Search dblp for Publications

export results for "Mario Sanchez"

 download as .bib file

@article{DBLP:journals/eswa/MadrugaCS25,
  author       = {Mario Madruga and
                  Yolanda Campos{-}Roca and
                  Carlos J. P{\'{e}}rez S{\'{a}}nchez},
  title        = {Enhancing noise robustness of automatic Parkinson's disease detection
                  in diadochokinesis tests using multicondition training},
  journal      = {Expert Syst. Appl.},
  volume       = {260},
  pages        = {125401},
  year         = {2025},
  url          = {https://doi.org/10.1016/j.eswa.2024.125401},
  doi          = {10.1016/J.ESWA.2024.125401},
  timestamp    = {Wed, 02 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/MadrugaCS25.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/VilarAndreuGGAG24,
  author       = {Mario Vilar{-}Andreu and
                  Laura Garc{\'{\i}}a and
                  Antonio{-}Javier Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Rafael Asorey{-}Cacheda and
                  Joan Garc{\'{\i}}a{-}Haro},
  title        = {Enhancing Precision Agriculture Pest Control: {A} Generalized Deep
                  Learning Approach With YOLOv8-Based Insect Detection},
  journal      = {{IEEE} Access},
  volume       = {12},
  pages        = {84420--84434},
  year         = {2024},
  url          = {https://doi.org/10.1109/ACCESS.2024.3413979},
  doi          = {10.1109/ACCESS.2024.3413979},
  timestamp    = {Fri, 02 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/VilarAndreuGGAG24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/VilchezMembrillaPPSS24,
  author       = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
                  Mario Fern{\'{a}}ndez Pantoja and
                  Ana Pilar Valerga Puerta and
                  Victor Hugo Oliveira e Souza and
                  Clemente Cobos S{\'{a}}nchez},
  title        = {Design of Transcranial Magnetic Stimulation Coils With Optimized Stimulation
                  Depth},
  journal      = {{IEEE} Access},
  volume       = {12},
  pages        = {1330--1340},
  year         = {2024},
  url          = {https://doi.org/10.1109/ACCESS.2023.3346173},
  doi          = {10.1109/ACCESS.2023.3346173},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/VilchezMembrillaPPSS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/algorithms/PonceSilvaSCAL24,
  author       = {Mario Ponce{-}Silva and
                  {\'{O}}scar S{\'{a}}nchez{-}Vargas and
                  Claudia Cort{\'{e}}s{-}Garc{\'{\i}}a and
                  Jesus Aguayo{-}Alquicira and
                  Susana Estefany De Le{\'{o}}n{-}Aldaco},
  title        = {Algorithm for Assessment of the Switching Angles in the Unipolar {SPWM}
                  Technique for Single-Phase Inverters},
  journal      = {Algorithms},
  volume       = {17},
  number       = {7},
  pages        = {317},
  year         = {2024},
  url          = {https://doi.org/10.3390/a17070317},
  doi          = {10.3390/A17070317},
  timestamp    = {Fri, 20 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/algorithms/PonceSilvaSCAL24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computers/AndresSanchezOSG24,
  author       = {Jorge de Andr{\'{e}}s{-}S{\'{a}}nchez and
                  Mario Arias Oliva and
                  Mar Souto{-}Romero and
                  Jaume Gen{\'{e}}{-}Albesa},
  title        = {Assessing the Acceptance of Cyborg Technology with a Hedonic Technology
                  Acceptance Model},
  journal      = {Comput.},
  volume       = {13},
  number       = {3},
  pages        = {82},
  year         = {2024},
  url          = {https://doi.org/10.3390/computers13030082},
  doi          = {10.3390/COMPUTERS13030082},
  timestamp    = {Sat, 04 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/computers/AndresSanchezOSG24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dcg/KolesnikS24,
  author       = {Brett Kolesnik and
                  Mario Sanchez},
  title        = {The Geometry of Random Tournaments},
  journal      = {Discret. Comput. Geom.},
  volume       = {71},
  number       = {4},
  pages        = {1343--1351},
  year         = {2024},
  url          = {https://doi.org/10.1007/s00454-023-00571-4},
  doi          = {10.1007/S00454-023-00571-4},
  timestamp    = {Sat, 08 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/dcg/KolesnikS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/MorenoAlvarezPSRHH24,
  author       = {Sergio Moreno{-}{\'{A}}lvarez and
                  Mercedes Eugenia Paoletti and
                  A. J. Sanchez{-}Fernandez and
                  Juan A. Rico{-}Gallego and
                  Lirong Han and
                  Juan Mario Haut},
  title        = {Federated learning meets remote sensing},
  journal      = {Expert Syst. Appl.},
  volume       = {255},
  pages        = {124583},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.eswa.2024.124583},
  doi          = {10.1016/J.ESWA.2024.124583},
  timestamp    = {Thu, 22 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/MorenoAlvarezPSRHH24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fi/GuerraMACSS24,
  author       = {Erik Ortiz Guerra and
                  Mario Mart{\'{\i}}nez Morfa and
                  Carlos Manuel Garc{\'{\i}}a Algora and
                  Hector Cruz{-}Enriquez and
                  Kris Steenhaut and
                  Samuel Montejo Sanchez},
  title        = {Enhanced Beacons Dynamic Transmission over {TSCH}},
  journal      = {Future Internet},
  volume       = {16},
  number       = {6},
  pages        = {187},
  year         = {2024},
  url          = {https://doi.org/10.3390/fi16060187},
  doi          = {10.3390/FI16060187},
  timestamp    = {Sun, 08 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fi/GuerraMACSS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/VillaizanValleladoSCS24,
  author       = {Mario Villaiz{\'{a}}n{-}Vallelado and
                  Matteo Salvatori and
                  Bel{\'{e}}n Carro and
                  Antonio Javier S{\'{a}}nchez{-}Esguevillas},
  title        = {Graph Neural Network contextual embedding for Deep Learning on tabular
                  data},
  journal      = {Neural Networks},
  volume       = {173},
  pages        = {106180},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.neunet.2024.106180},
  doi          = {10.1016/J.NEUNET.2024.106180},
  timestamp    = {Sat, 08 Jun 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nn/VillaizanValleladoSCS24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/software/LorenzoLopezMJPHP24,
  author       = {Alvaro Lorenzo{-}Lopez and
                  Ashley Morris and
                  Owain Jones and
                  Alexander B. Phillips and
                  Mario Hern{\'{a}}ndez{-}Tejera and
                  Adri{\'{a}}n Pe{\~{n}}ate S{\'{a}}nchez},
  title        = {Developing a Reconfigurable Architecture for the Remote Operation
                  of Marine Autonomous Systems},
  journal      = {{IEEE} Softw.},
  volume       = {41},
  number       = {4},
  pages        = {160--170},
  year         = {2024},
  url          = {https://doi.org/10.1109/MS.2023.3317065},
  doi          = {10.1109/MS.2023.3317065},
  timestamp    = {Thu, 04 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/software/LorenzoLopezMJPHP24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/MateosRuizPHAMMC24,
  author       = {Pablo Mateos{-}Ruiz and
                  Mario Perez{-}Escribano and
                  Alberto Hern{\'{a}}ndez{-}Escobar and
                  Elena Abdo{-}S{\'{a}}nchez and
                  Enrique Marquez{-}Segura and
                  Teresa M. Mart{\'{\i}}n{-}Guerrero and
                  Carlos Camacho{-}Pe{\~{n}}alosa},
  title        = {Time-Domain Characterization of Nematic Liquid Crystals Using Additive
                  Manufacturing Microstrip Lines},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {73},
  pages        = {1--8},
  year         = {2024},
  url          = {https://doi.org/10.1109/TIM.2024.3413162},
  doi          = {10.1109/TIM.2024.3413162},
  timestamp    = {Fri, 02 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/MateosRuizPHAMMC24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/Fernandez-Morales24,
  author       = {Enrique Fern{\'{a}}ndez{-}Morales and
                  Carlos Luis S{\'{a}}nchez{-}Bocanegra and
                  Rafael Pastor Vargas and
                  Jos{\'{e}}{-}Juan Pereyra{-}Rodriguez and
                  Juan Mario Haut and
                  Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades},
  title        = {Analysis and Detection of Melanoma through Collective Intelligence
                  with {AI}},
  booktitle    = {37th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2024, Guadalajara, Mexico, June 26-28, 2024},
  pages        = {75--80},
  year         = {2024},
  crossref     = {DBLP:conf/cbms/2024},
  url          = {https://doi.org/10.1109/CBMS61543.2024.00021},
  doi          = {10.1109/CBMS61543.2024.00021},
  timestamp    = {Wed, 07 Aug 2024 14:16:11 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/Fernandez-Morales24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/EntrenaSGPGLS23,
  author       = {Luis Entrena and
                  Antonio J. Sanchez{-}Clemente and
                  Luis {\'{A}}ngel Garc{\'{\i}}a{-}Astudillo and
                  Marta Portela{-}Garc{\'{\i}}a and
                  Mario Garc{\'{\i}}a{-}Valderas and
                  Almudena Lindoso and
                  Roberto Sarmiento},
  title        = {Formal Verification of Fault-Tolerant Hardware Designs},
  journal      = {{IEEE} Access},
  volume       = {11},
  pages        = {116127--116140},
  year         = {2023},
  url          = {https://doi.org/10.1109/ACCESS.2023.3325616},
  doi          = {10.1109/ACCESS.2023.3325616},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/EntrenaSGPGLS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/OrtizTorresMSMR23,
  author       = {Gerardo Ortiz{-}Torres and
                  Jesse Yoe Rumbo Morales and
                  Ren{\'{e}} Osorio S{\'{a}}nchez and
                  Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and
                  Marco Antonio Rodr{\'{\i}}guez{-}Blanco},
  title        = {Fault Tolerant Control via Input-Output Linearization Method for LED-Driver
                  Using a Boost Converter},
  journal      = {{IEEE} Access},
  volume       = {11},
  pages        = {10390--10397},
  year         = {2023},
  url          = {https://doi.org/10.1109/ACCESS.2023.3235348},
  doi          = {10.1109/ACCESS.2023.3235348},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/OrtizTorresMSMR23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amcs/OrdazASO23,
  author       = {Patricio Ordaz and
                  Hussain Alazki and
                  Bonifacio Sanchez and
                  Mario Ordaz{-}Oliver},
  title        = {On the finite time stabilization via robust control for uncertain
                  disturbed systems},
  journal      = {Int. J. Appl. Math. Comput. Sci.},
  volume       = {33},
  number       = {1},
  year         = {2023},
  url          = {https://doi.org/10.34768/amcs-2023-0006},
  doi          = {10.34768/AMCS-2023-0006},
  timestamp    = {Sat, 06 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/amcs/OrdazASO23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/MadrugaCP23,
  author       = {Mario Madruga and
                  Yolanda Campos{-}Roca and
                  Carlos J. P{\'{e}}rez},
  title        = {Addressing smartphone mismatch in Parkinson's disease detection aid
                  systems based on speech},
  journal      = {Biomed. Signal Process. Control.},
  volume       = {80},
  number       = {Part},
  pages        = {104281},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.bspc.2022.104281},
  doi          = {10.1016/J.BSPC.2022.104281},
  timestamp    = {Thu, 01 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bspc/MadrugaCP23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/complexity/RoldanCaballeroPHSPRVMGM23,
  author       = {Alfredo Rold{\'{a}}n{-}Caballero and
                  Jose Humberto P{\'{e}}rez{-}Cruz and
                  Eduardo Hern{\'{a}}ndez{-}M{\'{a}}rquez and
                  Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and
                  Mario Ponce{-}Silva and
                  Jos{\'{e}} de Jes{\'{u}}s Rubio and
                  Miguel Gabriel Villarreal{-}Cervantes and
                  Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez and
                  Enrique Garc{\'{\i}}a{-}Trinidad and
                  Alejandro Mendoza{-}Chegue},
  title        = {Synchronization of a New Chaotic System Using Adaptive Control: Design
                  and Experimental Implementation},
  journal      = {Complex.},
  volume       = {2023},
  pages        = {2881192:1--2881192:22},
  year         = {2023},
  url          = {https://doi.org/10.1155/2023/2881192},
  doi          = {10.1155/2023/2881192},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/complexity/RoldanCaballeroPHSPRVMGM23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comsur/BeltranPSBBPPC23,
  author       = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and
                  Mario Quiles P{\'{e}}rez and
                  Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and
                  Sergio L{\'{o}}pez Bernal and
                  G{\'{e}}r{\^{o}}me Bovet and
                  Manuel Gil P{\'{e}}rez and
                  Gregorio Mart{\'{\i}}nez P{\'{e}}rez and
                  Alberto Huertas Celdr{\'{a}}n},
  title        = {Decentralized Federated Learning: Fundamentals, State of the Art,
                  Frameworks, Trends, and Challenges},
  journal      = {{IEEE} Commun. Surv. Tutorials},
  volume       = {25},
  number       = {4},
  pages        = {2983--3013},
  year         = {2023},
  url          = {https://doi.org/10.1109/COMST.2023.3315746},
  doi          = {10.1109/COMST.2023.3315746},
  timestamp    = {Sun, 17 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/comsur/BeltranPSBBPPC23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/VillarFEMP23,
  author       = {Erika Yolanda Aguilar del Villar and
                  Mario Alberto S{\'{a}}nchez Flores and
                  Jes{\'{u}}s Jaime Moreno Escobar and
                  Oswaldo Morales Matamoros and
                  Ricardo Tejeida Padilla},
  title        = {Power Spectral Analysis of Bioacoustic Signals Emitted by a Bottlenose
                  Dolphin when Performing Assisted Therapy},
  journal      = {Computaci{\'{o}}n y Sistemas (CyS)},
  volume       = {27},
  number       = {1},
  year         = {2023},
  url          = {https://cys.cic.ipn.mx/ojs/index.php/CyS/article/view/4564},
  timestamp    = {Tue, 23 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cys/VillarFEMP23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eait/RojasSanchezPF23,
  author       = {Mario A. Rojas{-}S{\'{a}}nchez and
                  Pedro R. Palos{-}Sanchez and
                  Jos{\'{e}} A. Folgado{-}Fern{\'{a}}ndez},
  title        = {Systematic literature review and bibliometric analysis on virtual
                  reality and education},
  journal      = {Educ. Inf. Technol.},
  volume       = {28},
  number       = {1},
  pages        = {155--192},
  year         = {2023},
  url          = {https://doi.org/10.1007/s10639-022-11167-5},
  doi          = {10.1007/S10639-022-11167-5},
  timestamp    = {Tue, 28 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eait/RojasSanchezPF23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/CabreraQCSGSL23,
  author       = {Diego Cabrera and
                  Mar{\'{\i}}a J. Quinteros and
                  Mariela Cerrada and
                  Ren{\'{e}}{-}Vinicio S{\'{a}}nchez and
                  Mario Guallpa and
                  Fernando Sancho and
                  Chuan Li},
  title        = {Rainfall Forecasting using a Bayesian framework and Long Short-Term
                  Memory Multi-model Estimation based on an hourly meteorological monitoring
                  network. Case of study: Andean Ecuadorian Tropical City},
  journal      = {Earth Sci. Informatics},
  volume       = {16},
  number       = {2},
  pages        = {1373--1388},
  year         = {2023},
  url          = {https://doi.org/10.1007/s12145-023-00958-0},
  doi          = {10.1007/S12145-023-00958-0},
  timestamp    = {Tue, 30 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/esi/CabreraQCSGSL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/SanchezZasVVLMB23,
  author       = {Carmen S{\'{a}}nchez{-}Zas and
                  V{\'{\i}}ctor A. Villagr{\'{a}} and
                  Mario Vega{-}Barbas and
                  Xavier Larriva{-}Novo and
                  Jos{\'{e}} Ignacio Moreno and
                  Julio Berrocal},
  title        = {Ontology-based approach to real-time risk management and cyber-situational
                  awareness},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {141},
  pages        = {462--472},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.future.2022.12.006},
  doi          = {10.1016/J.FUTURE.2022.12.006},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/fgcs/SanchezZasVVLMB23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/finr/HaraldsenHMRMAAAAABBBBCCCCDBDDGGGG23,
  author       = {Ira R. J. Hebold Haraldsen and
                  Christoffer Hatlestad{-}Hall and
                  Camillo Marra and
                  Hanna Renvall and
                  Fernando Maest{\'{u}} and
                  Jorge Acosta{-}Hern{\'{a}}ndez and
                  Soraya Alfonsin and
                  Vebj{\o}rn Andersson and
                  Abhilash Anand and
                  Victor Ayll{\'{o}}n and
                  Aleksandar Babic and
                  Asma Belhadi and
                  Cindy Birck and
                  Ricardo Bru{\~{n}}a and
                  Naike Caraglia and
                  Claudia Carrarini and
                  Erik Christensen and
                  Americo Cicchetti and
                  Signe Daugbjerg and
                  Rossella Di Bidino and
                  Ana Diaz{-}Ponce and
                  Ainar Drews and
                  Guido Maria Giuffr{\`{e}} and
                  Jean Georges and
                  Pedro Gil{-}Gregorio and
                  Dianne Gove and
                  Tim M. Govers and
                  Harry Hallock and
                  Marja Hietanen and
                  Lone Holmen and
                  Jaakko Hotta and
                  Samuel Kaski and
                  Rabindra Khadka and
                  Antti S. Kinnunen and
                  Anne M. Koivisto and
                  Shrikanth Kulashekhar and
                  Denis Larsen and
                  Mia Liljestr{\"{o}}m and
                  Pedro G. Lind and
                  Alberto Marcos Dolado and
                  Serena Elizabeth Marshall and
                  Susanne Merz and
                  Francesca Miraglia and
                  Juha Montonen and
                  Ville M{\"{a}}ntynen and
                  Anne Rita {\O}kseng{\aa}rd and
                  Javier Olazar{\'{a}}n and
                  Teemu Paajanen and
                  Jos{\'{e}} M. Pe{\~{n}}a and
                  Lu{\'{\i}}s Pe{\~{n}}a and
                  Daniel lrabien Peniche and
                  Ana S. P{\'{e}}rez and
                  Mohamed Radwan and
                  Federico Ram{\'{\i}}rez{-}Tora{\~{n}}o and
                  Andrea Rodr{\'{\i}}guez{-}Pedrero and
                  Timo Saarinen and
                  Mario Salas{-}Carrillo and
                  Riitta Salmelin and
                  Sonia Sousa and
                  Abdillah Suyuthi and
                  Mathias Toft and
                  Pablo Toharia and
                  Thomas Tveitst{\o}l and
                  Mats Tveter and
                  Ramesh Upreti and
                  Robin J. Vermeulen and
                  Fabrizio Vecchio and
                  Anis Yazidi and
                  Paolo Maria Rossini},
  title        = {Intelligent digital tools for screening of brain connectivity and
                  dementia risk estimation in people affected by mild cognitive impairment:
                  the AI-Mind clinical study protocol},
  journal      = {Frontiers Neurorobotics},
  volume       = {17},
  year         = {2023},
  url          = {https://doi.org/10.3389/fnbot.2023.1289406},
  doi          = {10.3389/FNBOT.2023.1289406},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/finr/HaraldsenHMRMAAAAABBBBCCCCDBDDGGGG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcise/PenaCMCS23,
  author       = {Mario Pe{\~{n}}a and
                  Mariela Cerrada and
                  Rub{\'{e}}n Medina and
                  Diego Cabrera and
                  Ren{\'{e}}{-}Vinicio S{\'{a}}nchez},
  title        = {Poincar{\'{e}} Plot Features and Statistical Features From Current
                  and Vibration Signals for Fault Severity Classification of Helical
                  Gear Tooth Breaks},
  journal      = {J. Comput. Inf. Sci. Eng.},
  volume       = {23},
  number       = {2},
  year         = {2023},
  url          = {https://doi.org/10.1115/1.4054574},
  doi          = {10.1115/1.4054574},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jcise/PenaCMCS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jirs/SanchezSanchezHGRFFF23,
  author       = {A. G. Sanchez{-}Sanchez and
                  Eduardo Gamaliel Hern{\'{a}}ndez{-}Mart{\'{\i}}nez and
                  Jaime Gonz{\'{a}}lez{-}Sierra and
                  Mario Ramirez{-}Neria and
                  Jos{\'{e}}{-}Job Flores{-}Godoy and
                  Enrique D. Ferreira and
                  Guillermo Fern{\'{a}}ndez{-}Anaya},
  title        = {Leader-Follower Power-based Formation Control Applied to Differential-drive
                  Mobile Robots},
  journal      = {J. Intell. Robotic Syst.},
  volume       = {107},
  number       = {1},
  pages        = {6},
  year         = {2023},
  url          = {https://doi.org/10.1007/s10846-022-01796-w},
  doi          = {10.1007/S10846-022-01796-W},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jirs/SanchezSanchezHGRFFF23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kybernetes/BuitragoFlorezSRHH23,
  author       = {Francisco Buitrago{-}Florez and
                  Mario Sanchez and
                  Vanessa Perez Romanello and
                  Carola Hernandez and
                  Marcela Hern{\'{a}}ndez Hoyos},
  title        = {A systematic approach for curriculum redesign of introductory courses
                  in engineering: a programming course case study},
  journal      = {Kybernetes},
  volume       = {52},
  number       = {10},
  pages        = {3904--3917},
  year         = {2023},
  url          = {https://doi.org/10.1108/K-10-2021-0957},
  doi          = {10.1108/K-10-2021-0957},
  timestamp    = {Thu, 03 Oct 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/kybernetes/BuitragoFlorezSRHH23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mta/OlivaONREMN23,
  author       = {Diego Oliva and
                  No{\'{e}} Ortega{-}S{\'{a}}nchez and
                  Mario A. Navarro and
                  Alfonso Ramos{-}Michel and
                  Mohammed El{-}Abd and
                  Seyed Jalaleddin Mousavirad and
