsky}, title = {Mining relational structure from millions of books: position paper}, booktitle = {Proceedings of the 4th {ACM} Workshop on Online books, complementary social media and crowdsourcing, BooksOnline 2011, Glasgow, United Kingdom, October 24, 2011}, pages = {49--54}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2064058.2064069}, doi = {10.1145/2064058.2064069}, timestamp = {Wed, 04 May 2022 13:03:26 +0200}, biburl = {https://dblp.org/rec/conf/cikm/SmithMA11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cikm/YalnizCM11, author = {Ismet Zeki Yalniz and Ethem F. Can and R. Manmatha}, editor = {Craig Macdonald and Iadh Ounis and Ian Ruthven}, title = {Partial duplicate detection for large book collections}, booktitle = {Proceedings of the 20th {ACM} Conference on Information and Knowledge Management, {CIKM} 2011, Glasgow, United Kingdom, October 24-28, 2011}, pages = {469--474}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2063576.2063647}, doi = {10.1145/2063576.2063647}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cikm/YalnizCM11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdar/JainFJM11, author = {Raman Jain and Volkmar Frinken and C. V. Jawahar and Raghavan Manmatha}, title = {{BLSTM} Neural Network Based Word Retrieval for Hindi Documents}, booktitle = {2011 International Conference on Document Analysis and Recognition, {ICDAR} 2011, Beijing, China, September 18-21, 2011}, pages = {83--87}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/ICDAR.2011.26}, doi = {10.1109/ICDAR.2011.26}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/JainFJM11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdar/YalnizM11, author = {Ismet Zeki Yalniz and Raghavan Manmatha}, title = {A Fast Alignment Scheme for Automatic {OCR} Evaluation of Books}, booktitle = {2011 International Conference on Document Analysis and Recognition, {ICDAR} 2011, Beijing, China, September 18-21, 2011}, pages = {754--758}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/ICDAR.2011.157}, doi = {10.1109/ICDAR.2011.157}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/YalnizM11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/trecvid/ChengTAYJLDSHSB11, author = {Hui Cheng and Amir Tamrakar and Saad Ali and Qian Yu and Omar Javed and Jingen Liu and Ajay Divakaran and Harpreet S. Sawhney and Alexander G. Hauptmann and Mubarak Shah and Subhabrata Bhattacharya and Michael Witbrock and Jon Curtis and Gerald Friedland and Robert Mertens and Trevor Darrell and R. Manmatha and James Allan}, editor = {Paul Over and George Awad and Jonathan G. Fiscus and Brian Antonishek and Martial Michel and Alan F. Smeaton and Wessel Kraaij and Georges Qu{\'{e}}not}, title = {Team SRI-Sarnoff's {AURORA} System @ {TRECVID} 2011}, booktitle = {2011 {TREC} Video Retrieval Evaluation, {TRECVID} 2011, Gaithersburg, MD, USA, December 5-7, 2011}, publisher = {National Institute of Standards and Technology {(NIST)}}, year = {2011}, url = {https://www-nlpir.nist.gov/projects/tvpubs/tv11.papers/sri-aurora.pdf}, timestamp = {Thu, 11 Apr 2024 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/trecvid/ChengTAYJLDSHSB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icdar/2011hip, editor = {Bill Barrett and Michael S. Brown and R. Manmatha and Jake Gehring}, title = {Proceedings of the 2011 Workshop on Historical Document Imaging and Processing, HIP@ICDAR 2011, Beijing, China, September 16-17, 2011}, publisher = {{ACM}}, year = {2011}, url = {https://doi.org/10.1145/2037342}, doi = {10.1145/2037342}, isbn = {978-1-4503-0916-5}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/2011hip.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/civr/LlorenteMR10, author = {Ainhoa Llorente and Raghavan Manmatha and Stefan M. R{\"{u}}ger}, editor = {Shipeng Li and Xinbo Gao and Nicu Sebe}, title = {Image retrieval using Markov Random Fields and global image features}, booktitle = {Proceedings of the 9th {ACM} International Conference on Image and Video Retrieval, {CIVR} 2010, Xi'an, China, July 5-7, 2010}, pages = {243--250}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1816041.1816078}, doi = {10.1145/1816041.1816078}, timestamp = {Tue, 20 Apr 2021 16:59:22 +0200}, biburl = {https://dblp.org/rec/conf/civr/LlorenteMR10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/das/SankarJM10, author = {K. Pramod Sankar and C. V. Jawahar and Raghavan Manmatha}, editor = {David S. Doermann and Venu Govindaraju and Daniel P. Lopresti and Premkumar Natarajan}, title = {Nearest neighbor based collection {OCR}}, booktitle = {The Ninth {IAPR} International Workshop on Document Analysis Systems, {DAS} 2010, June 9-11, 2010, Boston, Massachusetts, {USA}}, series = {{ACM} International Conference Proceeding Series}, pages = {207--214}, publisher = {{ACM}}, year = {2010}, url = {https://doi.org/10.1145/1815330.1815357}, doi = {10.1145/1815330.1815357}, timestamp = {Sun, 25 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/das/SankarJM10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icfhr/FrinkenFBM10, author = {Volkmar Frinken and Andreas Fischer and Horst Bunke and R. Manmatha}, title = {Adapting {BLSTM} Neural Network Based Keyword Spotting Trained on Modern Data to Historical Documents}, booktitle = {International Conference on Frontiers in Handwriting Recognition, {ICFHR} 2010, Kolkata, India, 16-18 November 2010}, pages = {352--357}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICFHR.2010.61}, doi = {10.1109/ICFHR.2010.61}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icfhr/FrinkenFBM10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/HoweFM09, author = {Nicholas R. Howe and Shaolei Feng and R. Manmatha}, title = {Finding words in alphabet soup: Inference on freeform character recognition for historical scripts}, journal = {Pattern Recognit.}, volume = {42}, number = {12}, pages = {3338--3347}, year = {2009}, url = {https://doi.org/10.1016/j.patcog.2009.01.012}, doi = {10.1016/J.PATCOG.2009.01.012}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/HoweFM09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdar/RasagnaKJM09, author = {Venkat Rasagna and Anand Kumar and C. V. Jawahar and Raghavan Manmatha}, title = {Robust Recognition of Documents by Fusing Results of Word Clusters}, booktitle = {10th International Conference on Document Analysis and Recognition, {ICDAR} 2009, Barcelona, Spain, 26-29 July 2009}, pages = {566--570}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/ICDAR.2009.135}, doi = {10.1109/ICDAR.2009.135}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/RasagnaKJM09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/civr/FengM08, author = {Shaolei Feng and Raghavan Manmatha}, editor = {Jiebo Luo and Ling Guan and Alan Hanjalic and Mohan S. Kankanhalli and Ivan Lee}, title = {A discrete direct retrieval model for image and video retrieval}, booktitle = {Proceedings of the 7th {ACM} International Conference on Image and Video Retrieval, {CIVR} 2008, Niagara Falls, Canada, July 7-9, 2008}, pages = {427--436}, publisher = {{ACM}}, year = {2008}, url = {https://doi.org/10.1145/1386352.1386407}, doi = {10.1145/1386352.1386407}, timestamp = {Wed, 26 Jun 2024 21:42:22 +0200}, biburl = {https://dblp.org/rec/conf/civr/FengM08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sensys/YanGM08, author = {Tingxin Yan and Deepak Ganesan and R. Manmatha}, editor = {Tarek F. Abdelzaher and Margaret Martonosi and Adam Wolisz}, title = {Distributed image search in camera sensor networks}, booktitle = {Proceedings of the 6th International Conference on Embedded Networked Sensor Systems, SenSys 2008, Raleigh, NC, USA, November 5-7, 2008}, pages = {155--168}, publisher = {{ACM}}, year = {2008}, url = {https://doi.org/10.1145/1460412.1460428}, doi = {10.1145/1460412.1460428}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/sensys/YanGM08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:reference/wiley/Manmatha08, author = {R. Manmatha}, editor = {Benjamin W. Wah}, title = {Document Image Analysis and Recognition}, booktitle = {Wiley Encyclopedia of Computer Science and Engineering}, publisher = {John Wiley {\&} Sons, Inc.}, year = {2008}, url = {https://doi.org/10.1002/9780470050118.ecse667}, doi = {10.1002/9780470050118.ECSE667}, timestamp = {Tue, 16 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/reference/wiley/Manmatha08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijdar/KornfieldMA07, author = {E. Micah Kornfield and R. Manmatha and James Allan}, title = {Further explorations in text alignment with handwritten documents}, journal = {Int. J. Document Anal. Recognit.}, volume = {10}, number = {1}, pages = {39--52}, year = {2007}, url = {https://doi.org/10.1007/s10032-006-0019-8}, doi = {10.1007/S10032-006-0019-8}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijdar/KornfieldMA07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijdar/RathM07, author = {Toni M. Rath and R. Manmatha}, title = {Word spotting for historical documents}, journal = {Int. J. Document Anal. Recognit.}, volume = {9}, number = {2-4}, pages = {139--152}, year = {2007}, url = {https://doi.org/10.1007/s10032-006-0027-8}, doi = {10.1007/S10032-006-0027-8}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijdar/RathM07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijdar/RathM07a, author = {Toni M. Rath and R. Manmatha}, title = {Word spotting for historical documents}, journal = {Int. J. Document Anal. Recognit.