                  Mohammad H. Nadimi{-}Shahraki},
  title        = {Segmentation of thermographies from electronic systems by using the
                  global-best brain storm optimization algorithm},
  journal      = {Multim. Tools Appl.},
  volume       = {82},
  number       = {29},
  pages        = {44911--44941},
  year         = {2023},
  url          = {https://doi.org/10.1007/s11042-023-15059-9},
  doi          = {10.1007/S11042-023-15059-9},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/mta/OlivaONREMN23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/GirardRTAANPBABGOBPBSDSCBPFS23,
  author       = {Gabriel Girard and
                  Jonathan Rafael{-}Patino and
                  Rapha{\"{e}}l Truffet and
                  Dogu Baran Aydogan and
                  Nagesh Adluru and
                  Veena A. Nair and
                  Vivek Prabhakaran and
                  Barbara B. Bendlin and
                  Andrew L. Alexander and
                  Sara Bosticardo and
                  Ilaria Gabusi and
                  Mario Ocampo{-}Pineda and
                  Matteo Battocchio and
                  Zuzana Piskorova and
                  Pietro Bontempi and
                  Simona Schiavi and
                  Alessandro Daducci and
                  Aleksandra Stafiej and
                  Dominika Ciupek and
                  Fabian Bogusz and
                  Tomasz Pieciak and
                  Matteo Frigo and
                  Sara Sedlar and
                  Samuel Deslauriers{-}Gauthier and
                  Ivana Kojcic and
                  Mauro Zucchelli and
                  Hiba Laghrissi and
                  Yang Ji and
                  Rachid Deriche and
                  Kurt G. Schilling and
                  Bennett A. Landman and
                  Alberto Cacciola and
                  Gianpaolo Antonio Basile and
                  Salvatore Bertino and
                  Nancy Newlin and
                  Praitayini Kanakaraj and
                  Francois Rheault and
                  Patryk Filipiak and
                  Timothy M. Shepherd and
                  Ying{-}Chia Lin and
                  Dimitris G. Placantonakis and
                  Fernando E. Boada and
                  Steven H. Baete and
                  Erick Hernandez{-}Gutierrez and
                  Alonso Ramirez{-}Manzanares and
                  Ricardo Coronado{-}Leija and
                  Pablo Stack{-}S{\'{a}}nchez and
                  Luis Concha and
                  Maxime Descoteaux and
                  Sina Mansour L and
                  Caio Seguin and
                  Andrew Zalesky and
                  Kenji Marshall and
                  Erick Jorge Canales{-}Rodr{\'{\i}}guez and
                  Ye Wu and
                  Sahar Ahmad and
                  Pew{-}Thian Yap and
                  Antoine Th{\'{e}}berge and
                  Florence Gagnon and
                  Fr{\'{e}}d{\'{e}}ric Massi and
                  Elda Fischi Gomez and
                  Remy Gardier and
                  Juan Luis Villarreal{-}Haro and
                  Marco Pizzolato and
                  Emmanuel Caruyer and
                  Jean{-}Philippe Thiran},
  title        = {Tractography passes the test: Results from the diffusion-simulated
                  connectivity (disco) challenge},
  journal      = {NeuroImage},
  volume       = {277},
  pages        = {120231},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.neuroimage.2023.120231},
  doi          = {10.1016/J.NEUROIMAGE.2023.120231},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/neuroimage/GirardRTAANPBABGOBPBSDSCBPFS23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/HerreraCoyCHBCDSF23,
  author       = {Mar{\'{\i}}a Camila Herrera{-}Coy and
                  Laura Paola Calder{\'{o}}n and
                  Iv{\'{a}}n Leonardo Herrera{-}P{\'{e}}rez and
                  Paul Esteban Bravo{-}L{\'{o}}pez and
                  Christian Conoscenti and
                  Jorge Delgado and
                  Mario S{\'{a}}nchez{-}G{\'{o}}mez and
                  Tom{\'{a}}s Fern{\'{a}}ndez},
  title        = {Landslide Susceptibility Analysis on the Vicinity of Bogot{\'{a}}-Villavicencio
                  Road (Eastern Cordillera of the Colombian Andes)},
  journal      = {Remote. Sens.},
  volume       = {15},
  number       = {15},
  pages        = {3870},
  year         = {2023},
  url          = {https://doi.org/10.3390/rs15153870},
  doi          = {10.3390/RS15153870},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/HerreraCoyCHBCDSF23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Fernandez-Gorgojo23,
  author       = {Mario Fern{\'{a}}ndez{-}Gorgojo and
                  Diana Salas{-}G{\'{o}}mez and
                  Pascual S{\'{a}}nchez{-}Juan and
                  Esther Laguna{-}Bercero and
                  Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez},
  title        = {Analysis of Dynamic Plantar Pressure and Influence of Clinical-Functional
                  Measures on Their Performance in Subjects with Bimalleolar Ankle Fracture
                  at 6 and 12 Months Post-Surgery},
  journal      = {Sensors},
  volume       = {23},
  number       = {8},
  pages        = {3975},
  year         = {2023},
  url          = {https://doi.org/10.3390/s23083975},
  doi          = {10.3390/S23083975},
  timestamp    = {Fri, 07 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/Fernandez-Gorgojo23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/GraciaOCISDA23,
  author       = {Desir{\'{e}}e I. Gracia and
                  Mario Ort{\'{\i}}z and
                  Tatiana Candela and
                  Eduardo I{\'{a}}{\~{n}}ez and
                  Rosa M. S{\'{a}}nchez and
                  Carmina D{\'{\i}}az and
                  Jos{\'{e}} Mar{\'{\i}}a Azor{\'{\i}}n},
  title        = {Design and Evaluation of a Potential Non-Invasive Neurostimulation
                  Strategy for Treating Persistent Anosmia in Post-COVID-19 Patients},
  journal      = {Sensors},
  volume       = {23},
  number       = {13},
  pages        = {5880},
  year         = {2023},
  url          = {https://doi.org/10.3390/s23135880},
  doi          = {10.3390/S23135880},
  timestamp    = {Thu, 31 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/GraciaOCISDA23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/MartinezAPMBABL23,
  author       = {Raquel Martinez and
                  Alberto Arroyo and
                  Alberto Pigazo and
                  Mario Manana and
                  Eduardo Bayona and
                  Francisco J. Azcondo and
                  Sergio Bustamante and
                  Alberto Laso},
  title        = {Acoustic Noise-Based Detection of Ferroresonance Events in Isolated
                  Neutral Power Systems with Inductive Voltage Transformers},
  journal      = {Sensors},
  volume       = {23},
  number       = {1},
  pages        = {195},
  year         = {2023},
  url          = {https://doi.org/10.3390/s23010195},
  doi          = {10.3390/S23010195},
  timestamp    = {Thu, 26 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sensors/MartinezAPMBABL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Sanchez-Fernandez23,
  author       = {Luis Pastor S{\'{a}}nchez{-}Fern{\'{a}}ndez and
                  Luis Alejandro S{\'{a}}nchez{-}P{\'{e}}rez and
                  Jos{\'{e}} Juan Carbajal Hern{\'{a}}ndez and
                  Mario Alberto Hern{\'{a}}ndez{-}Guerrero and
                  Lucrecia P{\'{e}}rez{-}Echazabal},
  title        = {Buildings' Biaxial Tilt Assessment Using Inertial Wireless Sensors
                  and a Parallel Training Model},
  journal      = {Sensors},
  volume       = {23},
  number       = {11},
  pages        = {5352},
  year         = {2023},
  url          = {https://doi.org/10.3390/s23115352},
  doi          = {10.3390/S23115352},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/Sanchez-Fernandez23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/Sanchez-RinzaSL23,
  author       = {B{\'{a}}rbara Emma S{\'{a}}nchez{-}Rinza and
                  Carlos Ignacio Robledo S{\'{a}}nchez and
                  Mario Rossainz L{\'{o}}pez},
  title        = {Usability in a Mixed Cryptography and Hardware Security System},
  booktitle    = {Proceedings of the {XI} Latin American Conference on Human Computer
                  Interaction, {CLIHC} 2023, Puebla, Mexico, 30 October 2023- 1 November
                  2023},
  pages        = {10:1--10:5},
  year         = {2023},
  crossref     = {DBLP:conf/clihc/2023},
  url          = {https://doi.org/10.1145/3630970.3631051},
  doi          = {10.1145/3630970.3631051},
  timestamp    = {Mon, 15 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/clihc/Sanchez-RinzaSL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/VelandiaHBSV23,
  author       = {Paula Velandia and
                  Andrea Herrera and
                  L. Mar{\'{\i}}a Jos{\'{e}} Bonilla and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Driving Innovation in Industry 4.0 Through Business Model Simulation},
  booktitle    = {Enterprise Design, Operations, and Computing. {EDOC} 2023 Workshops
                  - IDAMS, iRESEARCH, MIDas4CS, SoEA4EE, {EDOC} Forum, Demonstrations
                  Track and Doctoral Consortium, Groningen, The Netherlands, October
                  30 - November 3, 2023, Revised Selected Papers},
  pages        = {23--38},
  year         = {2023},
  crossref     = {DBLP:conf/edoc/2023w},
  url          = {https://doi.org/10.1007/978-3-031-54712-6\_2},
  doi          = {10.1007/978-3-031-54712-6\_2},
  timestamp    = {Mon, 15 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/edoc/VelandiaHBSV23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icaisc/SanchezMQ23,
  author       = {Sergio Sanchez and
                  Javier Machacuay and
                  Mario Quinde},
  title        = {Federated Learning for Human Activity Recognition on the MHealth Dataset},
  booktitle    = {Artificial Intelligence and Soft Computing - 22nd International Conference,
                  {ICAISC} 2023, Zakopane, Poland, June 18-22, 2023, Proceedings, Part
                  {I}},
  pages        = {215--225},
  year         = {2023},
  crossref     = {DBLP:conf/icaisc/2023-1},
  url          = {https://doi.org/10.1007/978-3-031-42505-9\_19},
  doi          = {10.1007/978-3-031-42505-9\_19},
  timestamp    = {Sun, 24 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icaisc/SanchezMQ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/BravoMPRM23,
  author       = {J. Juan Avil{\'{e}}s Bravo and
                  Alfredo Morales{-}S{\'{a}}nchez and
                  Liliana Palacios{-}Huerta and
                  J. Federico Ramirez Rios and
                  Mario Moreno},
  title        = {Improved Photoluminescence Intensity of Silicon Rich Oxide Film by
                  Surface Etching},
  booktitle    = {20th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2023, Mexico City, Mexico, October
                  25-27, 2023},
  pages        = {1--6},
  year         = {2023},
  crossref     = {DBLP:conf/iceee/2023},
  url          = {https://doi.org/10.1109/CCE60043.2023.10332833},
  doi          = {10.1109/CCE60043.2023.10332833},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/BravoMPRM23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/CazcarraBesBLDDSC23,
  author       = {Victor Cazcarra{-}Bes and
                  Mario Busquier and
                  Juan M. Lopez{-}Sanchez and
                  Michael Duersch and
                  Shaunak De and
                  Craig Stringham and
                  Davide Castelleti},
  title        = {Assessment of Multi-Temporal Capella {SAR} Data for Change Detection
                  and Crop Monitoring},
  booktitle    = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
                  2023, Pasadena, CA, USA, July 16-21, 2023},
  pages        = {3410--3413},
  year         = {2023},
  crossref     = {DBLP:conf/igarss/2023},
  url          = {https://doi.org/10.1109/IGARSS52108.2023.10281689},
  doi          = {10.1109/IGARSS52108.2023.10281689},
  timestamp    = {Tue, 07 Nov 2023 16:21:25 +0100},
  biburl       = {https://dblp.org/rec/conf/igarss/CazcarraBesBLDDSC23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/VillarroyaCarpioBLE23,
  author       = {Arturo Villarroya{-}Carpio and
                  Mario Busquier and
                  Juan M. Lopez{-}Sanchez and
                  Marcus E. Engdahl},
  title        = {{C-} and X-Band Repeat-Pass Coherence for Crop-Type Mapping and Monitoring},
  booktitle    = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
                  2023, Pasadena, CA, USA, July 16-21, 2023},
  pages        = {425--428},
  year         = {2023},
  crossref     = {DBLP:conf/igarss/2023},
  url          = {https://doi.org/10.1109/IGARSS52108.2023.10281890},
  doi          = {10.1109/IGARSS52108.2023.10281890},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/igarss/VillarroyaCarpioBLE23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vts/AhmadilivaniBBBDTGJRRST23,
  author       = {Mohammad Hasan Ahmadilivani and
                  Mario Barbareschi and
                  Salvatore Barone and
                  Alberto Bosio and
                  Masoud Daneshtalab and
                  Salvatore Della Torca and
                  Gabriele Gavarini and
                  Maksim Jenihhin and
                  Jaan Raik and
                  Annachiara Ruospo and
                  Ernesto S{\'{a}}nchez and
                  Mahdi Taheri},
  title        = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators},
  booktitle    = {41st {IEEE} {VLSI} Test Symposium, {VTS} 2023, San Diego, CA, USA,
                  April 24-26, 2023},
  pages        = {1--10},
  year         = {2023},
  crossref     = {DBLP:conf/vts/2023},
  url          = {https://doi.org/10.1109/VTS56346.2023.10140043},
  doi          = {10.1109/VTS56346.2023.10140043},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/vts/AhmadilivaniBBBDTGJRRST23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/23/SavaglioSFACMRRB23,
  author       = {Claudio Savaglio and
                  Giandomenico Spezzano and
                  Giancarlo Fortino and
                  Mario Alejandro Paguay Alvarado and
                  Fabio Capparelli and
                  Gianmarco Marcello and
                  Luigi Rachiele and
                  Francesco Raco and
                  Samantha Genoveva Sanchez Basantes},
  title        = {Edge Intelligence Against {COVID-19:} {A} Smart University Campus
                  Case Study},
  booktitle    = {IoT Edge Solutions for Cognitive Buildings - Technology, Communications
                  and Computing},
  pages        = {221--243},
  year         = {2023},
  crossref     = {DBLP:books/sp/23/CGVS2023},
  url          = {https://doi.org/10.1007/978-3-031-15160-6\_10},
  doi          = {10.1007/978-3-031-15160-6\_10},
  timestamp    = {Sun, 25 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/23/SavaglioSFACMRRB23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2303-06455,
  author       = {Mario Villaiz{\'{a}}n{-}Vallelado and
                  Matteo Salvatori and
                  Bel{\'{e}}n Carro Mart{\'{\i}}nez and
                  Antonio Javier S{\'{a}}nchez{-}Esguevillas},
  title        = {Graph Neural Network contextual embedding for Deep Learning on Tabular
                  Data},
  journal      = {CoRR},
  volume       = {abs/2303.06455},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2303.06455},
  doi          = {10.48550/ARXIV.2303.06455},
  eprinttype    = {arXiv},
  eprint       = {2303.06455},
  timestamp    = {Thu, 16 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2303-06455.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2306-04645,
  author       = {Mohammad Hasan Ahmadilivani and
                  Mario Barbareschi and
                  Salvatore Barone and
                  Alberto Bosio and
                  Masoud Daneshtalab and
                  Salvatore Della Torca and
                  Gabriele Gavarini and
                  Maksim Jenihhin and
                  Jaan Raik and
                  Annachiara Ruospo and
                  Ernesto S{\'{a}}nchez and
                  Mahdi Taheri},
  title        = {Special Session: Approximation and Fault Resiliency of {DNN} Accelerators},
  journal      = {CoRR},
  volume       = {abs/2306.04645},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2306.04645},
  doi          = {10.48550/ARXIV.2306.04645},
  eprinttype    = {arXiv},
  eprint       = {2306.04645},
  timestamp    = {Wed, 14 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2306-04645.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Calderon-Ramirez22,
  author       = {Mario Calder{\'{o}}n{-}Ram{\'{\i}}rez and
                  Jes{\'{u}}s A. G{\'{o}}mez{-}N{\'{a}}fate and
                  Ramiro Rico{-}Mart{\'{\i}}nez and
                  Ram{\'{o}}n Rodr{\'{\i}}guez{-}Castro and
                  Micael{-}G. Bravo{-}S{\'{a}}nchez and
                  Luis A. Alcaraz{-}Caracheo},
  title        = {Improvement of Ohmic Pasteurization in Mango Pulp Through {CFD} and
                  {RSM}},
  journal      = {{IEEE} Access},
  volume       = {10},
  pages        = {81380--81389},
  year         = {2022},
  url          = {https://doi.org/10.1109/ACCESS.2022.3193391},
  doi          = {10.1109/ACCESS.2022.3193391},
  timestamp    = {Thu, 25 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/Calderon-Ramirez22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Garza-FabreSAB22,
  author       = {Mario Garza{-}Fabre and
                  Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and
                  Edwin Aldana{-}Bobadilla and
                  Ricardo Landa Becerra},
  title        = {Decision Making in Evolutionary Multiobjective Clustering: {A} Machine
                  Learning Challenge},
  journal      = {{IEEE} Access},
  volume       = {10},
  pages        = {117281--117303},
  year         = {2022},
  url          = {https://doi.org/10.1109/ACCESS.2022.3219854},
  doi          = {10.1109/ACCESS.2022.3219854},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/Garza-FabreSAB22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Maya-RodriguezL22,
  author       = {Mario C. Maya{-}Rodriguez and
                  Mario A. L{\'{o}}pez{-}Pacheco and
                  Yair Lozano{-}Hern{\'{a}}ndez and
                  Victor G. S{\'{a}}nchez{-}Meza and
                  Luis A. Cantera Cantera and
                  Ren{\'{e}} Tolentino{-}Eslava},
  title        = {Integration of {CNN} in a Dynamic Model-Based Controller for Control
                  of a 2DOF Helicopter With Tail Rotor Perturbations},
  journal      = {{IEEE} Access},
  volume       = {10},
  pages        = {73474--73483},
  year         = {2022},
  url          = {https://doi.org/10.1109/ACCESS.2022.3189353},
  doi          = {10.1109/ACCESS.2022.3189353},
  timestamp    = {Thu, 25 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/Maya-RodriguezL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bioinformatics/SanchezAMCO22,
  author       = {Daniel Jim{\'{e}}nez S{\'{a}}nchez and
                  Mikel Ariz and
                  Jos{\'{e}} M{\'{a}}rio Morgado and
                  Iv{\'{a}}n Cort{\'{e}}s{-}Dom{\'{\i}}nguez and
                  Carlos Ortiz{-}de{-}Sol{\'{o}}rzano},
  title        = {Corrigendum to: {NMF-RI:} blind spectral unmixing of highly mixed
                  multispectral flow and image cytometry data},
  journal      = {Bioinform.},
  volume       = {38},
  number       = {6},
  pages        = {1779},
  year         = {2022},
  url          = {https://doi.org/10.1093/bioinformatics/btab796},
  doi          = {10.1093/BIOINFORMATICS/BTAB796},
  timestamp    = {Tue, 22 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bioinformatics/SanchezAMCO22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/GalvezGGA22,
  author       = {Alba Maribel S{\'{a}}nchez G{\'{a}}lvez and
                  Ricardo {\'{A}}lvarez{-}Gonz{\'{a}}lez and
                  Sully S{\'{a}}nchez G{\'{a}}lvez and
                  Mario Anzures{-}Garc{\'{\i}}a},
  title        = {Model to Predict the Result of a Soccer Match Based on the Number
                  of Goals Scored by a Single Team},
  journal      = {Computaci{\'{o}}n y Sistemas},
  volume       = {26},
  number       = {1},
  year         = {2022},
  url          = {https://doi.org/10.13053/cys-26-1-4172},
  doi          = {10.13053/CYS-26-1-4172},
  timestamp    = {Fri, 09 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cys/GalvezGGA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ec/SanchezG22,
  author       = {Claudia N. S{\'{a}}nchez and
                  Mario Graff},
  title        = {Selection Heuristics on Semantic Genetic Programming for Classification
                  Problems},
  journal      = {Evol. Comput.},
  volume       = {30},
  number       = {2},
  pages        = {253--289},
  year         = {2022},
  url          = {https://doi.org/10.1162/evco\_a\_00297},
  doi          = {10.1162/EVCO\_A\_00297},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ec/SanchezG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/esi/Gonzalez-Herrera22,
  author       = {Roger Gonzalez{-}Herrera and
                  Mario Cortazar{-}Cepeda and
                  Ismael S{\'{a}}nchez{-}Pinto and
                  Javier Canto{-}Rios},
  title        = {A homogeneous approach in modeling a coastal karst aquifer},
  journal      = {Earth Sci. Informatics},
  volume       = {15},
  number       = {3},
  pages        = {1825--1840},
  year         = {2022},
  url          = {https://doi.org/10.1007/s12145-022-00841-4},
  doi          = {10.1007/S12145-022-00841-4},
  timestamp    = {Sat, 10 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/esi/Gonzalez-Herrera22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GomezCSCV22,
  author       = {Manuel J. Gomez and
                  Mario Calder{\'{o}}n and
                  Victor S{\'{a}}nchez and
                  F{\'{e}}lix J. Garc{\'{\i}}a Clemente and
                  Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente},
  title        = {Large scale analysis of open {MOOC} reviews to support learners' course
                  selection},
  journal      = {Expert Syst. Appl.},
  volume       = {210},
  pages        = {118400},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.eswa.2022.118400},
  doi          = {10.1016/J.ESWA.2022.118400},
  timestamp    = {Mon, 27 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/GomezCSCV22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/DivanRG22,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
                  Silvio Miguel Gonnet},
  title        = {Measurement project interoperability for real-time data gathering
                  systems},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {129},
  pages        = {298--314},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.future.2021.11.031},
  doi          = {10.1016/J.FUTURE.2021.11.031},
  timestamp    = {Wed, 23 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/fgcs/DivanRG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieee-rita/JiSPNJ22,
  author       = {Yi Peng Ji and
                  Ra{\'{u}}l Marticorena S{\'{a}}nchez and
                  Carlos Pardo{-}Aguilar and
                  Carlos L{\'{o}}pez Nozal and
                  Mario Juez{-}Gil},
  title        = {Activity and Dropout Tracking in Moodle Using UBUMonitor Application},
  journal      = {Rev. Iberoam. de Tecnol. del Aprendiz.},
  volume       = {17},
  number       = {3},
  pages        = {307--317},
  year         = {2022},
  url          = {https://doi.org/10.1109/RITA.2022.3191279},
  doi          = {10.1109/RITA.2022.3191279},
  timestamp    = {Thu, 22 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ieee-rita/JiSPNJ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/CrespoNSTP22,
  author       = {Yania Crespo and
                  Carlos L{\'{o}}pez Nozal and
                  Ra{\'{u}}l Marticorena S{\'{a}}nchez and
                  Margarita Gonzalo Tasis and
                  Mario Piattini},
  title        = {The role of awareness and gamification on technical debt management},
  journal      = {Inf. Softw. Technol.},
  volume       = {150},
  pages        = {106946},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.infsof.2022.106946},
  doi          = {10.1016/J.INFSOF.2022.106946},
  timestamp    = {Sat, 10 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/infsof/CrespoNSTP22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/js/Mendez-MonroyMT22,
  author       = {Paul E. Mendez{-}Monroy and
                  E. Cruz May and
                  Mario Jim{\'{e}}nez Torres and
                  J. L. G{\'{o}}mez Hern{\'{a}}ndez and
                  M. Canto Romero and
                  Israel Sanchez Dominguez and
                  Oscar May{-}Tzuc and
                  Ali Bassam},
  title        = {IoT System for the Continuous Electrical and Environmental Monitoring
                  into Mexican Social Housing Evaluated under Tropical Climate Conditions},
  journal      = {J. Sensors},
  volume       = {2022},
  pages        = {1--20},
  year         = {2022},
  url          = {https://doi.org/10.1155/2022/5508713},
  doi          = {10.1155/2022/5508713},
  timestamp    = {Mon, 23 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/js/Mendez-MonroyMT22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/Romero-PuigLB22,
  author       = {Noelia Romero{-}Puig and
                  Juan M. Lopez{-}Sanchez and
                  Mario Busquier},
  title        = {Evaluation of PolInSAR Observables for Crop-Type Mapping Using Bistatic
                  TanDEM-X Data},
  journal      = {{IEEE} Geosci. Remote. Sens. Lett.},
  volume       = {19},
  pages        = {1--5},
  year         = {2022},
  url          = {https://doi.org/10.1109/LGRS.2022.3175689},
  doi          = {10.1109/LGRS.2022.3175689},
  timestamp    = {Mon, 13 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/lgrs/Romero-PuigLB22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22,
  author       = {Carlo Biffi and
                  Pietro Salvagnini and
                  Nhan Ngo Dinh and
                  Cesare Hassan and
                  Prateek Sharma and
                  Giulio Antonelli and
                  Halim Awadie and
                  Sebastian Bernhofer and
                  Sabela Carballal and
                  M{\'{a}}rio Dinis{-}Ribeiro and
                  Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and
                  Gloria Fern{\'{a}}ndez{-}Esparrach and
                  Ian Gralnek and
                  Yuta Higasa and
                  Taku Hirabayashi and
                  Tatsuki Hirai and
                  Mineo Iwatate and
                  Miki Kawano and
                  Markus Mader and
                  Andreas Maieron and
                  Sebastian Mattes and
                  Tastuya Nakai and
                  Ingrid Ordas and
                  Raquel Ortig{\~{a}}o and
                  Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and
                  Maria Pellis{\'{e}} and
                  Cl{\'{a}}udia Pinto and
                  Florian Riedl and
                  Ariadna S{\'{a}}nchez and
                  Emanuel Steiner and
                  Yukari Tanaka and
                  Andrea Cherubini},
  title        = {A novel {AI} device for real-time optical characterization of colorectal
                  polyps},
  journal      = {npj Digit. Medicine},
  volume       = {5},
  year         = {2022},
  url          = {https://doi.org/10.1038/s41746-022-00633-6},
  doi          = {10.1038/S41746-022-00633-6},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/BiffiSDHSAABCDF22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npjdm/BiffiSDHSAABCDF22a,
  author       = {Carlo Biffi and
                  Pietro Salvagnini and
                  Nhan Ngo Dinh and
                  Cesare Hassan and
                  Prateek Sharma and
                  Giulio Antonelli and
                  Halim Awadie and
                  Sebastian Bernhofer and
                  Sabela Carballal and
                  M{\'{a}}rio Dinis{-}Ribeiro and
                  Agn{\`{e}}s Fern{\'{a}}ndez{-}Clotet and
                  Gloria Fern{\'{a}}ndez{-}Esparrach and
                  Ian Gralnek and
                  Yuta Higasa and
                  Taku Hirabayashi and
                  Tatsuki Hirai and
                  Mineo Iwatate and
                  Miki Kawano and
                  Markus Mader and
                  Andreas Maieron and
                  Sebastian Mattes and
                  Tastuya Nakai and
                  Ingrid Ordas and
                  Raquel Ortig{\~{a}}o and
                  Oswaldo Ortiz Z{\'{u}}{\~{n}}iga and
                  Maria Pellis{\'{e}} and
                  Cl{\'{a}}udia Pinto and
                  Florian Riedl and
                  Ariadna S{\'{a}}nchez and
                  Emanuel Steiner and
                  Yukari Tanaka and
                  Andrea Cherubini},
  title        = {Author Correction: {A} novel {AI} device for real-time optical characterization
                  of colorectal polyps},
  journal      = {npj Digit. Medicine},
  volume       = {5},
  year         = {2022},
  url          = {https://doi.org/10.1038/s41746-022-00669-8},
  doi          = {10.1038/S41746-022-00669-8},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npjdm/BiffiSDHSAABCDF22a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Rio-BarralSGA22,
  author       = {Pablo del R{\'{\i}}o{-}Barral and
                  Mario Soil{\'{a}}n and
                  Silvia Mar{\'{\i}}a Gonz{\'{a}}lez{-}Collazo and
                  Pedro Arias},
  title        = {Pavement Crack Detection and Clustering via Region-Growing Algorithm
                  from 3D {MLS} Point Clouds},
  journal      = {Remote. Sens.},
  volume       = {14},
  number       = {22},
  pages        = {5866},
  year         = {2022},
  url          = {https://doi.org/10.3390/rs14225866},
  doi          = {10.3390/RS14225866},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/remotesensing/Rio-BarralSGA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Almanza-OjedaRC22,
  author       = {Dora Luz Almanza{-}Ojeda and
                  Daniela Rodriguez{-}Sotelo and
                  Rogelio Castro{-}Sanchez and
                  Rene Martinez{-}Celorio and
                  Mario Alberto Ibarra{-}Manzano},
  title        = {Stokes Dynamic Polarimeter for Non-Organic and Organic Samples Characterization},
  journal      = {Sensors},
  volume       = {22},
  number       = {6},
  pages        = {2155},
  year         = {2022},
  url          = {https://doi.org/10.3390/s22062155},
  doi          = {10.3390/S22062155},
  timestamp    = {Wed, 18 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/Almanza-OjedaRC22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Contreras-Hernandez22,
  author       = {Jose L. Contreras{-}Hernandez and
                  Dora Luz Almanza{-}Ojeda and
                  Sergio Ledesma and
                  Arturo Garcia{-}Perez and
                  Rogelio Castro{-}Sanchez and
                  Miguel A. Gomez{-}Martinez and
                  Mario Alberto Ibarra{-}Manzano},
  title        = {Geometric Analysis of Signals for Inference of Multiple Faults in
                  Induction Motors},
  journal      = {Sensors},
  volume       = {22},
  number       = {7},
  pages        = {2622},
  year         = {2022},
  url          = {https://doi.org/10.3390/s22072622},
  doi          = {10.3390/S22072622},
  timestamp    = {Wed, 18 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/Contreras-Hernandez22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Fernandez-Gorgojo22,
  author       = {Mario Fern{\'{a}}ndez{-}Gorgojo and
                  Diana Salas{-}G{\'{o}}mez and
                  Pascual S{\'{a}}nchez{-}Juan and
                  David Barbado and
                  Esther Laguna{-}Bercero and
                  Mar{\'{\i}}a Isabel P{\'{e}}rez{-}N{\'{u}}{\~{n}}ez},
  title        = {Clinical-Functional Evaluation and Test-Retest Reliability of the
                  {G-WALK} Sensor in Subjects with Bimalleolar Ankle Fractures 6 Months
                  after Surgery},
  journal      = {Sensors},
  volume       = {22},
  number       = {8},
  pages        = {3050},
  year         = {2022},
  url          = {https://doi.org/10.3390/s22083050},
  doi          = {10.3390/S22083050},
  timestamp    = {Thu, 02 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sensors/Fernandez-Gorgojo22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/BusquierLTF22,
  author       = {Mario Busquier and
                  Juan M. Lopez{-}Sanchez and
                  Francesca Ticconi and
                  Nicolas Floury},
  title        = {Combination of Time Series of L-, C-, and X-Band {SAR} Images for
                  Land Cover and Crop Classification},
  journal      = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
  volume       = {15},
  pages        = {8266--8286},
  year         = {2022},
  url          = {https://doi.org/10.1109/JSTARS.2022.3207574},
  doi          = {10.1109/JSTARS.2022.3207574},
  timestamp    = {Tue, 18 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/staeors/BusquierLTF22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/SaldanhaSMA22,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Configurable Fast Block Partitioning for {VVC} Intra Coding Using
                  Light Gradient Boosting Machine},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {32},
  number       = {6},
  pages        = {3947--3960},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCSVT.2021.3108671},
  doi          = {10.1109/TCSVT.2021.3108671},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/SaldanhaSMA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/Vilchez-Membrilla22,
  author       = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
                  Ignacio Mateos and
                  {\'{A}}ngel Quir{\'{o}}s{-}Oloz{\'{a}}bal and
                  Mario Fern{\'{a}}ndez Pantoja and
                  Clemente Cobos S{\'{a}}nchez},
  title        = {{PCB} Transducer Coil Design for a Low-Noise Magnetic Measurement
                  System in Space Missions},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {71},
  pages        = {1--9},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIM.2022.3217843},
  doi          = {10.1109/TIM.2022.3217843},
  timestamp    = {Tue, 08 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/Vilchez-Membrilla22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnsm/RaghuramuCSSKCL22,
  author       = {Arun Raghuramu and
                  Lianjie Cao and
                  Puneet Sharma and
                  Mario S{\'{a}}nchez and
                  Joon{-}Myung Kang and
                  Chen{-}Nee Chuah and
                  David Lee and
                  Vinay Saxena},
  title        = {Metered Boot: Trusted Framework for Application Usage Rights Management
                  in Virtualized Ecosystems},
  journal      = {{IEEE} Trans. Netw. Serv. Manag.},
  volume       = {19},
  number       = {3},
  pages        = {2238--2250},
  year         = {2022},
  url          = {https://doi.org/10.1109/TNSM.2022.3159191},
  doi          = {10.1109/TNSM.2022.3159191},
  timestamp    = {Mon, 05 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnsm/RaghuramuCSSKCL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/Vilchez-Membrilla22,
  author       = {Jos{\'{e}} Antonio Vilchez{-}Membrilla and
                  Clemente Cobos S{\'{a}}nchez and
                  Carmen Torres Montijano and
                  Ana Pilar Valerga Puerta and
                  Mario Fern{\'{a}}ndez Pantoja},
  title        = {Design of Optimal Coils for Deep Transcranial Magnetic Stimulation},
  booktitle    = {44th Annual International Conference of the {IEEE} Engineering in
                  Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
                  United Kingdom, July 11-15, 2022},
  pages        = {3447--3450},
  year         = {2022},
  crossref     = {DBLP:conf/embc/2022},
  url          = {https://doi.org/10.1109/EMBC48229.2022.9871354},
  doi          = {10.1109/EMBC48229.2022.9871354},
  timestamp    = {Tue, 08 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/Vilchez-Membrilla22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSMA22,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Fast Transform Decision Scheme for {VVC} Intra-Frame Prediction Using
                  Decision Trees},
  booktitle    = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2022,
                  Austin, TX, USA, May 27 - June 1, 2022},
  pages        = {1948--1952},
  year         = {2022},
  crossref     = {DBLP:conf/iscas/2022},
  url          = {https://doi.org/10.1109/ISCAS48785.2022.9938000},
  doi          = {10.1109/ISCAS48785.2022.9938000},
  timestamp    = {Thu, 17 Nov 2022 15:59:17 +0100},
  biburl       = {https://dblp.org/rec/conf/iscas/SaldanhaSMA22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Sanchez-Martinez22,
  author       = {Aar{\'{o}}n Leonardo S{\'{a}}nchez{-}Mart{\'{\i}}nez and
                  Mario Garza{-}Fabre and
                  Ricardo Landa Becerra and
                  Edwin Aldana{-}Bobadilla},
  title        = {Machine Learning-Based Decision Making in Evolutionary Multiobjective
                  Clustering},
  booktitle    = {Advances in Computational Intelligence - 21st Mexican International
                  Conference on Artificial Intelligence, {MICAI} 2022, Monterrey, Mexico,
                  October 24-29, 2022, Proceedings, Part {I}},
  pages        = {123--137},
  year         = {2022},
  crossref     = {DBLP:conf/micai/2022-1},
  url          = {https://doi.org/10.1007/978-3-031-19493-1\_10},
  doi          = {10.1007/978-3-031-19493-1\_10},
  timestamp    = {Mon, 05 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/micai/Sanchez-Martinez22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/riiforum/SanchezGMG22,
  author       = {Mar{\'{\i}}a de los {\'{A}}ngeles T{\'{a}}rraga S{\'{a}}nchez and
                  Mar{\'{\i}}a del Mar Ballesteros Garc{\'{\i}}a and
                  H{\'{e}}ctor Migall{\'{o}}n and
                  Otoniel L{\'{o}}pez Granado},
  title        = {Reinforcement Learning Through Gamification and Open Online Resources
                  in Elementary School},
  booktitle    = {Research and Innovation Forum 2022: Rupture, Resilience and Recovery
                  in the Post-Covid World, {RIIFORUM} 2022, Athens, Greece, April 20-22,
                  2022},
  pages        = {455--463},
  year         = {2022},
  crossref     = {DBLP:conf/riiforum/2022},
  url          = {https://doi.org/10.1007/978-3-031-19560-0\_37},
  doi          = {10.1007/978-3-031-19560-0\_37},
  timestamp    = {Fri, 21 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/riiforum/SanchezGMG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/AhujaDPSGSYNRSZ22,
  author       = {Satyajeet Singh Ahuja and
                  Vinayak Dangui and
                  Kirtesh Patil and
                  Manikandan Somasundaram and
                  Varun Gupta and
                  Mario A. S{\'{a}}nchez and
                  Guanqing Yan and
                  Max Noormohammadpour and
                  Alaleh Razmjoo and
                  Grace Smith and
                  Hao Zhong and
                  Abhinav Triguna and
                  Soshant Bali and
                  Yuxiang Xiang and
                  Yilun Chen and
                  Prabhakaran Ganesan and
                  Mikel Jimenez Fernandez and
                  Petr Lapukhov and
                  Guyue Liu and
                  Ying Zhang},
  title        = {Network entitlement: contract-based network sharing with agility and
                  {SLO} guarantees},
  booktitle    = {{SIGCOMM} '22: {ACM} {SIGCOMM} 2022 Conference, Amsterdam, The Netherlands,
                  August 22 - 26, 2022},
  pages        = {250--263},
  year         = {2022},
  crossref     = {DBLP:conf/sigcomm/2022},
  url          = {https://doi.org/10.1145/3544216.3544245},
  doi          = {10.1145/3544216.3544245},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcomm/AhujaDPSGSYNRSZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sepln/2022iberlef,
  editor       = {Manuel Montes{-}y{-}G{\'{o}}mez and
                  Julio Gonzalo and
                  Francisco Rangel and
                  Marco Casavantes and
                  Miguel {\'{A}}ngel {\'{A}}lvare Carmona and
                  Gemma Bel{-}Enguix and
                  Hugo Jair Escalante and
                  Larissa A. de Freitas and
                  Antonio Miranda{-}Escalada and
                  Francisco J. Rodr{\'{\i}}guez{-}Sanchez and
                  Aiala Ros{\'{a}} and
                  Marco Antonio Sobrevilla Cabezudo and
                  Mariona Taul{\'{e}} and
                  Rafael Valencia{-}Garc{\'{\i}}a},
  title        = {Proceedings of the Iberian Languages Evaluation Forum (IberLEF 2022)
                  co-located with the Conference of the Spanish Society for Natural
                  Language Processing {(SEPLN} 2022), {A} Coru{\~{n}}a, Spain, September
                  20, 2022},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {3202},
  publisher    = {CEUR-WS.org},
  year         = {2022},
  url          = {https://ceur-ws.org/Vol-3202},
  urn          = {urn:nbn:de:0074-3202-9},
  timestamp    = {Fri, 10 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sepln/2022iberlef.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2201-06967,
  author       = {Manuel J. Gomez and
                  Mario Calder{\'{o}}n and
                  Victor S{\'{a}}nchez and
                  F{\'{e}}lix J. Garc{\'{\i}}a Clemente and
                  Jos{\'{e}} A. Ruip{\'{e}}rez{-}Valiente},
  title        = {Large Scale Analysis of Open {MOOC} Reviews to Support Learners' Course
                  Selection},
  journal      = {CoRR},
  volume       = {abs/2201.06967},
  year         = {2022},
  url          = {https://arxiv.org/abs/2201.06967},
  eprinttype    = {arXiv},
  eprint       = {2201.06967},
  timestamp    = {Mon, 27 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2201-06967.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2211-08413,
  author       = {Enrique Tom{\'{a}}s Mart{\'{\i}}nez Beltr{\'{a}}n and
                  Mario Quiles P{\'{e}}rez and
                  Pedro Miguel S{\'{a}}nchez S{\'{a}}nchez and
                  Sergio L{\'{o}}pez Bernal and
                  G{\'{e}}r{\^{o}}me Bovet and
                  Manuel Gil P{\'{e}}rez and
                  Gregorio Mart{\'{\i}}nez P{\'{e}}rez and
                  Alberto Huertas Celdr{\'{a}}n},
  title        = {Decentralized Federated Learning: Fundamentals, State-of-the-art,
                  Frameworks, Trends, and Challenges},
  journal      = {CoRR},
  volume       = {abs/2211.08413},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2211.08413},
  doi          = {10.48550/ARXIV.2211.08413},
  eprinttype    = {arXiv},
  eprint       = {2211.08413},
  timestamp    = {Wed, 23 Nov 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2211-08413.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/MadrugaCP21,
  author       = {Mario Madruga and
                  Yolanda Campos{-}Roca and
                  C. J. P{\'{e}}rez},
  title        = {Multicondition Training for Noise-Robust Detection of Benign Vocal
                  Fold Lesions From Recorded Speech},
  journal      = {{IEEE} Access},
  volume       = {9},
  pages        = {1707--1722},
  year         = {2021},
  url          = {https://doi.org/10.1109/ACCESS.2020.3046873},
  doi          = {10.1109/ACCESS.2020.3046873},
  timestamp    = {Mon, 25 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/MadrugaCP21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SanchezCOA21,
  author       = {Melissa S{\'{a}}nchez and
                  Jorge M. Cruz{-}Duarte and
                  Jos{\'{e}} Carlos Ortiz{-}Bayliss and
                  Iv{\'{a}}n Amaya},
  title        = {Sequence-Based Selection Hyper-Heuristic Model via MAP-Elites},
  journal      = {{IEEE} Access},
  volume       = {9},
  pages        = {116500--116527},
  year         = {2021},
  url          = {https://doi.org/10.1109/ACCESS.2021.3106815},
  doi          = {10.1109/ACCESS.2021.3106815},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/SanchezCOA21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SanchezPANL21,
  author       = {H{\'{e}}ctor Corrales S{\'{a}}nchez and
                  Noelia Hern{\'{a}}ndez Parra and
                  Ignacio Parra Alonso and
                  Eduardo M. Nebot and
                  David Fern{\'{a}}ndez Llorca},
  title        = {Are We Ready for Accurate and Unbiased Fine-Grained Vehicle Classification
                  in Realistic Environments?},
  journal      = {{IEEE} Access},
  volume       = {9},
  pages        = {116338--116355},
  year         = {2021},
  url          = {https://doi.org/10.1109/ACCESS.2021.3104340},
  doi          = {10.1109/ACCESS.2021.3104340},
  timestamp    = {Fri, 21 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/SanchezPANL21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/NaranjoPCM21,
  author       = {Lizbeth Naranjo and
                  Carlos J. P{\'{e}}rez and
                  Yolanda Campos{-}Roca and
                  Mario Madruga},
  title        = {Replication-based regularization approaches to diagnose Reinke's edema
                  by using voice recordings},
  journal      = {Artif. Intell. Medicine},
  volume       = {120},
  pages        = {102162},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.artmed.2021.102162},
  doi          = {10.1016/J.ARTMED.2021.102162},
  timestamp    = {Thu, 01 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/artmed/NaranjoPCM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bdr/LealCCGGDSSKGXL21,
  author       = {F{\'{a}}tima Leal and
                  Adriana E. Chis and
                  Simon Caton and
                  Horacio Gonz{\'{a}}lez{-}V{\'{e}}lez and
                  Juan M. Garc{\'{\i}}a{-}G{\'{o}}mez and
                  Marta Dur{\'{a}} and
                  Angel S{\'{a}}nchez{-}Garc{\'{\i}}a and
                  Carlos S{\'{a}}ez and
                  Anthony Karageorgos and
                  Vassilis C. Gerogiannis and
                  Apostolos Xenakis and
                  Efthymios N. Lallas and
                  Theodoros Ntounas and
                  Eleni Vasileiou and