}, volume = {9}, number = {2-4}, pages = {299}, year = {2007}, url = {https://doi.org/10.1007/s10032-006-0035-8}, doi = {10.1007/S10032-006-0035-8}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijdar/RathM07a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/accv/KumarJM07, author = {Anand Kumar and C. V. Jawahar and R. Manmatha}, editor = {Yasushi Yagi and Sing Bing Kang and In{-}So Kweon and Hongbin Zha}, title = {Efficient Search in Document Image Collections}, booktitle = {Computer Vision - {ACCV} 2007, 8th Asian Conference on Computer Vision, Tokyo, Japan, November 18-22, 2007, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {4843}, pages = {586--595}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-76386-4\_55}, doi = {10.1007/978-3-540-76386-4\_55}, timestamp = {Tue, 14 May 2019 10:00:50 +0200}, biburl = {https://dblp.org/rec/conf/accv/KumarJM07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/das/RothfederMR06, author = {Jamie L. Rothfeder and R. Manmatha and Toni M. Rath}, editor = {Horst Bunke and A. Lawrence Spitz}, title = {Aligning Transcripts to Automatically Segmented Handwritten Manuscripts}, booktitle = {Document Analysis Systems VII, 7th International Workshop, {DAS} 2006, Nelson, New Zealand, February 13-15, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3872}, pages = {84--95}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11669487\_8}, doi = {10.1007/11669487\_8}, timestamp = {Tue, 14 May 2019 10:00:52 +0200}, biburl = {https://dblp.org/rec/conf/das/RothfederMR06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dial/FengMM06, author = {Shaolei Feng and R. Manmatha and Andrew McCallum}, title = {Exploring the Use of Conditional Random Field Models and HMMs for Historical Handwritten Document Recognition}, booktitle = {Second International Workshop on Document Image Analysis for Libraries {(DIAL} 2006), 27-28 April 2006, Lyon, France}, pages = {30--37}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/DIAL.2006.19}, doi = {10.1109/DIAL.2006.19}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dial/FengMM06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dmin/XieNRH06, author = {Ying Xie and Manmathasivaram Nagarajan and Vijay V. Raghavan and Hisham Haddad}, editor = {Sven F. Crone and Stefan Lessmann and Robert Stahlbock}, title = {On Novelty Evaluation of Potentially Useful Patterns}, booktitle = {Proceedings of the 2006 International Conference on Data Mining, {DMIN} 2006, Las Vegas, Nevada, USA, June 26-29, 2006}, pages = {211--217}, publisher = {{CSREA} Press}, year = {2006}, timestamp = {Mon, 28 Sep 2015 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/dmin/XieNRH06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/jcdl/FengM06, author = {Shaolei Feng and R. Manmatha}, editor = {Gary Marchionini and Michael L. Nelson and Catherine C. Marshall}, title = {A hierarchical, HMM-based automatic evaluation of {OCR} accuracy for a digital library of books}, booktitle = {{ACM/IEEE} Joint Conference on Digital Libraries, {JCDL} 2006, Chapel Hill, NC, USA, June 11-15, 2006, Proceedings}, pages = {109--118}, publisher = {{ACM}}, year = {2006}, url = {https://doi.org/10.1145/1141753.1141776}, doi = {10.1145/1141753.1141776}, timestamp = {Wed, 16 Oct 2019 14:14:56 +0200}, biburl = {https://dblp.org/rec/conf/jcdl/FengM06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/ManmathaR05, author = {R. Manmatha and Jamie L. Rothfeder}, title = {A Scale Space Approach for Automatically Segmenting Words from Historical Handwritten Documents}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {27}, number = {8}, pages = {1212--1225}, year = {2005}, url = {https://doi.org/10.1109/TPAMI.2005.150}, doi = {10.1109/TPAMI.2005.150}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/ManmathaR05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/ManmathaRH05, author = {Raghavan Manmatha and Stefan M. R{\"{u}}ger and Alexander G. Hauptmann}, title = {Multimedia information retrieval: workshop report}, journal = {{SIGIR} Forum}, volume = {39}, number = {2}, pages = {40--41}, year = {2005}, url = {https://doi.org/10.1145/1113343.1113352}, doi = {10.1145/1113343.1113352}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sigir/ManmathaRH05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/civr/MohantyRLM05, author = {Natasha Mohanty and Toni M. Rath and Audrey Lee and R. Manmatha}, editor = {Wee Kheng Leow and Michael S. Lew and Tat{-}Seng Chua and Wei{-}Ying Ma and Lekha Chaisorn and Erwin M. Bakker}, title = {Learning Shapes for Image Classification and Retrieval}, booktitle = {Image and Video Retrieval, 4th International Conference, {CIVR} 2005, Singapore, July 20-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3568}, pages = {589--598}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11526346\_62}, doi = {10.1007/11526346\_62}, timestamp = {Tue, 14 May 2019 10:00:44 +0200}, biburl = {https://dblp.org/rec/conf/civr/MohantyRLM05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/ChangMC05, author = {Shih{-}Fu Chang and R. Manmatha and Tat{-}Seng Chua}, title = {Combining text and audio-visual features in video indexing}, booktitle = {2005 {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} '05, Philadelphia, Pennsylvania, USA, March 18-23, 2005}, pages = {1005--1008}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/ICASSP.2005.1416476}, doi = {10.1109/ICASSP.2005.1416476}, timestamp = {Mon, 22 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/ChangMC05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdar/FengM05, author = {Shaolei Feng and Raghavan Manmatha}, title = {Classification Models for Historical Manuscript Recognition}, booktitle = {Eighth International Conference on Document Analysis and Recognition {(ICDAR} 2005), 29 August - 1 September 2005, Seoul, Korea}, pages = {528--532}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/ICDAR.2005.73}, doi = {10.1109/ICDAR.2005.73}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/FengM05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mm/IyengarDFIKKKMNPPV05, author = {Giridharan Iyengar and Pinar Duygulu and Shaolei Feng and Pavel Ircing and Sanjeev Khudanpur and Dietrich Klakow and M. R. Krause and Raghavan Manmatha and Harriet J. Nock and D. Petkova and Brock Pytlik and Paola Virga}, editor = {HongJiang Zhang and Tat{-}Seng Chua and Ralf Steinmetz and Mohan S. Kankanhalli and Lynn Wilcox}, title = {Joint visual-text modeling for automatic retrieval of multimedia documents}, booktitle = {Proceedings of the 13th {ACM} International Conference on Multimedia, Singapore, November 6-11, 2005}, pages = {21--30}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1101149.1101154}, doi = {10.1145/1101149.1101154}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mm/IyengarDFIKKKMNPPV05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/HoweRM05, author = {Nicholas R. Howe and Toni M. Rath and R. Manmatha}, editor = {Ricardo A. Baeza{-}Yates and Nivio Ziviani and Gary Marchionini and Alistair Moffat and John Tait}, title = {Boosted decision trees for word recognition in handwritten document retrieval}, booktitle = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR} Conference on Research and Development in Information Retrieval, Salvador, Brazil, August 15-19, 2005}, pages = {377--383}, publisher = {{ACM}}, year = {2005}, url = {https://doi.org/10.1145/1076034.1076099}, doi = {10.1145/1076034.1076099}, timestamp = {Tue, 06 Nov 2018 11:07:23 +0100}, biburl = {https://dblp.org/rec/conf/sigir/HoweRM05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/civr/JeonM04, author = {Jiwoon Jeon and R. Manmatha}, title = {Using Maximum Entropy for Automatic Image Annotation}, booktitle = {Image and Video Retrieval: Third International Conference, {CIVR} 2004, Dublin, Ireland, July 21-23, 2004. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3115}, pages = {24--32}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-27814-6\_7}, doi = {10.1007/978-3-540-27814-6\_7}, timestamp = {Tue, 14 May 2019 10:00:44 +0200}, biburl = {https://dblp.org/rec/conf/civr/JeonM04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/civr/MetzlerM04, author = {Donald Metzler and R. Manmatha}, title = {An Inference Network Approach to Image Retrieval}, booktitle = {Image and Video Retrieval: Third International Conference, {CIVR} 2004, Dublin, Ireland, July 21-23, 2004. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3115}, pages = {42--50}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-27814-6\_9}, doi = {10.1007/978-3-540-27814-6\_9}, timestamp = {Tue, 23 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/civr/MetzlerM04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/FengML04, author = {Shaolei Feng and Raghavan Manmatha and Victor Lavrenko}, title = {Multiple Bernoulli Relevance Models for Image and Video Annotation}, booktitle = {2004 {IEEE} Computer Society Conference on Computer Vision and Pattern Recognition {(CVPR} 2004), with CD-ROM, 27 June - 2 July 2004, Washington, DC, {USA}}, pages = {1002--1009}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.ieeecomputersociety.org/10.1109/CVPR.2004.171}, doi = {10.1109/CVPR.2004.171}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/FengML04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dial/KornfieldMA04, author = {E. Micah Kornfield and R. Manmatha and James Allan}, title = {Text Alignment with Handwritten Documents}, booktitle = {1st International Workshop on Document Image Analysis for Libraries {(DIAL} 2004), 23-24 January 2004, Palo Alto, CA, {USA}}, pages = {195--211}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/DIAL.2004.1263249}, doi = {10.1109/DIAL.2004.1263249}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dial/KornfieldMA04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dial/LavrenkoRM04, author = {Victor Lavrenko and Toni M. Rath and R. Manmatha}, title = {Holistic Word Recognition for Handwritten Historical Documents}, booktitle = {1st International Workshop on Document Image Analysis for Libraries {(DIAL} 2004), 23-24 January 2004, Palo Alto, CA, {USA}}, pages = {278--287}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/DIAL.2004.1263256}, doi = {10.1109/DIAL.2004.1263256}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dial/LavrenkoRM04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/LavrenkoFM04, author = {Victor Lavrenko and Shaolei Feng and Raghavan Manmatha}, title = {Statistical models for automatic video annotation and retrieval}, booktitle = {2004 {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} 2004, Montreal, Quebec, Canada, May 17-21, 2004}, pages = {1044--1047}, publisher = {{IEEE}}, year = {2004}, url = {https://doi.org/10.1109/ICASSP.2004.1326727}, doi = {10.1109/ICASSP.2004.1326727}, timestamp = {Mon, 22 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/LavrenkoFM04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/RathML04, author = {Toni M. Rath and R. Manmatha and Victor Lavrenko}, editor = {Mark Sanderson and Kalervo J{\"{a}}rvelin and James Allan and Peter Bruza}, title = {A search engine for historical manuscript images}, booktitle = {{SIGIR} 2004: Proceedings of the 27th Annual International {ACM} {SIGIR} Conference on Research and Development in Information Retrieval, Sheffield, UK, July 25-29, 2004}, pages = {369--376}, publisher = {{ACM}}, year = {2004}, url = {https://doi.org/10.1145/1008992.1009056}, doi = {10.1145/1008992.1009056}, timestamp = {Tue, 06 Nov 2018 11:07:22 +0100}, biburl = {https://dblp.org/rec/conf/sigir/RathML04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03, author = {James Allan and Jay Aslam and Nicholas J. Belkin and Chris Buckley and James P. Callan and W. Bruce Croft and Susan T. Dumais and Norbert Fuhr and Donna Harman and David J. Harper and Djoerd Hiemstra and Thomas Hofmann and Eduard H. Hovy and Wessel Kraaij and John D. Lafferty and Victor Lavrenko and David D. Lewis and Liz Liddy and R. Manmatha and Andrew McCallum and Jay M. Ponte and John M. Prager and Dragomir R. Radev and Philip Resnik and Stephen E. Robertson and Ronald Rosenfeld and Salim Roukos and Mark Sanderson and Richard M. Schwartz and Amit Singhal and Alan F. Smeaton and Howard R. Turtle and Ellen M. Voorhees and Ralph M. Weischedel and Jinxi Xu and ChengXiang Zhai}, title = {Challenges in information retrieval and language modeling: report of a workshop held at the center for intelligent information retrieval, University of Massachusetts Amherst, September 2002}, journal = {{SIGIR} Forum}, volume = {37}, number = {1}, pages = {31--47}, year = {2003}, url = {https://doi.org/10.1145/945546.945549}, doi = {10.1145/945546.945549}, timestamp = {Sun, 22 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/RathM03, author = {Toni M. Rath and R. Manmatha}, title = {Word Image Matching Using Dynamic Time Warping}, booktitle = {2003 {IEEE} Computer Society Conference on Computer Vision and Pattern Recognition {(CVPR} 2003), 16-22 June 2003, Madison, WI, {USA}}, pages = {521--527}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/CVPR.2003.1211511}, doi = {10.1109/CVPR.2003.1211511}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/RathM03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icdar/RathM03, author = {Toni M. Rath and R. Manmatha}, title = {Features for Word Spotting in Historical Manuscripts}, booktitle = {7th International Conference on Document Analysis and Recognition {(ICDAR} 2003), 2-Volume Set, 3-6 August 2003, Edinburgh, Scotland, {UK}}, pages = {218--222}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/ICDAR.2003.1227662}, doi = {10.1109/ICDAR.2003.1227662}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icdar/RathM03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icnp/HannaLM03, author = {Katrina M. Hanna and Brian Neil Levine and R. Manmatha}, title = {Mobile Distributed Information Retrieval for Highly-Partitioned Networks}, booktitle = {11th {IEEE} International Conference on Network Protocols {(ICNP} 2003), 4-7 November 2003, Atlanta, GA, {USA}}, pages = {38}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/ICNP.2003.1249755}, doi = {10.1109/ICNP.2003.1249755}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icnp/HannaLM03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/nips/LavrenkoMJ03, author = {Victor Lavrenko and R. Manmatha and Jiwoon Jeon}, editor = {Sebastian Thrun and Lawrence K. Saul and Bernhard Sch{\"{o}}lkopf}, title = {A Model for Learning the Semantics of