                  Georgios Mountzouris and
                  Barbara Otti and
                  Penelope Pucci and
                  Rossano Papini and
                  David Cerrai and
                  Mariola Mier},
  title        = {Smart Pharmaceutical Manufacturing: Ensuring End-to-End Traceability
                  and Data Integrity in Medicine Production},
  journal      = {Big Data Res.},
  volume       = {24},
  pages        = {100172},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.bdr.2020.100172},
  doi          = {10.1016/J.BDR.2020.100172},
  timestamp    = {Tue, 12 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bdr/LealCCGGDSSKGXL21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/LuacesFFOBDL21,
  author       = {Miguel R. Luaces and
                  Jes{\'{u}}s A. Fisteus and
                  Luis S{\'{a}}nchez Fern{\'{a}}ndez and
                  Mario Mu{\~{n}}oz Organero and
                  Jes{\'{u}}s Balado and
                  Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and
                  Henrique Lorenzo},
  title        = {Accessible Routes Integrating Data from Multiple Sources},
  journal      = {{ISPRS} Int. J. Geo Inf.},
  volume       = {10},
  number       = {1},
  pages        = {7},
  year         = {2021},
  url          = {https://doi.org/10.3390/ijgi10010007},
  doi          = {10.3390/IJGI10010007},
  timestamp    = {Wed, 07 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijgi/LuacesFFOBDL21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/GonzalezSDR21,
  author       = {Mario Gonz{\'{a}}lez and
                  {\'{A}}ngel S{\'{a}}nchez and
                  David Dominguez and
                  Francisco B. Rodr{\'{\i}}guez},
  title        = {Ensemble of diluted attractor networks with optimized topology for
                  fingerprint retrieval},
  journal      = {Neurocomputing},
  volume       = {442},
  pages        = {269--280},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.neucom.2021.02.033},
  doi          = {10.1016/J.NEUCOM.2021.02.033},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/GonzalezSDR21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijris/DivanR21,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
  title        = {Strategies based on IoT for supporting the decision-making in agriculture:
                  a systematic literature mapping},
  journal      = {Int. J. Reason. based Intell. Syst.},
  volume       = {13},
  number       = {3},
  pages        = {155--171},
  year         = {2021},
  url          = {https://doi.org/10.1504/IJRIS.2021.117080},
  doi          = {10.1504/IJRIS.2021.117080},
  timestamp    = {Mon, 25 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijris/DivanR21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iotj/DivanRPM21,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
                  Juan Esteban Panebianco and
                  Mariano J. M{\'{e}}ndez},
  title        = {IoT-Based Approaches for Monitoring the Particulate Matter and Its
                  Impact on Health},
  journal      = {{IEEE} Internet Things J.},
  volume       = {8},
  number       = {15},
  pages        = {11983--12003},
  year         = {2021},
  url          = {https://doi.org/10.1109/JIOT.2021.3068898},
  doi          = {10.1109/JIOT.2021.3068898},
  timestamp    = {Wed, 15 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/iotj/DivanRPM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/RiveraFGPS21,
  author       = {Gilberto Rivera and
                  Rogelio Florencia and
                  Mario Guerrero and
                  Ra{\'{u}}l Porras and
                  Julia Patricia S{\'{a}}nchez{-}Sol{\'{\i}}s},
  title        = {Online multi-criteria portfolio analysis through compromise programming
                  models built on the underlying principles of fuzzy outranking},
  journal      = {Inf. Sci.},
  volume       = {580},
  pages        = {734--755},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.ins.2021.08.087},
  doi          = {10.1016/J.INS.2021.08.087},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/RiveraFGPS21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iwc/Bustos-LopezASP21,
  author       = {Maritza Bustos{-}L{\'{o}}pez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Mario Andr{\'{e}}s Paredes{-}Valverde and
                  Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate},
  title        = {EduRecomSys: An Educational Resource Recommender System Based on Collaborative
                  Filtering and Emotion Detection},
  journal      = {Interact. Comput.},
  volume       = {32},
  number       = {4},
  pages        = {407--432},
  year         = {2021},
  url          = {https://doi.org/10.1093/iwc/iwab001},
  doi          = {10.1093/IWC/IWAB001},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/iwc/Bustos-LopezASP21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jei/SaldanhaSMA21,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Fast block partitioning scheme for chrominance intra prediction of
                  versatile video coding standard},
  journal      = {J. Electronic Imaging},
  volume       = {30},
  number       = {5},
  year         = {2021},
  url          = {https://doi.org/10.1117/1.jei.30.5.053009},
  doi          = {10.1117/1.JEI.30.5.053009},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jei/SaldanhaSMA21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/Sanchez-Cervantes21,
  author       = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Mario Andr{\'{e}}s Paredes{-}Valverde and
                  Lisbeth Rodr{\'{\i}}guez{-}Mazahua and
                  Rafael Valencia{-}Garc{\'{\i}}a},
  title        = {NaLa-Search: {A} multimodal, interaction-based architecture for faceted
                  search on linked open data},
  journal      = {J. Inf. Sci.},
  volume       = {47},
  number       = {6},
  year         = {2021},
  url          = {https://doi.org/10.1177/0165551520930918},
  doi          = {10.1177/0165551520930918},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jis/Sanchez-Cervantes21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvcir/SaldanhaSMA21,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Performance analysis of {VVC} intra coding},
  journal      = {J. Vis. Commun. Image Represent.},
  volume       = {79},
  pages        = {103202},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.jvcir.2021.103202},
  doi          = {10.1016/J.JVCIR.2021.103202},
  timestamp    = {Wed, 03 Nov 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jvcir/SaldanhaSMA21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/DivanR21,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
  title        = {Metadata-based measurements transmission verified by a Merkle Tree},
  journal      = {Knowl. Based Syst.},
  volume       = {219},
  pages        = {106871},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.knosys.2021.106871},
  doi          = {10.1016/J.KNOSYS.2021.106871},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/kbs/DivanR21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/RodriguezOM21,
  author       = {Mario Rodr{\'{\i}}guez and
                  Carlos Orrite and
                  Carlos Medrano},
  title        = {Space-time flexible kernel for recognizing activities from wearable
                  cameras},
  journal      = {Pattern Anal. Appl.},
  volume       = {24},
  number       = {2},
  pages        = {843--852},
  year         = {2021},
  url          = {https://doi.org/10.1007/s10044-020-00942-0},
  doi          = {10.1007/S10044-020-00942-0},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/paa/RodriguezOM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/Rubio-TevesDPSP21,
  author       = {Mario Rubio{-}Teves and
                  Sergio Diez{-}Hermano and
                  C{\'{e}}sar Porrero and
                  Abel Sanchez{-}Jimenez and
                  Luc{\'{\i}}a Prensa and
                  Francisco Clasc{\'{a}} and
                  Mar{\'{\i}}a Garc{\'{\i}}a{-}Amado and
                  Jos{\'{e}} Antonio Villacorta{-}Atienza},
  title        = {Benchmarking of tools for axon length measurement in individually-labeled
                  projection neurons},
  journal      = {PLoS Comput. Biol.},
  volume       = {17},
  number       = {12},
  year         = {2021},
  url          = {https://doi.org/10.1371/journal.pcbi.1009051},
  doi          = {10.1371/JOURNAL.PCBI.1009051},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ploscb/Rubio-TevesDPSP21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/BusquierVLPSA21,
  author       = {Mario Busquier and
                  Rub{\'{e}}n Valcarce{-}Di{\~{n}}eiro and
                  Juan M. Lopez{-}Sanchez and
                  Javier Plaza and
                  Nilda S{\'{a}}nchez and
                  Benjam{\'{\i}}n Arias{-}P{\'{e}}rez},
  title        = {Fusion of Multi-Temporal {PAZ} and Sentinel-1 Data for Crop Classification},
  journal      = {Remote. Sens.},
  volume       = {13},
  number       = {19},
  pages        = {3915},
  year         = {2021},
  url          = {https://doi.org/10.3390/rs13193915},
  doi          = {10.3390/RS13193915},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/remotesensing/BusquierVLPSA21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/GatziouraVJS21,
  author       = {Anna Gatzioura and
                  Jo{\~{a}}o Vinagre and
                  Al{\'{\i}}pio M{\'{a}}rio Jorge and
                  Miquel S{\`{a}}nchez{-}Marr{\`{e}}},
  title        = {A Hybrid Recommender System for Improving Automatic Playlist Continuation},
  journal      = {{IEEE} Trans. Knowl. Data Eng.},
  volume       = {33},
  number       = {5},
  pages        = {1819--1830},
  year         = {2021},
  url          = {https://doi.org/10.1109/TKDE.2019.2952099},
  doi          = {10.1109/TKDE.2019.2952099},
  timestamp    = {Thu, 16 Sep 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tkde/GatziouraVJS21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmsd/NaranjoS21,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez},
  title        = {View and Viewpoint Reconstruction for Assisting the Preparation of
                  Participatory Modeling Sessions},
  booktitle    = {Business Modeling and Software Design - 11th International Symposium,
                  {BMSD} 2021, Sofia, Bulgaria, July 5-7, 2021, Proceedings},
  pages        = {306--316},
  year         = {2021},
  crossref     = {DBLP:conf/bmsd/2021},
  url          = {https://doi.org/10.1007/978-3-030-79976-2\_19},
  doi          = {10.1007/978-3-030-79976-2\_19},
  timestamp    = {Tue, 31 Aug 2021 10:24:53 +0200},
  biburl       = {https://dblp.org/rec/conf/bmsd/NaranjoS21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/TapiaGEJPCL21,
  author       = {Luis Sanchez Tapia and
                  Antonio Gomez and
                  Mario Esparza and
                  Venkatesh Jatla and
                  Marios Pattichis and
                  Sylvia Celed{\'{o}}n{-}Pattichis and
                  Carlos L{\'{o}}pez Leiva},
  title        = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video
                  Data},
  booktitle    = {Computer Analysis of Images and Patterns - 19th International Conference,
                  {CAIP} 2021, Virtual Event, September 28-30, 2021, Proceedings, Part
                  {I}},
  pages        = {79--89},
  year         = {2021},
  crossref     = {DBLP:conf/caip/2021-1},
  url          = {https://doi.org/10.1007/978-3-030-89128-2\_8},
  doi          = {10.1007/978-3-030-89128-2\_8},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/caip/TapiaGEJPCL21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GonzalezRVHPPST21,
  author       = {Ruben Vasallo Gonz{\'{a}}lez and
                  Antonio Robles{-}G{\'{o}}mez and
                  Rafael Pastor Vargas and
                  Juan Mario Haut and
                  Nicol{\'{a}}s A. Passadore and
                  Mercedes Eugenia Paoletti and
                  Carlos Luis S{\'{a}}nchez{-}Bocanegra and
                  Llanos Tobarra and
                  Karla A. Chac{\'{o}}n{-}Vargas and
                  Roberto Hern{\'{a}}ndez Berlinches and
                  Francesc Saig{\'{\i}} Rubi{\'{o}}},
  title        = {A Recommendation System for Electronic Health Records in the Context
                  of the {HOPE} Project},
  booktitle    = {34th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2021, Aveiro, Portugal, June 7-9, 2021},
  pages        = {603--608},
  year         = {2021},
  crossref     = {DBLP:conf/cbms/2021},
  url          = {https://doi.org/10.1109/CBMS52027.2021.00108},
  doi          = {10.1109/CBMS52027.2021.00108},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/GonzalezRVHPPST21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fie/IzuLMS21,
  author       = {Cruz Izu and
                  Violetta Lonati and
                  Anna Morpurgo and
                  Mario S{\'{a}}nchez},
  title        = {An Inventory of Goals from {CS1} Programs Processing a Data Series},
  booktitle    = {{IEEE} Frontiers in Education Conference, {FIE} 2021, Lincoln, NE,
                  USA, October 13-16, 2021},
  pages        = {1--8},
  year         = {2021},
  crossref     = {DBLP:conf/fie/2021},
  url          = {https://doi.org/10.1109/FIE49875.2021.9637360},
  doi          = {10.1109/FIE49875.2021.9637360},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/fie/IzuLMS21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icai2/MachadoSV21,
  author       = {Paola Lara Machado and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Enterprise Modeling: {A} Multi-perspective Tool-Supported Approach},
  booktitle    = {Applied Informatics - Fourth International Conference, {ICAI} 2021,
                  Buenos Aires, Argentina, October 28-30, 2021, Proceedings},
  pages        = {465--480},
  year         = {2021},
  crossref     = {DBLP:conf/icai2/2021},
  url          = {https://doi.org/10.1007/978-3-030-89654-6\_33},
  doi          = {10.1007/978-3-030-89654-6\_33},
  timestamp    = {Sun, 15 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icai2/MachadoSV21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaSRAF21,
  author       = {Andrea L{\'{o}}pez{-}Tapia and
                  Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
                  Mario Alfredo Reyes{-}Barranca and
                  Griselda Stephany Abarca{-}Jimenez and
                  Luis Mart{\'{\i}}n Flores{-}Nava},
  title        = {Micromotors unit based on {CMOS-MEMS} technology integrated on a single
                  chip},
  booktitle    = {18th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2021, Mexico City, Mexico, November
                  10-12, 2021},
  pages        = {1--6},
  year         = {2021},
  crossref     = {DBLP:conf/iceee/2021},
  url          = {https://doi.org/10.1109/CCE53527.2021.9633117},
  doi          = {10.1109/CCE53527.2021.9633117},
  timestamp    = {Mon, 03 Jan 2022 22:36:53 +0100},
  biburl       = {https://dblp.org/rec/conf/iceee/Lopez-TapiaSRAF21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/GonzalezSDR21,
  author       = {Mario Gonz{\'{a}}lez and
                  {\'{A}}ngel S{\'{a}}nchez and
                  David Dominguez and
                  Francisco B. Rodr{\'{\i}}guez},
  title        = {Fine-Tuning of Patterns Assignment to Subnetworks Increases the Capacity
                  of an Attractor Network Ensemble},
  booktitle    = {Advances in Computational Intelligence - 16th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2021, Virtual Event, June 16-18,
                  2021, Proceedings, Part {II}},
  pages        = {236--247},
  year         = {2021},
  crossref     = {DBLP:conf/iwann/2021-2},
  url          = {https://doi.org/10.1007/978-3-030-85099-9\_19},
  doi          = {10.1007/978-3-030-85099-9\_19},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/GonzalezSDR21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Suarez-RamirezD21,
  author       = {Cuauhtemoc Daniel Suarez{-}Ramirez and
                  Mario Alberto Duran{-}Vega and
                  H{\'{e}}ctor M. S{\'{a}}nchez C. and
                  Miguel Gonz{\'{a}}lez{-}Mendoza and
                  Leonardo Chang and
                  John M. Marshall},
  title        = {Deep Learning Architectures Applied to Mosquito Count Regressions
                  in {US} Datasets},
  booktitle    = {Advances in Computational Intelligence - 20th Mexican International
                  Conference on Artificial Intelligence, {MICAI} 2021, Mexico City,
                  Mexico, October 25-30, 2021, Proceedings, Part {I}},
  pages        = {199--212},
  year         = {2021},
  crossref     = {DBLP:conf/micai/2021-1},
  url          = {https://doi.org/10.1007/978-3-030-89817-5\_15},
  doi          = {10.1007/978-3-030-89817-5\_15},
  timestamp    = {Mon, 24 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/Suarez-RamirezD21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ondm/UrenaGSGNGG21,
  author       = {Mario Ure{\~{n}}a and
                  Rub{\'{e}}n Guillem and
                  Sabahat Shaheen and
                  Sergi Garc{\'{\i}}a and
                  Elham Nazemosadat and
                  Itandehui Gris{-}S{\'{a}}nchez and
                  Ivana Gasulla},
  title        = {Specialty fibers exploiting spatial multiplexing for signal processing
                  in radio access networks},
  booktitle    = {International Conference on Optical Network Design and Modeling, {ONDM}
                  2021, Gothenburg, Sweden, June 28 - July 1, 2021},
  pages        = {1--3},
  year         = {2021},
  crossref     = {DBLP:conf/ondm/2021},
  url          = {https://doi.org/10.23919/ONDM51796.2021.9492430},
  doi          = {10.23919/ONDM51796.2021.9492430},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ondm/UrenaGSGNGG21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Analysis of {VVC} Intra Prediction Block Partitioning Structure},
  booktitle    = {International Conference on Visual Communications and Image Processing,
                  {VCIP} 2021, Munich, Germany, December 5-8, 2021},
  pages        = {1--5},
  year         = {2021},
  crossref     = {DBLP:conf/vcip/2021},
  url          = {https://doi.org/10.1109/VCIP53242.2021.9675347},
  doi          = {10.1109/VCIP53242.2021.9675347},
  timestamp    = {Tue, 25 Jan 2022 09:48:31 +0100},
  biburl       = {https://dblp.org/rec/conf/vcip/SaldanhaSMA21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/SaldanhaSMA21a,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Learning-Based Complexity Reduction Scheme for {VVC} Intra-Frame Prediction},
  booktitle    = {International Conference on Visual Communications and Image Processing,
                  {VCIP} 2021, Munich, Germany, December 5-8, 2021},
  pages        = {1--5},
  year         = {2021},
  crossref     = {DBLP:conf/vcip/2021},
  url          = {https://doi.org/10.1109/VCIP53242.2021.9675394},
  doi          = {10.1109/VCIP53242.2021.9675394},
  timestamp    = {Tue, 25 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/vcip/SaldanhaSMA21a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/worldcist/MoralesMTAM21,
  author       = {C. Santiago Morales and
                  Mario Raul Morales{-}Morales and
                  Glenda Toala S{\'{a}}nchez and
                  B. Alicia Andrade and
                  Milton Giovanny Moncayo},
  title        = {Business Decision Making Based on Social Media Analysis},
  booktitle    = {Trends and Applications in Information Systems and Technologies -
                  Volume 2, WorldCIST 2021, Terceira Island, Azores, Portugal, 30 March
                  - 2 April, 2021},
  pages        = {203--213},
  year         = {2021},
  crossref     = {DBLP:conf/worldcist/2021-2},
  url          = {https://doi.org/10.1007/978-3-030-72651-5\_20},
  doi          = {10.1007/978-3-030-72651-5\_20},
  timestamp    = {Wed, 22 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/worldcist/MoralesMTAM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-02009,
  author       = {Eric Sadit Tellez and
                  Sabino Miranda{-}Jim{\'{e}}nez and
                  Mario Graff and
                  Daniela Moctezuma and
                  Oscar S. Siordia and
                  Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
  title        = {A Case Study of Spanish Text Transformations for Twitter Sentiment
                  Analysis},
  journal      = {CoRR},
  volume       = {abs/2106.02009},
  year         = {2021},
  url          = {https://arxiv.org/abs/2106.02009},
  eprinttype    = {arXiv},
  eprint       = {2106.02009},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2106-02009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-13463,
  author       = {Luis Sanchez Tapia and
                  Antonio Gomez and
                  Mario Esparza and
                  Venkatesh Jatla and
                  Marios Pattichis and
                  Sylvia Celed{\'{o}}n{-}Pattichis and
                  Carlos LopezLeiva},
  title        = {Bilingual Speech Recognition by Estimating Speaker Geometry from Video
                  Data},
  journal      = {CoRR},
  volume       = {abs/2112.13463},
  year         = {2021},
  url          = {https://arxiv.org/abs/2112.13463},
  eprinttype    = {arXiv},
  eprint       = {2112.13463},
  timestamp    = {Tue, 04 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2112-13463.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aada/DivanR20,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
  title        = {Optimizing Data Transmission from IoT Devices Through Weighted Online
                  Data Changing Detectors},
  journal      = {Adv. Data Sci. Adapt. Anal.},
  volume       = {12},
  number       = {2},
  pages        = {2041001:1--2041001:33},
  year         = {2020},
  url          = {https://doi.org/10.1142/S2424922X20410016},
  doi          = {10.1142/S2424922X20410016},
  timestamp    = {Fri, 09 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/aada/DivanR20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Sanchez-AvilaMF20,
  author       = {Mario S{\'{a}}nchez{-}{\'{A}}vila and
                  Marcos Antonio Mouri{\~{n}}o{-}Garc{\'{\i}}a and
                  Jes{\'{u}}s A. Fisteus and
                  Luis S{\'{a}}nchez Fern{\'{a}}ndez},
  title        = {Detection of Barriers to Mobility in the Smart City Using Twitter},
  journal      = {{IEEE} Access},
  volume       = {8},
  pages        = {168429--168438},
  year         = {2020},
  url          = {https://doi.org/10.1109/ACCESS.2020.3022834},
  doi          = {10.1109/ACCESS.2020.3022834},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/Sanchez-AvilaMF20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/SanchezCOCTA20,
  author       = {Melissa S{\'{a}}nchez and
                  Jorge M. Cruz{-}Duarte and
                  Jos{\'{e}} Carlos Ortiz{-}Bayliss and
                  Hector G. Ceballos and
                  Hugo Terashima{-}Mar{\'{\i}}n and
                  Iv{\'{a}}n Amaya},
  title        = {A Systematic Review of Hyper-Heuristics on Combinatorial Optimization
                  Problems},
  journal      = {{IEEE} Access},
  volume       = {8},
  pages        = {128068--128095},
  year         = {2020},
  url          = {https://doi.org/10.1109/ACCESS.2020.3009318},
  doi          = {10.1109/ACCESS.2020.3009318},
  timestamp    = {Mon, 21 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/SanchezCOCTA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/caee/Jimenez-Ramirez20,
  author       = {Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and
                  Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and
                  Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and
                  Mario Alan Quiroz{-}Ju{\'{a}}rez and
                  Rub{\'{e}}n V{\'{a}}zquez{-}Medina},
  title        = {Digital proportional-derivative controller implemented in low-resource
                  microcontrollers},
  journal      = {Comput. Appl. Eng. Educ.},
  volume       = {28},
  number       = {6},
  pages        = {1671--1682},
  year         = {2020},
  url          = {https://doi.org/10.1002/cae.22346},
  doi          = {10.1002/CAE.22346},
  timestamp    = {Thu, 17 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/caee/Jimenez-Ramirez20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ci/Paredes-Valverde20,
  author       = {Mario Andr{\'{e}}s Paredes{-}Valverde and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
                  Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
                  Luis Omar Colombo{-}Mendoza and
                  Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes},
  title        = {IntelliHome: An internet of things-based system for electrical energy
                  saving in smart home environment},
  journal      = {Comput. Intell.},
  volume       = {36},
  number       = {1},
  pages        = {203--224},
  year         = {2020},
  url          = {https://doi.org/10.1111/coin.12252},
  doi          = {10.1111/COIN.12252},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ci/Paredes-Valverde20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cleiej/DivanR20,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
  title        = {A Real-Time Entity Monitoring based on States and Scenarios},
  journal      = {{CLEI} Electron. J.},
  volume       = {23},
  number       = {1},
  year         = {2020},
  url          = {https://doi.org/10.19153/cleiej.23.1.2},
  doi          = {10.19153/CLEIEJ.23.1.2},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cleiej/DivanR20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computer/Gonzalez-Briceno20,
  author       = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and
                  Abraham S{\'{a}}nchez and
                  Susana Ortega{-}Cisneros and
                  Mario Salvador Garcia Contreras and
                  German Alonso Pinedo Diaz and
                  Eduardo Ulises Moya{-}S{\'{a}}nchez},
  title        = {Artificial Intelligence-Based Referral System for Patients With Diabetic
                  Retinopathy},
  journal      = {Computer},
  volume       = {53},
  number       = {10},
  pages        = {77--87},
  year         = {2020},
  url          = {https://doi.org/10.1109/MC.2020.3004392},
  doi          = {10.1109/MC.2020.3004392},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/computer/Gonzalez-Briceno20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Sanchez-GalvezA20,
  author       = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Mario Anzures{-}Garc{\'{\i}}a and
                  {\'{A}}lvaro Campos Gregorio},
  title        = {Weighted Bidirectional Graph-based Academic Curricula Model to Support
                  the Tutorial Competence},
  journal      = {Computaci{\'{o}}n y Sistemas},
  volume       = {24},
  number       = {2},
  year         = {2020},
  url          = {https://doi.org/10.13053/cys-24-2-3397},
  doi          = {10.13053/CYS-24-2-3397},
  timestamp    = {Fri, 10 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cys/Sanchez-GalvezA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/digearth/SoilanRFA20,
  author       = {Mario Soil{\'{a}}n and
                  Bel{\'{e}}n Riveiro and
                  Jes{\'{u}}s Balado and
                  Pedro Arias},
  title        = {Comparison of heuristic and deep learning-based methods for ground
                  classification from aerial point clouds},
  journal      = {Int. J. Digit. Earth},
  volume       = {13},
  number       = {10},
  pages        = {1115--1134},
  year         = {2020},
  url          = {https://doi.org/10.1080/17538947.2019.1663948},
  doi          = {10.1080/17538947.2019.1663948},
  timestamp    = {Sun, 25 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/digearth/SoilanRFA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijgi/FernandezPGCCSD20,
  author       = {Tom{\'{a}}s Fern{\'{a}}ndez and
                  Jos{\'{e}} Luis P{\'{e}}rez{-}Garc{\'{\i}}a and
                  Jos{\'{e}} Miguel G{\'{o}}mez{-}L{\'{o}}pez and
                  Javier Cardenal and
                  Julio Calero and
                  Mario S{\'{a}}nchez{-}G{\'{o}}mez and
                  Jorge Delgado and
                  Joaqu{\'{\i}}n Tovar{-}Pescador},
  title        = {Multitemporal Analysis of Gully Erosion in Olive Groves by Means of
                  Digital Elevation Models Obtained with Aerial Photogrammetric and
                  LiDAR Data},
  journal      = {{ISPRS} Int. J. Geo Inf.},
  volume       = {9},
  number       = {4},
  pages        = {260},
  year         = {2020},
  url          = {https://doi.org/10.3390/ijgi9040260},
  doi          = {10.3390/IJGI9040260},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijgi/FernandezPGCCSD20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/NaveiraSCGGPCMC20,
  author       = {Miguel Ramos Naveira and
                  Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
                  Jes{\'{u}}s Barros Castro and
                  Lino Carrajo Garc{\'{\i}}a and
                  Guillermo V{\'{a}}zquez Gonz{\'{a}}lez and
                  Santiago P{\'{e}}rez and
                  Mario Pascual Carrasco and
                  Fernando Mart{\'{\i}}n{-}S{\'{a}}nchez and
                  Adolfo Mu{\~{n}}oz Carrero},
  title        = {An Archetype Query Language interpreter into MongoDB: Managing NoSQL
                  standardized Electronic Health Record extracts systems},
  journal      = {J. Biomed. Informatics},
  volume       = {101},
  pages        = {103339},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.jbi.2019.103339},
  doi          = {10.1016/J.JBI.2019.103339},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jbi/NaveiraSCGGPCMC20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/Anzures-GarciaS20,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
  title        = {{PROMISE:} PRoposing an Ontological Model for developing collaboratIve
                  SystEms},
  journal      = {J. Intell. Fuzzy Syst.},
  volume       = {39},
  number       = {2},
  pages        = {2545--2557},
  year         = {2020},
  url          = {https://doi.org/10.3233/JIFS-179913},
  doi          = {10.3233/JIFS-179913},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jifs/Anzures-GarciaS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jiii/LaraSV20,
  author       = {Paola Lara and
                  Mario S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Enterprise modeling and operational technologies {(OT)} application
                  in the oil and gas industry},
  journal      = {J. Ind. Inf. Integr.},
  volume       = {19},
  pages        = {100160},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.jii.2020.100160},
  doi          = {10.1016/J.JII.2020.100160},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jiii/LaraSV20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kais/Salas-ZarateASP20,
  author       = {Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Mario Andr{\'{e}}s Paredes{-}Valverde and
                  Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
                  Rafael Valencia{-}Garc{\'{\i}}a},
  title        = {Review of English literature on figurative language applied to social
                  networks},
  journal      = {Knowl. Inf. Syst.},
  volume       = {62},
  number       = {6},
  pages        = {2105--2137},
  year         = {2020},
  url          = {https://doi.org/10.1007/s10115-019-01425-3},
  doi          = {10.1007/S10115-019-01425-3},
  timestamp    = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/kais/Salas-ZarateASP20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/lgrs/BusquierLB20,
  author       = {Mario Busquier and
                  Juan M. Lopez{-}Sanchez and
                  Damian Bargiel},
  title        = {Added Value of Coherent Copolar Polarimetry at X-Band for Crop-Type
                  Mapping},
  journal      = {{IEEE} Geosci. Remote. Sens. Lett.},
  volume       = {17},
  number       = {5},
  pages        = {819--823},
  year         = {2020},
  url          = {https://doi.org/10.1109/LGRS.2019.2933738},
  doi          = {10.1109/LGRS.2019.2933738},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/lgrs/BusquierLB20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/Alvarez-Arenald20,
  author       = {Angel {\'{A}}lvarez{-}Arenal and
                  H{\'{e}}ctor deLlanos{-}Lanchares and
                  Elena Mart{\'{\i}}n Fern{\'{a}}ndez and
                  Mario Mauvezin{-}Quevedo and
                  Mar{\'{\i}}a Luisa S{\'{a}}nchez Rodr{\'{\i}}guez and
                  Francisco Javier de Cos Juez},
  title        = {An artificial neural network model for the prediction of bruxism by
                  means of occlusal variables},
  journal      = {Neural Comput. Appl.},
  volume       = {32},
  number       = {5},
  pages        = {1259--1267},
  year         = {2020},
  url          = {https://doi.org/10.1007/s00521-018-3715-7},
  doi          = {10.1007/S00521-018-3715-7},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/Alvarez-Arenald20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS20,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
  title        = {Enfoque sem{\'{a}}ntico de pol{\'{\i}}ticas para gestionar
                  la conciencia de grupo en Groupware},
  journal      = {Res. Comput. Sci.},
  volume       = {149},
  number       = {8},
  pages        = {1117--1132},
  year         = {2020},
  url          = {https://rcs.cic.ipn.mx/2020\_149\_8/Enfoque\%20semantico\%20de\%20politicas\%20para\%20gestionar\%20la\%20conciencia\%20de\%20grupo\%20en\%20Groupware.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/BricenoSMODCC20,
  author       = {Gaspar Gonz{\'{a}}lez{-}Brice{\~{n}}o and
                  Abraham S{\'{a}}nchez and
                  Eduardo Ulises Moya{-}S{\'{a}}nchez and
                  Susana Ortega{-}Cisneros and
                  German Alonso Pinedo Diaz and
                  Mario Salvador Garcia Contreras and
                  Beatriz Alvarado Castillo},
  title        = {Automatic Cropping of Retinal Fundus Photographs using Convolutional
                  Neural Networks},
  journal      = {Res. Comput. Sci.},
  volume       = {149},
  number       = {5},
  pages        = {161--167},
  year         = {2020},
  url          = {https://rcs.cic.ipn.mx/2020\_149\_5/Automatic\%20Cropping\%20of\%20Retinal\%20Fundus\%20Photographs\%20using\%20Convolutional\%20Neural\%20Networks.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/BricenoSMODCC20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/EnriquezGLSPRG20,
  author       = {Karen Andrea Guerrero Enr{\'{\i}}quez and
                  Octavio Jim{\'{e}}nez Gonz{\'{a}}lez and
                  Roberto Pacheco L{\'{o}}pez and
                  Javier Medrano S{\'{a}}nchez and
                  Mario Murguia Perez and
                  Ang{\'{e}}lica Hern{\'{a}}ndez Rayas and
                  Martha Alicia Hern{\'{a}}ndez Gonz{\'{a}}lez},
  title        = {An{\'{a}}lisis y caracterizaci{\'{o}}n de espectros Raman
                  de tejido neopl{\'{a}}sico e hiperpl{\'{a}}sico de pr{\'{o}}stata},
  journal      = {Res. Comput. Sci.},
  volume       = {149},
  number       = {2},
  pages        = {87--94},
  year         = {2020},
  url          = {https://rcs.cic.ipn.mx/2020\_149\_2/Analisis\%20y\%20caracterizacion\%20de\%20espectros\%20Raman\%20de\%20tejido\%20neoplasico\%20e\%20hiperplasico\%20de\%20prostata.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/EnriquezGLSPRG20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/EstrellaTM20,
  author       = {Guillermo Fern{\'{a}}ndez Estrella and
                  Joel Antonio Trejo{-}S{\'{a}}nchez and
                  Mario Ren{\'{a}}n Moreno{-}Sabido},
  title        = {Sistema multi-agente para el control de tr{\'{a}}fico urbano
                  para veh{\'{\i}}culos de prioridad},
  journal      = {Res. Comput. Sci.},
  volume       = {149},
  number       = {8},
  pages        = {713--723},
  year         = {2020},
  url          = {https://rcs.cic.ipn.mx/2020\_149\_8/Sistema\%20multi-agente\%20para\%20el\%20control\%20de\%20trafico\%20urbano\%20para\%20vehiculos\%20de\%20prioridad.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/EstrellaTM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/BusquierLMNGM20,
  author       = {Mario Busquier and
                  Juan M. Lopez{-}Sanchez and
                  Alejandro Mestre{-}Quereda and
                  Elena Navarro and
                  Maria P. Gonz{\'{a}}lez{-}Dugo and
                  Luciano Mateos},
  title        = {Exploring TanDEM-X Interferometric Products for Crop-Type Mapping},
  journal      = {Remote. Sens.},
  volume       = {12},
  number       = {11},
  pages        = {1774},
  year         = {2020},
  url          = {https://doi.org/10.3390/rs12111774},
  doi          = {10.3390/RS12111774},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/BusquierLMNGM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/SoilanJSR20,
  author       = {Mario Soil{\'{a}}n and
                  Andr{\'{e}}s Justo and
                  Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
                  Bel{\'{e}}n Riveiro},
  title        = {3D Point Cloud to {BIM:} Semi-Automated Framework to Define {IFC}
                  Alignment Entities from MLS-Acquired LiDAR Data of Highway Roads},
  journal      = {Remote. Sens.},
  volume       = {12},
  number       = {14},
  pages        = {2301},
  year         = {2020},
  url          = {https://doi.org/10.3390/rs12142301},
  doi          = {10.3390/RS12142301},
  timestamp    = {Fri, 31 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/SoilanJSR20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ress/LozanoZS20,
  author       = {Jorge{-}Mario Lozano and
                  Santiago Zuluaga and
                  Mauricio S{\'{a}}nchez{-}Silva},
  title        = {Developing flexible management strategies in infrastructure: The sequential
                  expansion problem for infrastructure analysis {(SEPIA)}},
  journal      = {Reliab. Eng. Syst. Saf.},
  volume       = {200},
  pages        = {106951},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.ress.2020.106951},
  doi          = {10.1016/J.RESS.2020.106951},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ress/LozanoZS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Guerra-SerranoS20,
  author       = {Juan Guerra{-}Serrano and
                  Angel S{\'{a}}nchez{-}Roca and
                  Guillermo Gonz{\'{a}}lez{-}Yero and
                  Mario C. S{\'{a}}nchez{-}Orozco and
                  Mercedes P{\'{e}}rez de la Parte and
                  Emilio Jim{\'{e}}nez Mac{\'{\i}}as and
                  Julio Blanco{-}Fern{\'{a}}ndez},
  title        = {New Arc Stability Index for Industrial {AC} Three-Phase Electric Arc
                  Furnaces Based on Acoustic Signals},
  journal      = {Sensors},
  volume       = {20},
  number       = {23},
  pages        = {6840},
  year         = {2020},
  url          = {https://doi.org/10.3390/s20236840},
  doi          = {10.3390/S20236840},
  timestamp    = {Sat, 25 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sensors/Guerra-SerranoS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/SanchezTSGMRPHM20,
  author       = {Jos{\'{e}} Rafael Garc{\'{\i}}a S{\'{a}}nchez and
                  Salvador Tavera{-}Mosqueda and
                  Ram{\'{o}}n Silva{-}Ortigoza and
                  V{\'{\i}}ctor Manuel Hern{\'{a}}ndez Guzm{\'{a}}n and
                  Magdalena Marciano{-}Melchor and
                  Jos{\'{e}} de Jes{\'{u}}s Rubio and
                  Mario Ponce{-}Silva and
                  Miguel Hern{\'{a}}ndez{-}Bola{\~{n}}os and
                  Jes{\'{u}}s Mart{\'{\i}}nez{-}Mart{\'{\i}}nez},
  title        = {A Novel Dynamic Three-Level Tracking Controller for Mobile Robots
                  Considering Actuators and Power Stage Subsystems: Experimental Assessment},
  journal      = {Sensors},
  volume       = {20},
  number       = {17},
  pages        = {4959},
  year         = {2020},
  url          = {https://doi.org/10.3390/s20174959},
  doi          = {10.3390/S20174959},
  timestamp    = {Fri, 25 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sensors/SanchezTSGMRPHM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/SaldanhaSMA20,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Tile Adaptation for Workload Balancing of 3D-HEVC Encoder in Homogeneous
                  Multicore Systems},
  journal      = {{IEEE} Trans. Circuits Syst. {I} Fundam. Theory Appl.},
  volume       = {67-I},
  number       = {5},
  pages        = {1704--1714},
  year         = {2020},
  url          = {https://doi.org/10.1109/TCSI.2020.2977297},
  doi          = {10.1109/TCSI.2020.2977297},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcas/SaldanhaSMA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/SanchezSFCAM20,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Ramon Fernandes and
                  Rodrigo Cataldo and
                  Luciano Agostini and
                  C{\'{e}}sar A. M. Marcon},
  title        = {3D-HEVC Bipartition Modes Encoder and Decoder Design Targeting High-Resolution
                  Videos},
  journal      = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
  volume       = {67-I},
  number       = {2},
  pages        = {415--427},
  year         = {2020},
  url          = {https://doi.org/10.1109/TCSI.2019.2929977},
  doi          = {10.1109/TCSI.2019.2929977},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcas/SanchezSFCAM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tce/SanchezSO20,
  author       = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
                  Daniel D{\'{\i}}az S{\'{a}}nchez and
                  Mario Mu{\~{n}}oz Organero},
  title        = {Specification and Unattended Deployment of Home Networks at the Edge
                  of the Network},
  journal      = {{IEEE} Trans. Consumer Electron.},
  volume       = {66},
  number       = {4},
  pages        = {279--288},
  year         = {2020},
  url          = {https://doi.org/10.1109/TCE.2020.3018543},
  doi          = {10.1109/TCE.2020.3018543},
  timestamp    = {Thu, 27 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tce/SanchezSO20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/SaldanhaSMA20,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Fast 3D-HEVC Depth Map Encoding Using Machine Learning},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {30},
  number       = {3},
  pages        = {850--861},
  year         = {2020},
  url          = {https://doi.org/10.1109/TCSVT.2019.2898122},
  doi          = {10.1109/TCSVT.2019.2898122},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/SaldanhaSMA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/SantAnaHSSAN20,
  author       = {Jean Michel de Souza Sant'Ana and
                  Arliones Hoeller and
                  Richard Demo Souza and
                  Samuel Montejo Sanchez and
                  Hirley Alves and
                  Mario de Noronha{-}Neto},
  title        = {Hybrid Coded Replication in LoRa Networks},
  journal      = {{IEEE} Trans. Ind. Informatics},
  volume       = {16},
  number       = {8},
  pages        = {5577--5585},
  year         = {2020},
  url          = {https://doi.org/10.1109/TII.2020.2966120},
  doi          = {10.1109/TII.2020.2966120},
  timestamp    = {Fri, 22 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tii/SantAnaHSSAN20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ahfe/Sanchez-MatuteZ20,
  author       = {Mario Raul Sanchez{-}Matute and
                  Carolina Zayas{-}M{\'{a}}rquez and
                  Mar{\'{\i}}a Marcela Sol{\'{\i}}s{-}Quinteros and
                  Luis Alfredo {\'{A}}vila{-}L{\'{o}}pez},
  title        = {Improvement of Efficiency in the Productivity of an Aerospace, Maritime
                  and Military Company in Tijuana, Baja California; Mexico},
  booktitle    = {Advances in Physical, Social {\&} Occupational Ergonomics - Proceedings
                  of the {AHFE} 2020 Virtual Conferences on Physical Ergonomics and
                  Human Factors, Social {\&} Occupational Ergonomics and Cross-Cultural
                  Decision Making, July 16-20, 2020, {USA}},
  pages        = {421--436},
  year         = {2020},
  crossref     = {DBLP:conf/ahfe/2020-15},
  url          = {https://doi.org/10.1007/978-3-030-51549-2\_56},
  doi          = {10.1007/978-3-030-51549-2\_56},
  timestamp    = {Tue, 07 Nov 2023 08:36:40 +0100},
  biburl       = {https://dblp.org/rec/conf/ahfe/Sanchez-MatuteZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cec/SanchezOACCT20,
  author       = {Xavier S{\'{a}}nchez and
                  Jos{\'{e}} Carlos Ortiz{-}Bayliss and
                  Iv{\'{a}}n Amaya and
                  Jorge M. Cruz{-}Duarte and
                  Santiago Enrique Conant{-}Pablos and
                  Hugo Terashima{-}Mar{\'{\i}}n},
  title        = {A Preliminary Study on Feature-independent Hyper-heuristics for the
                  0/1 Knapsack Problem},
  booktitle    = {{IEEE} Congress on Evolutionary Computation, {CEC} 2020, Glasgow,
                  United Kingdom, July 19-24, 2020},
  pages        = {1--8},
  year         = {2020},
  crossref     = {DBLP:conf/cec/2020},
  url          = {https://doi.org/10.1109/CEC48606.2020.9185671},
  doi          = {10.1109/CEC48606.2020.9185671},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cec/SanchezOACCT20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cosecivi/RomeroSSMP20,
  author       = {Diego Romero and
                  Mario S{\'{a}}nchez and
                  Jos{\'{e}} M. Sierra and
                  Maximiliano Miranda and
                  Federico Peinado},
  title        = {Developing an automated planning tool for non-player character behavior},
  booktitle    = {Proceedings of the {VI} Congreso de la Sociedad Espa{\~{n}}ola para
                  las Ciencias del Videojuego, On-line, October 7-8, 2020},
  pages        = {69--77},
  year         = {2020},
  crossref     = {DBLP:conf/cosecivi/2020},
  url          = {https://ceur-ws.org/Vol-2719/paper7.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:22:22 +0100},
  biburl       = {https://dblp.org/rec/conf/cosecivi/RomeroSSMP20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/MadrugaCP20,
  author       = {Mario Madruga and
                  Yolanda Campos{-}Roca and
                  Carlos J. P{\'{e}}rez},
  title        = {Robustness Assessment of Automatic Reinke's Edema Diagnosis Systems},
  booktitle    = {2020 {IEEE} International Conference on Acoustics, Speech and Signal