Pictures}, booktitle = {Advances in Neural Information Processing Systems 16 [Neural Information Processing Systems, {NIPS} 2003, December 8-13, 2003, Vancouver and Whistler, British Columbia, Canada]}, pages = {553--560}, publisher = {{MIT} Press}, year = {2003}, url = {https://proceedings.neurips.cc/paper/2003/hash/0bf727e907c5fc9d5356f11e4c45d613-Abstract.html}, timestamp = {Mon, 16 May 2022 15:41:51 +0200}, biburl = {https://dblp.org/rec/conf/nips/LavrenkoMJ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/JeonLM03, author = {Jiwoon Jeon and Victor Lavrenko and R. Manmatha}, editor = {Charles L. A. Clarke and Gordon V. Cormack and Jamie Callan and David Hawking and Alan F. Smeaton}, title = {Automatic image annotation and retrieval using cross-media relevance models}, booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR} Conference on Research and Development in Information Retrieval, July 28 - August 1, 2003, Toronto, Canada}, pages = {119--126}, publisher = {{ACM}}, year = {2003}, url = {https://doi.org/10.1145/860435.860459}, doi = {10.1145/860435.860459}, timestamp = {Tue, 06 Nov 2018 11:07:23 +0100}, biburl = {https://dblp.org/rec/conf/sigir/JeonLM03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/ManmathaFA02, author = {R. Manmatha and Ao Feng and James Allan}, editor = {Kalervo J{\"{a}}rvelin and Micheline Beaulieu and Ricardo A. Baeza{-}Yates and Sung{-}Hyon Myaeng}, title = {A critical examination of TDT's cost function}, booktitle = {{SIGIR} 2002: Proceedings of the 25th Annual International {ACM} {SIGIR} Conference on Research and Development in Information Retrieval, August 11-15, 2002, Tampere, Finland}, pages = {403--404}, publisher = {{ACM}}, year = {2002}, url = {https://doi.org/10.1145/564376.564465}, doi = {10.1145/564376.564465}, timestamp = {Wed, 07 Nov 2018 14:52:44 +0100}, biburl = {https://dblp.org/rec/conf/sigir/ManmathaFA02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/DasM01, author = {Madirakshi Das and R. Manmatha}, title = {Automatic Segmentation and Indexing in a Database of Bird Images}, booktitle = {Proceedings of the Eighth International Conference On Computer Vision (ICCV-01), Vancouver, British Columbia, Canada, July 7-14, 2001 - Volume 2}, pages = {351--358}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/ICCV.2001.937647}, doi = {10.1109/ICCV.2001.937647}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/DasM01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/ManmathaRF01, author = {R. Manmatha and Toni M. Rath and Fangfang Feng}, editor = {W. Bruce Croft and David J. Harper and Donald H. Kraft and Justin Zobel}, title = {Modeling Score Distributions for Combining the Outputs of Search Engines}, booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR} Conference on Research and Development in Information Retrieval, September 9-13, 2001, New Orleans, Louisiana, {USA}}, pages = {267--275}, publisher = {{ACM}}, year = {2001}, url = {https://doi.org/10.1145/383952.384005}, doi = {10.1145/383952.384005}, timestamp = {Tue, 06 Nov 2018 11:07:24 +0100}, biburl = {https://dblp.org/rec/conf/sigir/ManmathaRF01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/expert/DasMR99, author = {Madirakshi Das and R. Manmatha and Edward M. Riseman}, title = {Indexing Flower Patent Images Using Domain Knowledge}, journal = {{IEEE} Intell. Syst.}, volume = {14}, number = {5}, pages = {24--33}, year = {1999}, url = {https://doi.org/10.1109/5254.796084}, doi = {10.1109/5254.796084}, timestamp = {Fri, 06 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/expert/DasMR99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/WuMR99, author = {Victor Wu and R. Manmatha and Edward M. Riseman}, title = {TextFinder: An Automatic System to Detect and Recognize Text In Images}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {21}, number = {11}, pages = {1224--1229}, year = {1999}, url = {https://doi.org/10.1109/34.809116}, doi = {10.1109/34.809116}, timestamp = {Wed, 17 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pami/WuMR99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/SrihariZMR99, author = {Rohini K. Srihari and Zhongfei Zhang and R. Manmatha and Chandu Ravela}, title = {Indexing and Retrieval, SIGIR'99 Workshop Summary}, journal = {{SIGIR} Forum}, volume = {33}, number = {1}, pages = {34--35}, year = {1999}, url = {https://doi.org/10.1145/331403.331412}, doi = {10.1145/331403.331412}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sigir/SrihariZMR99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/scalespace/ManmathaS99, author = {R. Manmatha and Nitin Srimal}, editor = {Mads Nielsen and Peter Johansen and Ole Fogh Olsen and Joachim Weickert}, title = {Scale Space Technique for Word Segmentation in Handwritten Documents}, booktitle = {Scale-Space Theories