                  Processing, {ICASSP} 2020, Barcelona, Spain, May 4-8, 2020},
  pages        = {891--895},
  year         = {2020},
  crossref     = {DBLP:conf/icassp/2020},
  url          = {https://doi.org/10.1109/ICASSP40776.2020.9053676},
  doi          = {10.1109/ICASSP40776.2020.9053676},
  timestamp    = {Thu, 01 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/MadrugaCP20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/MouraSSMPA20,
  author       = {Christopher Moura and
                  M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Marcelo Schiavon Porto and
                  Luciano Agostini},
  title        = {Fast Intra Mode Decision for 3D-HEVC Depth Map Coding using Decision
                  Trees},
  booktitle    = {27th {IEEE} International Conference on Electronics, Circuits and
                  Systems, {ICECS} 2020, Glasgow, Scotland, UK, November 23-25, 2020},
  pages        = {1--4},
  year         = {2020},
  crossref     = {DBLP:conf/icecsys/2020},
  url          = {https://doi.org/10.1109/ICECS49266.2020.9294919},
  doi          = {10.1109/ICECS49266.2020.9294919},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icecsys/MouraSSMPA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF20,
  author       = {Andrea L{\'{o}}pez{-}Tapia and
                  Mario Alfredo Reyes{-}Barranca and
                  Griselda Stephany Abarca{-}Jimenez and
                  Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
                  Luis Mart{\'{\i}}n Flores{-}Nava},
  title        = {Design of position sensor of a linear micromotor based on {CMOS-MEMS}
                  technology},
  booktitle    = {17th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November
                  11-13, 2020},
  pages        = {1--6},
  year         = {2020},
  crossref     = {DBLP:conf/iceee/2020},
  url          = {https://doi.org/10.1109/CCE50788.2020.9299123},
  doi          = {10.1109/CCE50788.2020.9299123},
  timestamp    = {Sun, 07 Feb 2021 14:11:06 +0100},
  biburl       = {https://dblp.org/rec/conf/iceee/Lopez-TapiaRASF20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/MenesesMSM20,
  author       = {Maricela Meneses and
                  Mario Moreno and
                  Alfredo Morales{-}S{\'{a}}nchez and
                  J. C{\'{e}}sar Mendoza},
  title        = {Effect of the thermal treatments on the emission of a-Si1-xCx: {H}
                  films},
  booktitle    = {17th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November
                  11-13, 2020},
  pages        = {1--5},
  year         = {2020},
  crossref     = {DBLP:conf/iceee/2020},
  url          = {https://doi.org/10.1109/CCE50788.2020.9299172},
  doi          = {10.1109/CCE50788.2020.9299172},
  timestamp    = {Thu, 20 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/MenesesMSM20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez20,
  author       = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
                  Mario Alfredo Reyes{-}Barranca and
                  Griselda Stephany Abarca{-}Jimenez and
                  Andrea L{\'{o}}pez{-}Tapia and
                  Luis Mart{\'{\i}}n Flores{-}Nava},
  title        = {Proposal for a rotary micromotor structure based on {CMOS-MEMS} technology},
  booktitle    = {17th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November
                  11-13, 2020},
  pages        = {1--6},
  year         = {2020},
  crossref     = {DBLP:conf/iceee/2020},
  url          = {https://doi.org/10.1109/CCE50788.2020.9299176},
  doi          = {10.1109/CCE50788.2020.9299176},
  timestamp    = {Sun, 07 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iceee/Sanchez-Marquez20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icict2/Barcelo-Valenzuela20,
  author       = {Mario Barcelo{-}Valenzuela and
                  Carlos Maximiliano Leal{-}Pompa and
                  Gerardo Sanchez{-}Schmitz},
  title        = {An {IT} Service Management Methodology for an Electoral Public Institution},
  booktitle    = {3rd International Conference on Information and Computer Technologies,
                  {ICICT} 2020, San Jose, CA, USA, March 9-12, 2020},
  pages        = {219--223},
  year         = {2020},
  crossref     = {DBLP:conf/icict2/2020},
  url          = {https://doi.org/10.1109/ICICT50521.2020.00041},
  doi          = {10.1109/ICICT50521.2020.00041},
  timestamp    = {Tue, 19 May 2020 15:34:02 +0200},
  biburl       = {https://dblp.org/rec/conf/icict2/Barcelo-Valenzuela20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/SaldanhaSMA20,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Complexity Analysis Of {VVC} Intra Coding},
  booktitle    = {{IEEE} International Conference on Image Processing, {ICIP} 2020,
                  Abu Dhabi, United Arab Emirates, October 25-28, 2020},
  pages        = {3119--3123},
  year         = {2020},
  crossref     = {DBLP:conf/icip/2020},
  url          = {https://doi.org/10.1109/ICIP40778.2020.9190970},
  doi          = {10.1109/ICIP40778.2020.9190970},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/SaldanhaSMA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSMA20,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {Fast Partitioning Decision Scheme for Versatile Video Coding Intra-Frame
                  Prediction},
  booktitle    = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2020,
                  Sevilla, Spain, October 10-21, 2020},
  pages        = {1--5},
  year         = {2020},
  crossref     = {DBLP:conf/iscas/2020},
  url          = {https://doi.org/10.1109/ISCAS45731.2020.9180980},
  doi          = {10.1109/ISCAS45731.2020.9180980},
  timestamp    = {Mon, 18 Jan 2021 08:38:59 +0100},
  biburl       = {https://dblp.org/rec/conf/iscas/SaldanhaSMA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iticse/SanchezS20,
  author       = {Mario S{\'{a}}nchez and
                  Pedro Salazar},
  title        = {A feedback-oriented platform for deliberate programming practice},
  booktitle    = {Proceedings of the 2020 {ACM} Conference on Innovation and Technology
                  in Computer Science Education, ITiCSE 2020, Trondheim, Norway, June
                  15-19, 2020},
  pages        = {531--532},
  year         = {2020},
  crossref     = {DBLP:conf/iticse/2020},
  url          = {https://doi.org/10.1145/3341525.3393996},
  doi          = {10.1145/3341525.3393996},
  timestamp    = {Tue, 08 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iticse/SanchezS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Lara-CardenasSA20,
  author       = {Erick Lara{-}C{\'{a}}rdenas and
                  Xavier S{\'{a}}nchez{-}D{\'{\i}}az and
                  Iv{\'{a}}n Amaya and
                  Jorge M. Cruz{-}Duarte and
                  Jos{\'{e}} Carlos Ortiz{-}Bayliss},
  title        = {A Genetic Programming Framework for Heuristic Generation for the Job-Shop
                  Scheduling Problem},
  booktitle    = {Advances in Soft Computing - 19th Mexican International Conference
                  on Artificial Intelligence, {MICAI} 2020, Mexico City, Mexico, October
                  12-17, 2020, Proceedings, Part {I}},
  pages        = {284--295},
  year         = {2020},
  crossref     = {DBLP:conf/micai/2020-1},
  url          = {https://doi.org/10.1007/978-3-030-60884-2\_21},
  doi          = {10.1007/978-3-030-60884-2\_21},
  timestamp    = {Mon, 21 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/micai/Lara-CardenasSA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssci/Silva-GalvezOLO20,
  author       = {Arturo Silva{-}G{\'{a}}lvez and
                  Jorge Orozco{-}Sanchez and
                  Erick Lara{-}C{\'{a}}rdenas and
                  Jos{\'{e}} Carlos Ortiz{-}Bayliss and
                  Iv{\'{a}}n Amaya and
                  Jorge M. Cruz{-}Duarte and
                  Hugo Terashima{-}Mar{\'{\i}}n},
  title        = {Discovering Action Regions for Solving the Bin Packing Problem through
                  Hyper-heuristics},
  booktitle    = {2020 {IEEE} Symposium Series on Computational Intelligence, {SSCI}
                  2020, Canberra, Australia, December 1-4, 2020},
  pages        = {822--828},
  year         = {2020},
  crossref     = {DBLP:conf/ssci/2020},
  url          = {https://doi.org/10.1109/SSCI47803.2020.9308538},
  doi          = {10.1109/SSCI47803.2020.9308538},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ssci/Silva-GalvezOLO20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ssiai/TapiaPCL20,
  author       = {Luis Sanchez Tapia and
                  Marios S. Pattichis and
                  Sylvia Celed{\'{o}}n{-}Pattichis and
                  Carlos L{\'{o}}pez Leiva},
  title        = {The Importance of the Instantaneous Phase for Face Detection using
                  Simple Convolutional Neural Networks},
  booktitle    = {{IEEE} Southwest Symposium on Image Analysis and Interpretation, {SSIAI}
                  2020, Albuquerque, NM, USA, March 29-31, 2020},
  pages        = {1--4},
  year         = {2020},
  crossref     = {DBLP:conf/ssiai/2020},
  url          = {https://doi.org/10.1109/SSIAI49293.2020.9094589},
  doi          = {10.1109/SSIAI49293.2020.9094589},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ssiai/TapiaPCL20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2001-08168,
  author       = {Jean Michel de Souza Sant'Ana and
                  Arliones Hoeller and
                  Richard Demo Souza and
                  Samuel Montejo S{\'{a}}nchez and
                  Hirley Alves and
                  Mario de Noronha{-}Neto},
  title        = {Hybrid Coded Replication in LoRa Networks},
  journal      = {CoRR},
  volume       = {abs/2001.08168},
  year         = {2020},
  url          = {https://arxiv.org/abs/2001.08168},
  eprinttype    = {arXiv},
  eprint       = {2001.08168},
  timestamp    = {Fri, 24 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2001-08168.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Perez-MedinaGPV19,
  author       = {Jorge Luis P{\'{e}}rez{-}Medina and
                  Mario Gonz{\'{a}}lez and
                  Hennry Mauricio Pilco and
                  Karina Beatriz Jimenes Vargas and
                  Patricia Acosta{-}Vargas and
                  Sandra Sanchez{-}Gordon and
                  Tania Calle{-}Jimenez and
                  Danilo Esparza and
                  Yves Rybarczyk},
  title        = {Usability Study of a Web-Based Platform for Home Motor Rehabilitation},
  journal      = {{IEEE} Access},
  volume       = {7},
  pages        = {7932--7947},
  year         = {2019},
  url          = {https://doi.org/10.1109/ACCESS.2018.2889257},
  doi          = {10.1109/ACCESS.2018.2889257},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/Perez-MedinaGPV19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/Sanchez-Martinez19,
  author       = {Juan Jose Sanchez{-}Martinez and
                  Mario Perez{-}Escribano and
                  Enrique Marquez{-}Segura},
  title        = {Synthesis of Dual-Band Bandpass Filters With Short-Circuited Multiconductor
                  Transmission Lines and Shunt Open Stubs},
  journal      = {{IEEE} Access},
  volume       = {7},
  pages        = {24071--24081},
  year         = {2019},
  url          = {https://doi.org/10.1109/ACCESS.2018.2886657},
  doi          = {10.1109/ACCESS.2018.2886657},
  timestamp    = {Fri, 12 Apr 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/Sanchez-Martinez19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ascom/SanchezDLBCGQAC19,
  author       = {Bruno S{\'{a}}nchez and
                  Mariano Dom{\'{\i}}nguez and
                  Marcelo Lares and
                  Martin Beroiz and
                  Juan B. Cabral and
                  Sebasti{\'{a}}n Gurovich and
                  Cecilia Qui{\~{n}}ones and
                  Rodolfo A. Artola and
                  Carlos A. Colazo and
                  Mat{\'{\i}}as E. Schneiter and
                  Carla Girardini and
                  Marina Tornatore and
                  Jos Luis Nilo Castell{\'{o}}n and
                  Diego Garc{\'{\i}}a Lambas and
                  Mario C. D{\'{\i}}az},
  title        = {Machine learning on difference image analysis: {A} comparison of methods
                  for transient detection},
  journal      = {Astron. Comput.},
  volume       = {28},
  pages        = {100284},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.ascom.2019.05.002},
  doi          = {10.1016/J.ASCOM.2019.05.002},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ascom/SanchezDLBCGQAC19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bise/LaraSV19,
  author       = {Paola Lara and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {{OT} Modeling: The Enterprise Beyond {IT}},
  journal      = {Bus. Inf. Syst. Eng.},
  volume       = {61},
  number       = {4},
  pages        = {399--411},
  year         = {2019},
  url          = {https://doi.org/10.1007/s12599-018-0543-3},
  doi          = {10.1007/S12599-018-0543-3},
  timestamp    = {Fri, 09 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bise/LaraSV19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcisd/Perez-CastilloS19,
  author       = {Yunierkis P{\'{e}}rez{-}Castillo and
                  Stellamaris Sotomayor{-}Burneo and
                  Karina Beatriz Jimenes Vargas and
                  Mario Salvador Gonz{\'{a}}lez{-}Rodr{\'{\i}}guez and
                  Maykel Cruz{-}Monteagudo and
                  Vinicio Armijos{-}Jaramillo and
                  M. Nat{\'{a}}lia Dias Soeiro Cordeiro and
                  Fernanda Borges and
                  Aminael S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
                  Eduardo Tejera},
  title        = {CompScore: Boosting Structure-Based Virtual Screening Performance
                  by Incorporating Docking Scoring Function Components into Consensus
                  Scoring},
  journal      = {J. Chem. Inf. Model.},
  volume       = {59},
  number       = {9},
  pages        = {3655--3666},
  year         = {2019},
  url          = {https://doi.org/10.1021/acs.jcim.9b00343},
  doi          = {10.1021/ACS.JCIM.9B00343},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcisd/Perez-CastilloS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/MuhlbergerSTOBB19,
  author       = {G{\"{u}}nter M{\"{u}}hlberger and
                  Louise Seaward and
                  Melissa Terras and
                  Sofia Ares Oliveira and
                  Vicente Bosch and
                  Maximilian Bryan and
                  Sebastian Colutto and
                  Herv{\'{e}} D{\'{e}}jean and
                  Markus Diem and
                  Stefan Fiel and
                  Basilis Gatos and
                  Albert Greinoecker and
                  Tobias Gr{\"{u}}ning and
                  G{\"{u}}nter Hackl and
                  Vili Haukkovaara and
                  Gerhard Heyer and
                  Lauri Hirvonen and
                  Tobias Hodel and
                  Matti Jokinen and
                  Philip Kahle and
                  Mario Kallio and
                  Fr{\'{e}}d{\'{e}}ric Kaplan and
                  Florian Kleber and
                  Roger Labahn and
                  Eva Maria Lang and
                  S{\"{o}}ren Laube and
                  Gundram Leifert and
                  Georgios Louloudis and
                  Rory McNicholl and
                  Jean{-}Luc Meunier and
                  Johannes Michael and
                  Elena M{\"{u}}hlbauer and
                  Nathanael Philipp and
                  Ioannis Pratikakis and
                  Joan Puigcerver P{\'{e}}rez and
                  Hannelore Putz and
                  George Retsinas and
                  Ver{\'{o}}nica Romero and
                  Robert Sablatnig and
                  Joan{-}Andreu S{\'{a}}nchez and
                  Philip Schofield and
                  Giorgos Sfikas and
                  Christian Sieber and
                  Nikolaos Stamatopoulos and
                  Tobias Strau{\ss} and
                  Tamara Terbul and
                  Alejandro H. Toselli and
                  Berthold Ulreich and
                  Mauricio Villegas and
                  Enrique Vidal and
                  Johanna Walcher and
                  Max Weidemann and
                  Herbert Wurster and
                  Konstantinos Zagoris},
  title        = {Transforming scholarship in the archives through handwritten text
                  recognition},
  journal      = {J. Documentation},
  volume       = {75},
  number       = {5},
  pages        = {954--976},
  year         = {2019},
  url          = {https://doi.org/10.1108/JD-07-2018-0114},
  doi          = {10.1108/JD-07-2018-0114},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jd/MuhlbergerSTOBB19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jocs/PrimsCAMLSCD19,
  author       = {Oriol Tint{\'{o}} Prims and
                  Miguel Castrillo and
                  Mario C. Acosta and
                  Oriol Mula{-}Valls and
                  Alicia Sanchez Lorente and
                  Kim Serradell and
                  Ana Cort{\'{e}}s and
                  Francisco J. Doblas{-}Reyes},
  title        = {Finding, analysing and solving {MPI} communication bottlenecks in
                  Earth System models},
  journal      = {J. Comput. Sci.},
  volume       = {36},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.jocs.2018.04.015},
  doi          = {10.1016/J.JOCS.2018.04.015},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jocs/PrimsCAMLSCD19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/neuroimage/PremiCDGCAAPGSG19,
  author       = {Enrico Premi and
                  Vince D. Calhoun and
                  Matteo Diano and
                  Stefano Gazzina and
                  Maura Cosseddu and
                  Antonella Alberici and
                  Silvana Archetti and
                  Donata Paternic{\`{o}} and
                  Roberto Gasparotti and
                  John van Swieten and
                  Daniela Galimberti and
                  Raquel S{\'{a}}nchez{-}Valle and
                  Robert Laforce Jr. and
                  Fermin Moreno and
                  Matthis Synofzik and
                  Caroline Graff and
                  Mario Masellis and
                  Maria Carmela Tartaglia and
                  Miren Zulaica},
  title        = {The inner fluctuations of the brain in presymptomatic Frontotemporal
                  Dementia: The chronnectome fingerprint},
  journal      = {NeuroImage},
  volume       = {189},
  pages        = {645--654},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.neuroimage.2019.01.080},
  doi          = {10.1016/J.NEUROIMAGE.2019.01.080},
  timestamp    = {Tue, 02 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/neuroimage/PremiCDGCAAPGSG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/AraujoMDLSCC19,
  author       = {Lourdes Araujo and
                  Juan Mart{\'{\i}}nez{-}Romo and
                  Andr{\'{e}}s Duque and
                  Fernando L{\'{o}}pez{-}Ostenero and
                  Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
                  Adolfo Mu{\~{n}}oz Carrero and
                  Mario Pascual Carrasco},
  title        = {{EXTRAE:} EXTRacci{\'{o}}n de Asociaciones entre Enfermedades
                  y otros conceptos m{\'{e}}dicos},
  journal      = {Proces. del Leng. Natural},
  volume       = {63},
  pages        = {171--174},
  year         = {2019},
  url          = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/6112},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pdln/AraujoMDLSCC19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ploscb/BendallMILPOJMR19,
  author       = {Matthew L. Bendall and
                  Miguel de Mulder and
                  Luis Pedro I{\~{n}}iguez and
                  Aar{\'{o}}n Lecanda{-}S{\'{a}}nchez and
                  Marcos P{\'{e}}rez{-}Losada and
                  Mario A. Ostrowski and
                  R. Brad Jones and
                  Lubbertus C. F. Mulder and
                  Gustavo Reyes{-}Ter{\'{a}}n and
                  Keith A. Crandall and
                  Christopher E. Ormsby and
                  Douglas F. Nixon},
  title        = {Telescope: Characterization of the retrotranscriptome by accurate
                  estimation of transposable element expression},
  journal      = {PLoS Comput. Biol.},
  volume       = {15},
  number       = {9},
  year         = {2019},
  url          = {https://doi.org/10.1371/journal.pcbi.1006453},
  doi          = {10.1371/JOURNAL.PCBI.1006453},
  timestamp    = {Mon, 26 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ploscb/BendallMILPOJMR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/SernaLALG19,
  author       = {Mario Serna and
                  Abraham S{\'{a}}nchez L{\'{o}}pez and
                  Mart{\'{\i}}n Estrada Analco and
                  Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
                  Elberfeld E. P{\'{e}}rez G.},
  title        = {Navegaci{\'{o}}n de robots m{\'{o}}viles utilizando algoritmos
                  Bugs extendidos},
  journal      = {Res. Comput. Sci.},
  volume       = {148},
  number       = {8},
  pages        = {159--171},
  year         = {2019},
  url          = {https://rcs.cic.ipn.mx/2019\_148\_8/Navegacion\%20de\%20robots\%20moviles\%20utilizando\%20algoritmos\%20Bugs\%20extendidos.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/SernaLALG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Mate-GonzalezSB19,
  author       = {Miguel {\'{A}}ngel Mat{\'{e}}{-}Gonz{\'{a}}lez and
                  Luis Javier S{\'{a}}nchez{-}Aparicio and
                  Cristina S{\'{a}}ez Bl{\'{a}}zquez and
                  Pedro Carrasco Garc{\'{\i}}a and
                  David {\'{A}}lvarez{-}Alonso and
                  Mar{\'{\i}}a de Andr{\'{e}}s{-}Herrero and
                  Juan Carlos Garc{\'{\i}}a{-}Davalillo and
                  Diego Gonz{\'{a}}lez{-}Aguilera and
                  Mario Hern{\'{a}}ndez Ruiz and
                  Luis Jord{\'{a}} Bordehore and
                  Carlos L{\'{o}}pez Carnicero and
                  Roc{\'{\i}}o Mora},
  title        = {On the Combination of Remote Sensing and Geophysical Methods for the
                  Digitalization of the San L{\'{a}}zaro Middle Paleolithic Rock
                  Shelter (Segovia, Central Iberia, Spain)},
  journal      = {Remote. Sens.},
  volume       = {11},
  number       = {17},
  pages        = {2035},
  year         = {2019},
  url          = {https://doi.org/10.3390/rs11172035},
  doi          = {10.3390/RS11172035},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/Mate-GonzalezSB19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/QSS19,
  author       = {J. Antonio Guzm{\'{a}}n Q. and
                  G. Arturo Sanchez{-}Azofeifa and
                  Mario Marcos do Espirito Santo},
  title        = {{MODIS} and {PROBA-V} {NDVI} Products Differ when Compared with Observations
                  from Phenological Towers at Four Tropical Dry Forests in the Americas},
  journal      = {Remote. Sens.},
  volume       = {11},
  number       = {19},
  pages        = {2316},
  year         = {2019},
  url          = {https://doi.org/10.3390/rs11192316},
  doi          = {10.3390/RS11192316},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/QSS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/Sanchez-Rodriguez19,
  author       = {Ana S{\'{a}}nchez{-}Rodr{\'{\i}}guez and
                  Mario Soil{\'{a}}n and
                  Manuel Cabaleiro and
                  Pedro Arias},
  title        = {Automated Inspection of Railway Tunnels' Power Line Using LiDAR Point
                  Clouds},
  journal      = {Remote. Sens.},
  volume       = {11},
  number       = {21},
  pages        = {2567},
  year         = {2019},
  url          = {https://doi.org/10.3390/rs11212567},
  doi          = {10.3390/RS11212567},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/remotesensing/Sanchez-Rodriguez19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/remotesensing/TomasPNCPRCCBML19,
  author       = {Roberto Tom{\'{a}}s and
                  Jos{\'{e}} Ignacio Pag{\'{a}}n and
                  Jos{\'{e}} A. Navarro and
                  Miguel Cano and
                  Jos{\'{e}} Luis Pastor and
                  Adri{\'{a}}n J. Riquelme and
                  Mar{\'{\i}}a Cuevas{-}Gonz{\'{a}}lez and
                  Michele Crosetto and
                  Anna Barra and
                  Oriol Monserrat and
                  Juan M. Lopez{-}Sanchez and
                  Alfredo Ram{\'{o}}n and
                  Salvador Ivorra and
                  Matteo Del Soldato and
                  Lorenzo Solari and
                  Silvia Bianchini and
                  Federico Raspini and
                  Fabrizio Novali and
                  Alessandro Ferretti and
                  Mario Costantini and
                  Francesco Trillo and
                  Gerardo Herrera and
                  Nicola Casagli},
  title        = {Semi-Automatic Identification and Pre-Screening of Geological-Geotechnical
                  Deformational Processes Using Persistent Scatterer Interferometry
                  Datasets},
  journal      = {Remote. Sens.},
  volume       = {11},
  number       = {14},
  pages        = {1675},
  year         = {2019},
  url          = {https://doi.org/10.3390/rs11141675},
  doi          = {10.3390/RS11141675},
  timestamp    = {Thu, 04 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/remotesensing/TomasPNCPRCCBML19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sivp/SanchezSAM19,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Luciano Agostini and
                  C{\'{e}}sar A. M. Marcon},
  title        = {Analysis of parallel encoding using tiles in 3D High Efficiency Video
                  Coding},
  journal      = {Signal Image Video Process.},
  volume       = {13},
  number       = {6},
  pages        = {1079--1086},
  year         = {2019},
  url          = {https://doi.org/10.1007/s11760-019-01450-3},
  doi          = {10.1007/S11760-019-01450-3},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sivp/SanchezSAM19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/soco/PenaBLTPSMGC19,
  author       = {Alejandro Pe{\~{n}}a and
                  Isis Bonet and
                  Christian Lochmuller and
                  Marta S. Tabares and
                  Carlos C. Piedrahita and
                  Carmen C. S{\'{a}}nchez and
                  Lillyana Mar{\'{\i}}a Giraldo Mar{\'{\i}}n and
                  Mario Gongora and
                  Francisco Chiclana},
  title        = {A fuzzy {ELECTRE} structure methodology to assess big data maturity
                  in healthcare SMEs},
  journal      = {Soft Comput.},
  volume       = {23},
  number       = {20},
  pages        = {10537--10550},
  year         = {2019},
  url          = {https://doi.org/10.1007/s00500-018-3625-8},
  doi          = {10.1007/S00500-018-3625-8},
  timestamp    = {Tue, 03 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/soco/PenaBLTPSMGC19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/WuMS19,
  author       = {Chenchen Wu and
                  Mario E. Maga{\~{n}}a and
                  Eduardo Cotilla Sanchez},
  title        = {Dynamic Frequency and Amplitude Estimation for Three-Phase Unbalanced
                  Power Systems Using the Unscented Kalman Filter},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {68},
  number       = {9},
  pages        = {3387--3395},
  year         = {2019},
  url          = {https://doi.org/10.1109/TIM.2018.2875605},
  doi          = {10.1109/TIM.2018.2875605},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/WuMS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/LaraSHVV19,
  author       = {Paola Lara and
                  Mario E. S{\'{a}}nchez and
                  Andrea Herrera and
                  Karol Valdivieso and
                  Jorge Villalobos},
  title        = {Modeling Reverse Logistics Networks: {A} Case Study for {\unicode{8232}}E-Waste
                  Management Policy},
  booktitle    = {Information Systems Engineering in Responsible Information Systems
                  - CAiSE Forum 2019, Rome, Italy, June 3-7, 2019, Proceedings},
  pages        = {158--169},
  year         = {2019},
  crossref     = {DBLP:conf/caise/2019fo},
  url          = {https://doi.org/10.1007/978-3-030-21297-1\_14},
  doi          = {10.1007/978-3-030-21297-1\_14},
  timestamp    = {Fri, 31 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/LaraSHVV19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisis-spain/SanchezMDE19,
  author       = {Mar{\'{\i}}a Jes{\'{u}}s Santos S{\'{a}}nchez and
                  Mario Miguel and
                  Araceli Queiruga Dios and
                  Ascensi{\'{o}}n Hern{\'{a}}ndez Encinas},
  title        = {Looking for the Antidote for Contaminated Water: Learning Through
                  an Escape Game},
  booktitle    = {International Joint Conference: 12th International Conference on Computational
                  Intelligence in Security for Information Systems {(CISIS} 2019) and
                  10th International Conference on EUropean Transnational Education
                  {(ICEUTE} 2019) - Seville, Spain, May 13-15, 2019, Proceedings},
  pages        = {217--226},
  year         = {2019},
  crossref     = {DBLP:conf/cisis-spain/2019},
  url          = {https://doi.org/10.1007/978-3-030-20005-3\_22},
  doi          = {10.1007/978-3-030-20005-3\_22},
  timestamp    = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cisis-spain/SanchezMDE19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/citi/Machorro-CanoPA19,
  author       = {Isaac Machorro{-}Cano and
                  Mario Andr{\'{e}}s Paredes{-}Valverde and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
                  M{\'{o}}nica Guadalupe Segura Ozuna and
                  Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes},
  title        = {PESSHIoT: Smart Platform for Monitoring and Controlling Smart Home
                  Devices and Sensors},
  booktitle    = {Technologies and Innovation - 5th International Conference, {CITI}
                  2019, Guayaquil, Ecuador, December 2-5, 2019, Proceedings},
  pages        = {137--150},
  year         = {2019},
  crossref     = {DBLP:conf/citi/2019},
  url          = {https://doi.org/10.1007/978-3-030-34989-9\_11},
  doi          = {10.1007/978-3-030-34989-9\_11},
  timestamp    = {Thu, 19 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/citi/Machorro-CanoPA19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clei/DivanR19,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso},
  title        = {Incorporating Scenarios and States Definitions on Real-Time Entity
                  Monitoring in PAbMM},
  booktitle    = {{XLV} Latin American Computing Conference, {CLEI} 2019, Panama, September
                  30 - October 4, 2019},
  pages        = {1--10},
  year         = {2019},
  crossref     = {DBLP:conf/clei/2019},
  url          = {https://doi.org/10.1109/CLEI47609.2019.235072},
  doi          = {10.1109/CLEI47609.2019.235072},
  timestamp    = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/clei/DivanR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Ordonez-Sanchez19,
  author       = {Alejandro A. Ordo{\~{n}}ez{-}S{\'{a}}nchez and
                  Omar Jim{\'{e}}nez{-}Ram{\'{\i}}rez and
                  Jos{\'{e}} A. C{\'{a}}rdenas{-}Valderrama and
                  Mario Alan Quiroz{-}Ju{\'{a}}rez and
                  Leonardo Palacios{-}Luengas and
                  Rub{\'{e}}n V{\'{a}}zquez{-}Medina},
  title        = {Generator of Synthetic Dopaminergic Signals},
  booktitle    = {International Conference on Electronics, Communications and Computers,
                  {CONIELECOMP} 2019, Cholula, Mexico, February 27 - March 1, 2019},
  pages        = {31--35},
  year         = {2019},
  crossref     = {DBLP:conf/conielecomp/2019},
  url          = {https://doi.org/10.1109/CONIELECOMP.2019.8673110},
  doi          = {10.1109/CONIELECOMP.2019.8673110},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/conielecomp/Ordonez-Sanchez19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci-collab/LopezGAMCS19,
  author       = {Mario Rossainz L{\'{o}}pez and
                  Carmen Cer{\'{o}}n Garnica and
                  Etelvina Archundia{-}Sierra and
                  Ana Patricia Cervantes M{\'{a}}rquez and
                  David Carrasco{-}Lim{\'{o}}n and
                  B{\'{a}}rbara S{\'{a}}nchez{-}Rinza},
  title        = {Parallel Simulation of Digital Logic Circuits Using Message Passing
                  via {CSP} as an Educational Tool},
  booktitle    = {Human-Computer Interaction - 5th Iberoamerican Workshop, HCI-Collab
                  2019, Puebla, Mexico, June 19-21, 2019, Revised Selected Papers},
  pages        = {284--298},
  year         = {2019},
  crossref     = {DBLP:conf/hci-collab/2019},
  url          = {https://doi.org/10.1007/978-3-030-37386-3\_21},
  doi          = {10.1007/978-3-030-37386-3\_21},
  timestamp    = {Sat, 06 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hci-collab/LopezGAMCS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hci-collab/Sanchez-GalvezL19,
  author       = {Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Juan Manuel Fern{\'{a}}ndez Luna and
                  Mario Anzures{-}Garc{\'{\i}}a},
  title        = {A Groupware Usability-Oriented Evaluation Methodology Based on a Fuzzy
                  Linguistic Approach},
  booktitle    = {Human-Computer Interaction - 5th Iberoamerican Workshop, HCI-Collab
                  2019, Puebla, Mexico, June 19-21, 2019, Revised Selected Papers},
  pages        = {1--16},
  year         = {2019},
  crossref     = {DBLP:conf/hci-collab/2019},
  url          = {https://doi.org/10.1007/978-3-030-37386-3\_1},
  doi          = {10.1007/978-3-030-37386-3\_1},
  timestamp    = {Fri, 31 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hci-collab/Sanchez-GalvezL19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Lopez-TapiaRASF19,
  author       = {Andrea L{\'{o}}pez{-}Tapia and
                  Mario Alfredo Reyes{-}Barranca and
                  Griselda Stephany Abarca{-}Jimenez and
                  Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
                  Luis Mart{\'{\i}}n Flores{-}Nava and
                  Oliverio Arellano{-}C{\'{a}}rdenas},
  title        = {Design and analysis of the mechanical structure of a linear micromotor
                  based on {CMOS-MEMS} technology},
  booktitle    = {16th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2019, Mexico City, Mexico, September
                  11-13, 2019},
  pages        = {1--6},
  year         = {2019},
  crossref     = {DBLP:conf/iceee/2019},
  url          = {https://doi.org/10.1109/ICEEE.2019.8884566},
  doi          = {10.1109/ICEEE.2019.8884566},
  timestamp    = {Fri, 27 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iceee/Lopez-TapiaRASF19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Sanchez-Marquez19,
  author       = {Luis S{\'{a}}nchez{-}M{\'{a}}rquez and
                  Mario Alfredo Reyes{-}Barranca and
                  Griselda Stephany Abarca{-}Jimenez and
                  Andrea L{\'{o}}pez{-}Tapia and
                  Luis Mart{\'{\i}}n Flores{-}Nava and
                  Oliverio Arellano{-}C{\'{a}}rdenas},
  title        = {Proposal of a speed sensor based on {FGMOS} for a {MEMS} rotatory
                  micromotor},
  booktitle    = {16th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2019, Mexico City, Mexico, September
                  11-13, 2019},
  pages        = {1--6},
  year         = {2019},
  crossref     = {DBLP:conf/iceee/2019},
  url          = {https://doi.org/10.1109/ICEEE.2019.8884574},
  doi          = {10.1109/ICEEE.2019.8884574},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/Sanchez-Marquez19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/BernabeGFPHPP19,
  author       = {Sergio Bernab{\'{e}} and
                  Carlos Garc{\'{\i}}a and
                  Rub{\'{e}}n Fern{\'{a}}ndez{-}Beltran and
                  Mercedes Eugenia Paoletti and
                  Juan Mario Haut and
                  Javier Plaza and
                  Antonio Plaza},
  title        = {Open Multi-Processing Acceleration for Unsupervised Land Cover Categorization
                  Using Probabilistic Latent Semantic Analysis},
  booktitle    = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
                  {IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
  pages        = {9835--9838},
  year         = {2019},
  crossref     = {DBLP:conf/igarss/2019},
  url          = {https://doi.org/10.1109/IGARSS.2019.8898507},
  doi          = {10.1109/IGARSS.2019.8898507},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/BernabeGFPHPP19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSZMA19,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  Bruno Zatt and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Agostini},
  title        = {{TITAN:} Tile Timing-Aware Balancing Algorithm for Speeding Up the
                  3D-HEVC Intra Coding},
  booktitle    = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2019,
                  Sapporo, Japan, May 26-29, 2019},
  pages        = {1--5},
  year         = {2019},
  crossref     = {DBLP:conf/iscas/2019},
  url          = {https://doi.org/10.1109/ISCAS.2019.8702475},
  doi          = {10.1109/ISCAS.2019.8702475},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/SaldanhaSZMA19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/DavilaGPDSR19,
  author       = {Carlos D{\'{a}}vila and
                  Mario Gonz{\'{a}}lez and
                  Jorge Luis P{\'{e}}rez{-}Medina and
                  David Dominguez and
                  {\'{A}}ngel S{\'{a}}nchez and
                  Francisco B. Rodr{\'{\i}}guez},
  title        = {Ensemble of Attractor Networks for 2D Gesture Retrieval},
  booktitle    = {Advances in Computational Intelligence - 15th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
                  June 12-14, 2019, Proceedings, Part {II}},
  pages        = {488--499},
  year         = {2019},
  crossref     = {DBLP:conf/iwann/2019-2},
  url          = {https://doi.org/10.1007/978-3-030-20518-8\_41},
  doi          = {10.1007/978-3-030-20518-8\_41},
  timestamp    = {Sat, 01 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/DavilaGPDSR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/GonzalezDDSR19,
  author       = {Mario Gonz{\'{a}}lez and
                  Carlos D{\'{a}}vila and
                  David Dominguez and
                  {\'{A}}ngel S{\'{a}}nchez and
                  Francisco B. Rodr{\'{\i}}guez},
  title        = {Fingerprint Retrieval Using a Specialized Ensemble of Attractor Networks},
  booktitle    = {Advances in Computational Intelligence - 15th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
                  June 12-14, 2019, Proceedings, Part {II}},
  pages        = {709--719},
  year         = {2019},
  crossref     = {DBLP:conf/iwann/2019-2},
  url          = {https://doi.org/10.1007/978-3-030-20518-8\_59},
  doi          = {10.1007/978-3-030-20518-8\_59},
  timestamp    = {Sat, 01 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/GonzalezDDSR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/Nimo-JarquezRRY19,
  author       = {Dami{\'{a}}n Nimo{-}J{\'{a}}rquez and
                  Magaly Margarita Narvaez{-}Rios and
                  Mario Rivas{-}S{\'{a}}nchez and
                  Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and
                  Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and
                  Maria De La Paz Guerrero{-}Lebrero and
                  Elisa Guerrero and
                  Pedro L. Galindo},
  title        = {{AL4LA:} Active Learning for Text Labeling Based on Paragraph Vectors},
  booktitle    = {Advances in Computational Intelligence - 15th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
                  June 12-14, 2019, Proceedings, Part {I}},
  pages        = {679--687},
  year         = {2019},
  crossref     = {DBLP:conf/iwann/2019-1},
  url          = {https://doi.org/10.1007/978-3-030-20521-8\_56},
  doi          = {10.1007/978-3-030-20521-8\_56},
  timestamp    = {Tue, 16 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/Nimo-JarquezRRY19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19,
  author       = {Ziawasch Abedjan and
                  Nozha Boujemaa and
                  Stuart Campbell and
                  Patricia Casla and
                  Supriyo Chatterjea and
                  Sergio Consoli and
                  Crist{\'{o}}bal Costa Soria and
                  Paul Czech and
                  Marija Despenic and
                  Chiara Garattini and
                  Dirk Hamelinck and
                  Adrienne Heinrich and
                  Wessel Kraaij and
                  Jacek Kustra and
                  Aizea Lojo and
                  Marga Martin Sanchez and
                  Miguel Angel Mayer and
                  Matteo Melideo and
                  Ernestina Menasalvas and
                  Frank M{\o}ller Aarestrup and
                  Elvira Narro Artigot and
                  Milan Petkovic and
                  Diego Reforgiato Recupero and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Gisele Roesems Kerremans and
                  Roland Roller and
                  M{\'{a}}rio Rom{\~{a}}o and
                  Stefan R{\"{u}}ping and
                  Felix Sasaki and
                  Wouter Spek and
                  Nenad Stojanovic and
                  Jack Thoms and
                  Andrejs Vasiljevs and
                  Wilfried Verachtert and
                  Roel Wuyts},
  title        = {Data Science in Healthcare: Benefits, Challenges and Opportunities},
  booktitle    = {Data Science for Healthcare - Methodologies and Applications},
  pages        = {3--38},
  year         = {2019},
  crossref     = {DBLP:books/sp/CRP2019},
  url          = {https://doi.org/10.1007/978-3-030-05249-2\_1},
  doi          = {10.1007/978-3-030-05249-2\_1},
  timestamp    = {Fri, 22 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/igisc/2019,
  editor       = {Oscar S. Siordia and
                  Jos{\'{e}} Luis Silv{\'{a}}n{-}C{\'{a}}rdenas and
                  Alejandro Molina{-}Villegas and
                  Gandhi Hern{\'{a}}ndez{-}Chan and
                  Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and
                  Rodrigo Tapia{-}McClung and
                  Karime Gonz{\'{a}}lez Zuccolotto and
                  Mario Chirinos Colunga},
  title        = {Proceedings of the 1st International Conference on Geospatial Information
                  Sciences, iGISc 2019, M{\'{e}}rida, Yucat{\'{a}}n, M{\'{e}}xico,
                  October 23-25, 2019},
  series       = {Kalpa Publications in Computing},
  volume       = {13},
  publisher    = {EasyChair},
  year         = {2019},
  url          = {https://easychair.org/publications/volume/iGISc\_2019},
  timestamp    = {Fri, 10 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/igisc/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1907-07066,
  author       = {Claudia N. S{\'{a}}nchez and
                  Mario Graff},
  title        = {Selection Heuristics on Semantic Genetic Programming for Classification
                  Problems},
  journal      = {CoRR},
  volume       = {abs/1907.07066},
  year         = {2019},
  url          = {http://arxiv.org/abs/1907.07066},
  eprinttype    = {arXiv},
  eprint       = {1907.07066},
  timestamp    = {Tue, 23 Jul 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1907-07066.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/candc/ModicaSPOMC18,
  author       = {Maria Vittoria Modica and
                  Jonathan Reinoso S{\'{a}}nchez and
                  Andrea Pasquadibisceglie and
                  Marco Oliverio and
                  Paolo Mariottini and
                  Manuela Cervelli},
  title        = {Anti-haemostatic compounds from the vampire snail \emph{Cumia reticulata}:
                  Molecular cloning and \emph{in-silico} structure-function analysis},
  journal      = {Comput. Biol. Chem.},
  volume       = {75},
  pages        = {168--177},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.compbiolchem.2018.05.014},
  doi          = {10.1016/J.COMPBIOLCHEM.2018.05.014},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/candc/ModicaSPOMC18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comcom/Sanchez-GarciaG18,
  author       = {Jes{\'{u}}s S{\'{a}}nchez{-}Garc{\'{\i}}a and
                  Jos{\'{e}} M. Garc{\'{\i}}a{-}Campos and
                  Mario Arzamendia and
                  Daniel Guti{\'{e}}rrez{-}Reina and
                  Sergio L. Toral Mar{\'{\i}}n and
                  Derlis Gregor},
  title        = {A survey on unmanned aerial and aquatic vehicle multi-hop networks:
                  Wireless communications, evaluation tools and applications},
  journal      = {Comput. Commun.},
  volume       = {119},
  pages        = {43--65},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.comcom.2018.02.002},
  doi          = {10.1016/J.COMCOM.2018.02.002},
  timestamp    = {Tue, 15 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/comcom/Sanchez-GarciaG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Anzures-GarciaS18,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Miguel J. Hornos and
                  Patricia Paderewski{-}Rodr{\'{\i}}guez},
  title        = {A Workflow Ontology to support Knowledge Management in a Group's organizational
                  structure},
  journal      = {Computaci{\'{o}}n y Sistemas},
  volume       = {22},
  number       = {1},
  year         = {2018},
  url          = {https://doi.org/10.13053/cys-22-1-2781},
  doi          = {10.13053/CYS-22-1-2781},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cys/Anzures-GarciaS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/GonzalezSDA18,
  author       = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
                  Jorge Cerezo S{\'{a}}nchez and
                  Mario Bustillo D{\'{\i}}az and
                  Apolonio Ata{-}P{\'{e}}rez},
  title        = {Recognition and Classification of Sign Language for Spanish},
  journal      = {Computaci{\'{o}}n y Sistemas},
  volume       = {22},
  number       = {1},
  year         = {2018},
  url          = {https://doi.org/10.13053/cys-22-1-2780},
  doi          = {10.13053/CYS-22-1-2780},
  timestamp    = {Fri, 10 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cys/GonzalezSDA18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Saldana-Gonzalez18,