in Computer Vision, Second International Conference, Scale-Space'99, Corfu, Greece, September 26-27, 1999, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {1682}, pages = {22--33}, publisher = {Springer}, year = {1999}, url = {https://doi.org/10.1007/3-540-48236-9\_3}, doi = {10.1007/3-540-48236-9\_3}, timestamp = {Tue, 14 May 2019 10:00:52 +0200}, biburl = {https://dblp.org/rec/conf/scalespace/ManmathaS99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigir/SrihariZMR98, author = {Rohini K. Srihari and Zhongfei Zhang and R. Manmatha and Chandu Ravela}, title = {Multimedia Indexing and Retrieval, Summary Report}, journal = {{SIGIR} Forum}, volume = {32}, number = {2}, pages = {29--30}, year = {1998}, url = {https://doi.org/10.1145/305110.305130}, doi = {10.1145/305110.305130}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sigir/SrihariZMR98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/drr/WuM98, author = {Victor Wu and Raghavan Manmatha}, editor = {Daniel P. Lopresti and Jiangying Zhou}, title = {Document image cleanup and binarization}, booktitle = {Document Recognition V, San Jose, CA, USA, January 24, 1998}, series = {{SPIE} Proceedings}, volume = {3305}, pages = {263}, publisher = {{SPIE}}, year = {1998}, url = {https://doi.org/10.1117/12.304638}, doi = {10.1117/12.304638}, timestamp = {Wed, 24 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/drr/WuM98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hvei/ManmathaRC98, author = {Raghavan Manmatha and S. Chandu Ravela and Y. Chitti}, editor = {Bernice E. Rogowitz and Thrasyvoulos N. Pappas}, title = {Computing local and global similarity in images}, booktitle = {Human Vision and Electronic Imaging III, San Jose, CA, USA, January 24, 1998}, series = {{SPIE} Proceedings}, volume = {3299}, pages = {540--551}, publisher = {{SPIE}}, year = {1998}, url = {https://doi.org/10.1117/12.320145}, doi = {10.1117/12.320145}, timestamp = {Sun, 21 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hvei/ManmathaRC98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/RavelaM98, author = {Srinivas Ravela and R. Manmatha}, title = {Retrieving Images by Appearance}, booktitle = {Proceedings of the Sixth International Conference on Computer Vision (ICCV-98), Bombay, India, January 4-7, 1998}, pages = {608--613}, publisher = {{IEEE} Computer Society}, year = {1998}, url = {https://doi.org/10.1109/ICCV.1998.710780}, doi = {10.1109/ICCV.1998.710780}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/RavelaM98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wacv/DasMR98, author = {Madirakshi Das and Raghavan Manmatha and Edward M. Riseman}, title = {Indexing flowers by color names using domain knowledge-driven segmentation}, booktitle = {Proceedings Fourth {IEEE} Workshop on Applications of Computer Vision, {WACV} 1998, October 19-21, 1998, Princeton, New Jersey, {USA}}, pages = {94--99}, publisher = {{IEEE} Computer Society}, year = {1998}, url = {https://doi.org/10.1109/ACV.1998.732864}, doi = {10.1109/ACV.1998.732864}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wacv/DasMR98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wacv/RavelaM98, author = {Srinivas Ravela and Raghavan Manmatha}, title = {On computing global similarity in images}, booktitle = {Proceedings Fourth {IEEE} Workshop on Applications of Computer Vision, {WACV} 1998, October 19-21, 1998, Princeton, New Jersey, {USA}}, pages = {82--87}, publisher = {{IEEE} Computer Society}, year = {1998}, url = {https://doi.org/10.1109/ACV.1998.732862}, doi = {10.1109/ACV.1998.732862}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/wacv/RavelaM98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dl/WuMR97, author = {Victor Wu and R. Manmatha and Edward M. Riseman}, title = {Finding Text in Images}, booktitle = {Proceedings of the 2nd {ACM} International Conference on Digital Libraries, July 25-28, 1997, Philadelphia, PA, {USA}}, pages = {3--12}, publisher = {{ACM}}, year = {1997}, url = {https://doi.org/10.1145/263690.263766}, doi = {10.1145/263690.263766}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dl/WuMR97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/hvei/ManmathaR97, author = {Raghavan Manmatha and S. Chandu Ravela}, editor = {Bernice E. Rogowitz and Thrasyvoulos N. Pappas}, title = {Syntactic characterization of appearance and its application to image retrieval}, booktitle = {Human Vision and Electronic Imaging II, San Jose, CA, USA, February 8, 1997}, series = {{SPIE} Proceedings}, volume = {3016}, pages = {484--495}, publisher = {{SPIE}}, year = {1997}, url = {https://doi.org/10.1117/12.274546}, doi = {10.1117/12.274546}, timestamp = {Sun, 21 May 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/hvei/ManmathaR97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigir/RavelaM97, author = {Srinivas Ravela and R. Manmatha}, editor = {Nicholas J. Belkin and Arcot Desai Narasimhalu and Peter Willett and William R. Hersh and Fazli Can and Ellen M. Voorhees}, title = {Image Retrieval by Appearance}, booktitle = {{SIGIR} '97: Proceedings of the 20th Annual International {ACM} {SIGIR} Conference on Research and Development in Information Retrieval, July 27-31, 1997, Philadelphia, PA, {USA}}, pages = {278--285}, publisher = {{ACM}}, year = {1997}, url = {https://doi.org/10.1145/258525.258589}, doi = {10.1145/258525.258589}, timestamp = {Tue, 19 Sep 2023 11:58:25 +0200}, biburl = {https://dblp.org/rec/conf/sigir/RavelaM97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ManmathaHR96, author = {R. Manmatha and Chengfeng Han and Edward M. Riseman}, title = {Word Spotting: {A} New Approach to Indexing Handwriting}, booktitle = {1996 Conference on Computer Vision and Pattern Recognition {(CVPR} '96), June 18-20, 1996 San Francisco, CA, {USA}}, pages = {631--637}, publisher = {{IEEE} Computer Society}, year = {1996}, url = {https://doi.org/10.1109/CVPR.1996.517139}, doi = {10.1109/CVPR.1996.517139}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/ManmathaHR96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/dl/ManmathaHRC96, author = {R. Manmatha and Chengfeng Han and Edward M. Riseman and W. Bruce Croft}, title = {Indexing Handwriting Using Word Matching}, booktitle = {Proceedings of the 1st {ACM} International Conference on Digital Libraries, March 20-23, 1996, Bethesda, Maryland, {USA}}, pages = {151--159}, publisher = {{ACM}}, year = {1996}, url = {https://doi.org/10.1145/226931.226960}, doi = {10.1145/226931.226960}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/dl/ManmathaHRC96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/RavelaMR96, author = {Srinivas Ravela and R. Manmatha and Edward M. Riseman}, editor = {Bernard F. Buxton and Roberto Cipolla}, title = {Image Retrieval Using Scale-Space Matching}, booktitle = {Computer Vision - ECCV'96, 4th European Conference on Computer Vision, Cambridge, UK, April 15-18, 1996, Proceedings, Volume {I}}, series = {Lecture Notes in Computer Science}, volume = {1064}, pages = {273--282}, publisher = {Springer}, year = {1996}, url = {https://doi.org/10.1007/BFb0015543}, doi = {10.1007/BFB0015543}, timestamp = {Tue, 14 May 2019 10:00:45 +0200}, biburl = {https://dblp.org/rec/conf/eccv/RavelaMR96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/Manmatha94, author = {R. Manmatha}, title = {A framework for recovering affine transforms using points, lines or image brightnesses}, booktitle = {Conference on Computer Vision and Pattern Recognition, {CVPR} 1994, 21-23 June, 1994, Seattle, WA, {USA}}, pages = {141--146}, publisher = {{IEEE}}, year = {1994}, url = {https://doi.org/10.1109/CVPR.1994.323821}, doi = {10.1109/CVPR.1994.323821}, timestamp = {Wed, 16 Oct 2019 14:14:50 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/Manmatha94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/Manmatha94, author = {R. Manmatha}, editor = {Jan{-}Olof Eklundh}, title = {Measuring the Affine Transform Using Gaussian Filters}, booktitle = {Computer Vision - ECCV'94, Third European Conference on Computer Vision, Stockholm, Sweden, May 2-6, 1994, Proceedings, Volume {II}}, series = {Lecture Notes in Computer Science}, volume = {801}, pages = {159--164}, publisher = {Springer}, year = {1994}, url = {https://doi.org/10.1007/BFb0028346}, doi = {10.1007/BFB0028346}, timestamp = {Tue, 14 May 2019 10:00:45 +0200}, biburl = {https://dblp.org/rec/conf/eccv/Manmatha94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ManmathaO93, author = {Raghavan Manmatha and John Oliensis}, title = {Extracting affine deformations from image patches. I. Finding scale and rotation}, booktitle = {Conference on Computer Vision and Pattern Recognition, {CVPR} 1993, 15-17 June, 1993, New York, NY, {USA}}, pages = {754--755}, publisher = {{IEEE}}, year = {1993}, url = {https://doi.org/10.1109/CVPR.1993.341158}, doi = {10.1109/CVPR.1993.341158}, timestamp = {Wed, 16 Oct 2019 14:14:50 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/ManmathaO93.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/DuttaMWR89, author = {Rabindranath Dutta and R. Manmatha and Lance R. Williams and Edward M. Riseman}, title = {A data set for quantitative motion analysis}, booktitle = {{IEEE} Computer Society Conference on Computer Vision and Pattern Recognition, {CVPR} 1989, 4-8 June, 1989, San Diego, CA, {USA}}, pages = {159--164}, publisher = {{IEEE}}, year = {1989}, url = {https://doi.org/10.1109/CVPR.1989.37844}, doi = {10.1109/CVPR.1989.37844}, timestamp = {Tue, 30 Mar 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/DuttaMWR89.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.