  author       = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
                  Jorge Cerezo S{\'{a}}nchez and
                  Mario Bustillo D{\'{\i}}az and
                  Apolonio Ata{-}P{\'{e}}rez},
  title        = {Vision System for the Navigation of a Mobile Robot},
  journal      = {Computaci{\'{o}}n y Sistemas},
  volume       = {22},
  number       = {1},
  year         = {2018},
  url          = {https://doi.org/10.13053/cys-22-1-2770},
  doi          = {10.13053/CYS-22-1-2770},
  timestamp    = {Fri, 10 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cys/Saldana-Gonzalez18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/Sanchez-ReyesRT18,
  author       = {Sergio S{\'{a}}nchez{-}Reyes and
                  Mario E. Rivero{-}Angeles and
                  No{\'{e}} Torres{-}Cruz},
  title        = {Teletraffic Analysis for VoIP Services in {WLAN} Systems with Handoff
                  Capabilities},
  journal      = {Computaci{\'{o}}n y Sistemas},
  volume       = {22},
  number       = {3},
  year         = {2018},
  url          = {https://doi.org/10.13053/cys-22-3-2749},
  doi          = {10.13053/CYS-22-3-2749},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cys/Sanchez-ReyesRT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fini/Ruiz-GomezGPMTC18,
  author       = {Sa{\'{u}}l J. Ruiz{-}G{\'{o}}mez and
                  Carlos G{\'{o}}mez and
                  Jes{\'{u}}s Poza and
                  Mario Mart{\'{\i}}nez{-}Zarzuela and
                  Miguel {\'{A}}ngel Tola{-}Arribas and
                  M{\'{o}}nica Cano and
                  Roberto Hornero},
  title        = {Measuring Alterations of Spontaneous {EEG} Neural Coupling in Alzheimer's
                  Disease and Mild Cognitive Impairment by Means of Cross-Entropy Metrics},
  journal      = {Frontiers Neuroinformatics},
  volume       = {12},
  pages        = {76},
  year         = {2018},
  url          = {https://doi.org/10.3389/fninf.2018.00076},
  doi          = {10.3389/FNINF.2018.00076},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fini/Ruiz-GomezGPMTC18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/iet-spr/MunozMS18,
  author       = {Juan Pablo Mu{\~{n}}oz and
                  Mario E. Maga{\~{n}}a and
                  Eduardo Cotilla Sanchez},
  title        = {Adaptive master-slave unscented Kalman filter for grid voltage frequency
                  estimation},
  journal      = {{IET} Signal Process.},
  volume       = {12},
  number       = {4},
  pages        = {496--505},
  year         = {2018},
  url          = {https://doi.org/10.1049/iet-spr.2016.0199},
  doi          = {10.1049/IET-SPR.2016.0199},
  timestamp    = {Tue, 12 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/iet-spr/MunozMS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/PenaCAJLMGS18,
  author       = {Mario Pe{\~{n}}a and
                  Mariela Cerrada and
                  Ximena Alvarez and
                  Diana Jad{\'{a}}n and
                  Pablo Lucero and
                  Barrag{\'{a}}n Milton and
                  Rodrigo Guam{\'{a}}n and
                  Ren{\'{e}}{-}Vinicio S{\'{a}}nchez},
  title        = {Feature engineering based on ANOVA, cluster validity assessment and
                  {KNN} for fault diagnosis in bearings},
  journal      = {J. Intell. Fuzzy Syst.},
  volume       = {34},
  number       = {6},
  pages        = {3451--3462},
  year         = {2018},
  url          = {https://doi.org/10.3233/JIFS-169525},
  doi          = {10.3233/JIFS-169525},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jifs/PenaCAJLMGS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/Bustos-LopezASS18,
  author       = {Maritza Bustos{-}L{\'{o}}pez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
                  Mario Andr{\'{e}}s Paredes{-}Valverde},
  title        = {EduRP: an Educational Resources Platform based on Opinion Mining and
                  Semantic Web},
  journal      = {J. Univers. Comput. Sci.},
  volume       = {24},
  number       = {11},
  pages        = {1515--1535},
  year         = {2018},
  url          = {http://www.jucs.org/jucs\_24\_11/edurp\_an\_educational\_resources},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jucs/Bustos-LopezASS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/DiazLSVL18,
  author       = {Enrique D{\'{\i}}az and
                  Abraham S{\'{a}}nchez L{\'{o}}pez and
                  Mario Serna and
                  Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
                  Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca}},
  title        = {Planificaci{\'{o}}n reactiva de movimientos en tiempo real para
                  robots m{\'{o}}viles},
  journal      = {Res. Comput. Sci.},
  volume       = {147},
  number       = {7},
  pages        = {115--128},
  year         = {2018},
  url          = {https://rcs.cic.ipn.mx/2018\_147\_7/Planificacion\%20reactiva\%20de\%20movimientos\%20en\%20tiempo\%20real\%20para\%20robots\%20moviles.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/DiazLSVL18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Lopez-RamirezMS18,
  author       = {Pablo L{\'{o}}pez{-}Ram{\'{\i}}rez and
                  Alejandro Molina{-}Villegas and
                  Oscar S{\'{a}}nchez Siordia and
                  Mario Chirinos Colunga and
                  Gandhi Hern{\'{a}}ndez{-}Chan},
  title        = {Regular Activity Patterns in Spatio-Temporal Events Databases: Multi-Scale
                  Extraction of Geolocated Tweets},
  journal      = {Res. Comput. Sci.},
  volume       = {147},
  number       = {12},
  pages        = {137--150},
  year         = {2018},
  url          = {https://rcs.cic.ipn.mx/2018\_147\_12/Regular\%20Activity\%20Patterns\%20in\%20Spatio-Temporal\%20Events\%20Databases\_\%20Multi-Scale\%20Extraction.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/Lopez-RamirezMS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tgrs/Nieto-HidalgoGG18,
  author       = {Mario Nieto{-}Hidalgo and
                  Antonio Javier Gallego and
                  Pablo Gil and
                  Antonio Pertusa},
  title        = {Two-Stage Convolutional Neural Network for Ship and Spill Detection
                  Using {SLAR} Images},
  journal      = {{IEEE} Trans. Geosci. Remote. Sens.},
  volume       = {56},
  number       = {9},
  pages        = {5217--5230},
  year         = {2018},
  url          = {https://doi.org/10.1109/TGRS.2018.2812619},
  doi          = {10.1109/TGRS.2018.2812619},
  timestamp    = {Fri, 02 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tgrs/Nieto-HidalgoGG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/MorianoRBMR18,
  author       = {Javier Moriano and
                  Mario Rizo and
                  Emilio Jos{\'{e}} Bueno and
                  Rocio Martin and
                  Francisco J. Rodr{\'{\i}}guez},
  title        = {A Novel Multifrequency Current Reference Calculation to Mitigate Active
                  Power Fluctuations},
  journal      = {{IEEE} Trans. Ind. Electron.},
  volume       = {65},
  number       = {1},
  pages        = {810--818},
  year         = {2018},
  url          = {https://doi.org/10.1109/TIE.2017.2686319},
  doi          = {10.1109/TIE.2017.2686319},
  timestamp    = {Thu, 25 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tie/MorianoRBMR18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/OsorioAVPSMB18,
  author       = {Ren{\'{e}} Osorio and
                  J. Marcos Alonso and
                  Nimrod V{\'{a}}zquez and
                  Sergio Pinto and
                  Felipe De Jesus Sorcia{-}Vazquez and
                  Mario Mart{\'{\i}}nez{-}Garc{\'{\i}}a and
                  Luis Manuel Barrera},
  title        = {Fuzzy Logic Control With an Improved Algorithm for Integrated {LED}
                  Drivers},
  journal      = {{IEEE} Trans. Ind. Electron.},
  volume       = {65},
  number       = {9},
  pages        = {6994--7003},
  year         = {2018},
  url          = {https://doi.org/10.1109/TIE.2018.2795565},
  doi          = {10.1109/TIE.2018.2795565},
  timestamp    = {Fri, 22 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tie/OsorioAVPSMB18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/urban/OrganeroRF18,
  author       = {Mario Mu{\~{n}}oz Organero and
                  Ramona Ruiz{-}Blazquez and
                  Luis S{\'{a}}nchez Fern{\'{a}}ndez},
  title        = {Automatic detection of traffic lights, street crossings and urban
                  roundabouts combining outlier detection and deep learning classification
                  techniques based on {GPS} traces while driving},
  journal      = {Comput. Environ. Urban Syst.},
  volume       = {68},
  pages        = {1--8},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.compenvurbsys.2017.09.005},
  doi          = {10.1016/J.COMPENVURBSYS.2017.09.005},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/urban/OrganeroRF18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcis/RomeroSV18,
  author       = {Mar{\'{\i}}a Camila Romero and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Executable Business Model Blueprints},
  booktitle    = {24th Americas Conference on Information Systems, {AMCIS} 2018, New
                  Orleans, LA, USA, August 16-18, 2018},
  year         = {2018},
  crossref     = {DBLP:conf/amcis/2018},
  url          = {https://aisel.aisnet.org/amcis2018/Enterprise/Presentations/5},
  timestamp    = {Mon, 22 Oct 2018 17:24:45 +0200},
  biburl       = {https://dblp.org/rec/conf/amcis/RomeroSV18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/appis/Barcena-Gonzalez18,
  author       = {Guillermo B{\'{a}}rcena{-}Gonz{\'{a}}lez and
                  Maria De La Paz Guerrero{-}Lebrero and
                  Elisa Guerrero and
                  D. F. Reyes and
                  B. Nu{\~{n}}ez{-}Moraleda and
                  Mario Rivas{-}S{\'{a}}nchez and
                  Andr{\'{e}}s Y{\'{a}}{\~{n}}ez and
                  David Gonz{\'{a}}lez and
                  Pedro L. Galindo},
  title        = {Application of Super-Resolution Techniques to Transmission Electron
                  Microscopy Images},
  booktitle    = {Applications of Intelligent Systems - Proceedings of the 1st International
                  {APPIS} Conference 2018, Las Palmas de Gran Canaria, Spain, 8-12 January
                  2018},
  pages        = {42--49},
  year         = {2018},
  crossref     = {DBLP:conf/appis/2018},
  url          = {https://doi.org/10.3233/978-1-61499-929-4-42},
  doi          = {10.3233/978-1-61499-929-4-42},
  timestamp    = {Sun, 25 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/appis/Barcena-Gonzalez18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccia/GatziouraSJ18,
  author       = {Anna Gatzioura and
                  Miquel S{\`{a}}nchez{-}Marr{\`{e}} and
                  Al{\'{\i}}pio M{\'{a}}rio Jorge},
  title        = {A Study on Contextual Influences on Automatic Playlist Continuation},
  booktitle    = {Artificial Intelligence Research and Development - Current Challenges,
                  New Trends and Applications, {CCIA} 2018, 21st International Conference
                  of the Catalan Association for Artificial Intelligence, Alt Empord{\`{a}},
                  Catalonia, Spain, 8-10th October 2018},
  pages        = {156--165},
  year         = {2018},
  crossref     = {DBLP:conf/ccia/2018},
  url          = {https://doi.org/10.3233/978-1-61499-918-8-156},
  doi          = {10.3233/978-1-61499-918-8-156},
  timestamp    = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ccia/GatziouraSJ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/citi/Ochoa-Hernandez18,
  author       = {Jos{\'{e}} Luis Ochoa{-}Hern{\'{a}}ndez and
                  Mario Barcelo{-}Valenzuela and
                  Gerardo Sanchez{-}Schmitz and
                  Raquel Torres Peralta},
  title        = {Concept Identification from Single-Documents},
  booktitle    = {Technologies and Innovation - 4th International Conference, {CITI}
                  2018, Guayaquil, Ecuador, November 6-9, 2018, Proceedings},
  pages        = {158--173},
  year         = {2018},
  crossref     = {DBLP:conf/citi/2018},
  url          = {https://doi.org/10.1007/978-3-030-00940-3\_12},
  doi          = {10.1007/978-3-030-00940-3\_12},
  timestamp    = {Tue, 16 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/citi/Ochoa-Hernandez18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/AlmagroMIP18,
  author       = {Mario Almagro and
                  Soto Montalvo and
                  Arantza D{\'{\i}}az de Ilarraza and
                  Alicia P{\'{e}}rez},
  title        = {{MAMTRA-MED} at {CLEF} eHealth 2018: {A} Combination of Information
                  Retrieval Techniques and Neural Networks for {ICD-10} Coding of Death
                  Certificates},
  booktitle    = {Working Notes of {CLEF} 2018 - Conference and Labs of the Evaluation
                  Forum, Avignon, France, September 10-14, 2018},
  year         = {2018},
  crossref     = {DBLP:conf/clef/2018w},
  url          = {https://ceur-ws.org/Vol-2125/paper\_110.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:23:36 +0100},
  biburl       = {https://dblp.org/rec/conf/clef/AlmagroMIP18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPZVBL18,
  author       = {Matej Kristan and
                  Ales Leonardis and
                  Jiri Matas and
                  Michael Felsberg and
                  Roman P. Pflugfelder and
                  Luka Cehovin Zajc and
                  Tom{\'{a}}s Voj{\'{\i}}r and
                  Goutam Bhat and
                  Alan Lukezic and
                  Abdelrahman Eldesokey and
                  Gustavo Fern{\'{a}}ndez and
                  {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
                  {\'{A}}lvaro Iglesias{-}Arias and
                  A. Aydin Alatan and
                  Abel Gonz{\'{a}}lez{-}Garc{\'{\i}}a and
                  Alfredo Petrosino and
                  Alireza Memarmoghadam and
                  Andrea Vedaldi and
                  Andrej Muhic and
                  Anfeng He and
                  Arnold W. M. Smeulders and
                  Asanka G. Perera and
                  Bo Li and
                  Boyu Chen and
                  Changick Kim and
                  Changsheng Xu and
                  Changzhen Xiong and
                  Cheng Tian and
                  Chong Luo and
                  Chong Sun and
                  Cong Hao and
                  Daijin Kim and
                  Deepak Mishra and
                  Deming Chen and
                  Dong Wang and
                  Dongyoon Wee and
                  Efstratios Gavves and
                  Erhan Gundogdu and
                  Erik Velasco{-}Salido and
                  Fahad Shahbaz Khan and
                  Fan Yang and
                  Fei Zhao and
                  Feng Li and
                  Francesco Battistone and
                  George De Ath and
                  Gorthi R. K. Sai Subrahmanyam and
                  Guilherme Sousa Bastos and
                  Haibin Ling and
                  Hamed Kiani Galoogahi and
                  Hankyeol Lee and
                  Haojie Li and
                  Haojie Zhao and
                  Heng Fan and
                  Honggang Zhang and
                  Horst Possegger and
                  Houqiang Li and
                  Huchuan Lu and
                  Hui Zhi and
                  Huiyun Li and
                  Hyemin Lee and
                  Hyung Jin Chang and
                  Isabela Drummond and
                  Jack Valmadre and
                  Jaime Spencer Martin and
                  Javaan Singh Chahl and
                  Jin Young Choi and
                  Jing Li and
                  Jinqiao Wang and
                  Jinqing Qi and
                  Jinyoung Sung and
                  Joakim Johnander and
                  Jo{\~{a}}o F. Henriques and
                  Jongwon Choi and
                  Joost van de Weijer and
                  Jorge Rodr{\'{\i}}guez Herranz and
                  Jos{\'{e}} M. Mart{\'{\i}}nez and
                  Josef Kittler and
                  Junfei Zhuang and
                  Junyu Gao and
                  Klemen Grm and
                  Lichao Zhang and
                  Lijun Wang and
                  Lingxiao Yang and
                  Litu Rout and
                  Liu Si and
                  Luca Bertinetto and
                  Lutao Chu and
                  Manqiang Che and
                  Mario Edoardo Maresca and
                  Martin Danelljan and
                  Ming{-}Hsuan Yang and
                  Mohamed H. Abdelpakey and
                  Mohamed S. Shehata and
                  Myunggu Kang and
                  Namhoon Lee and
                  Ning Wang and
                  Ondrej Miksik and
                  Payman Moallem and
                  Pablo Vicente{-}Mo{\~{n}}ivar and
                  Pedro Senna and
                  Peixia Li and
                  Philip H. S. Torr and
                  Priya Mariam Raju and
                  Ruihe Qian and
                  Qiang Wang and
                  Qin Zhou and
                  Qing Guo and
                  Rafael Martin Nieto and
                  Rama Krishna Sai Subrahmanyam Gorthi and
                  Ran Tao and
                  Richard Bowden and
                  Richard M. Everson and
                  Runling Wang and
                  Sangdoo Yun and
                  Seokeon Choi and
                  Sergio Vivas and
                  Shuai Bai and
                  Shuangping Huang and
                  Sihang Wu and
                  Simon Hadfield and
                  Siwen Wang and
                  Stuart Golodetz and
                  Ming Tang and
                  Tianyang Xu and
                  Tianzhu Zhang and
                  Tobias Fischer and
                  Vincenzo Santopietro and
                  Vitomir Struc and
                  Wei Wang and
                  Wangmeng Zuo and
                  Wei Feng and
                  Wei Wu and
                  Wei Zou and
                  Weiming Hu and
                  Wengang Zhou and
                  Wenjun Zeng and
                  Xiaofan Zhang and
                  Xiaohe Wu and
                  Xiao{-}Jun Wu and
                  Xinmei Tian and
                  Yan Li and
                  Yan Lu and
                  Yee Wei Law and
                  Yi Wu and
                  Yiannis Demiris and
                  Yicai Yang and
                  Yifan Jiao and
                  Yuhong Li and
                  Yunhua Zhang and
                  Yuxuan Sun and
                  Zheng Zhang and
                  Zheng Zhu and
                  Zhen{-}Hua Feng and
                  Zhihui Wang and
                  Zhiqun He},
  title        = {The Sixth Visual Object Tracking {VOT2018} Challenge Results},
  booktitle    = {Computer Vision - {ECCV} 2018 Workshops - Munich, Germany, September
                  8-14, 2018, Proceedings, Part {I}},
  pages        = {3--53},
  year         = {2018},
  crossref     = {DBLP:conf/eccv/2018w1},
  url          = {https://doi.org/10.1007/978-3-030-11009-3\_1},
  doi          = {10.1007/978-3-030-11009-3\_1},
  timestamp    = {Wed, 14 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/KristanLMFPZVBL18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/SaldanhaSMA18,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  C{\'{e}}sar A. M. Marcon and
                  Luciano Volcan Agostini},
  title        = {Fast 3D-Hevc Depth Maps Intra-Frame Prediction Using Data Mining},
  booktitle    = {2018 {IEEE} International Conference on Acoustics, Speech and Signal
                  Processing, {ICASSP} 2018, Calgary, AB, Canada, April 15-20, 2018},
  pages        = {1738--1742},
  year         = {2018},
  crossref     = {DBLP:conf/icassp/2018},
  url          = {https://doi.org/10.1109/ICASSP.2018.8462283},
  doi          = {10.1109/ICASSP.2018.8462283},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/SaldanhaSMA18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ipmu/ValdezGLG18,
  author       = {Mario Garc{\'{\i}}a Valdez and
                  Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Lucero Lara and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez},
  title        = {Increasing Performance via Gamification in a Volunteer-Based Evolutionary
                  Computation System},
  booktitle    = {Information Processing and Management of Uncertainty in Knowledge-Based
                  Systems. Applications - 17th International Conference, {IPMU} 2018,
                  C{\'{a}}diz, Spain, June 11-15, 2018, Proceedings, Part {III}},
  pages        = {342--353},
  year         = {2018},
  crossref     = {DBLP:conf/ipmu/2018-3},
  url          = {https://doi.org/10.1007/978-3-319-91479-4\_29},
  doi          = {10.1007/978-3-319-91479-4\_29},
  timestamp    = {Thu, 07 Jan 2021 08:57:40 +0100},
  biburl       = {https://dblp.org/rec/conf/ipmu/ValdezGLG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ni/GarciaMFNMS18,
  author       = {Jessica Juarez Garc{\'{\i}}a and
                  Adriana Jord{\'{a}}n Morales and
                  Lizbeth Garc{\'{\i}}a Fern{\'{a}}ndez and
                  Reyna Rosas Negrete and
                  Mario Enrique Rend{\'{o}}n Macias and
                  Sylvia Claudine Ram{\'{\i}}rez S{\'{a}}nchez},
  title        = {Use of Distraction to Reduce Pain in Venipunture when a Venoclysis
                  Is Placed},
  booktitle    = {Nursing Informatics 2018 - {ICT} to Improve Quality and Safety at
                  the Point of Care, Proceedings of the 14th International Congress
                  on Nursing Informatics, Guadalajara, Mexico, June 6-8, 2018},
  pages        = {24--25},
  year         = {2018},
  crossref     = {DBLP:conf/ni/2018},
  url          = {https://doi.org/10.3233/978-1-61499-872-3-24},
  doi          = {10.3233/978-1-61499-872-3-24},
  timestamp    = {Tue, 09 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ni/GarciaMFNMS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rice/SanchezGSG18,
  author       = {Claudia N. S{\'{a}}nchez and
                  Sebasti{\'{a}}n Guti{\'{e}}rrez and
                  Julieta Dom{\'{\i}}nguez{-}Soberanes and
                  Mario Graff},
  title        = {Landscape images distance using kullback leibler divergence},
  booktitle    = {Proceedings of the 2018 {IEEE} International Conference on Research
                  in Intelligent and Computing in Engineering, {RICE} 2018, San Salvador,
                  El Salvador, August 22-24, 2018},
  pages        = {1--5},
  year         = {2018},
  crossref     = {DBLP:conf/rice/2018},
  url          = {https://doi.org/10.1109/RICE.2018.8627908},
  doi          = {10.1109/RICE.2018.8627908},
  timestamp    = {Tue, 23 Apr 2024 09:24:14 +0200},
  biburl       = {https://dblp.org/rec/conf/rice/SanchezGSG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sbcci/SanchezSAM18,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Luciano Volcan Agostini and
                  C{\'{e}}sar A. M. Marcon},
  title        = {Hardware-Oriented Wedgelet Evaluation Skip for {DMM-1} in 3D-HEVC},
  booktitle    = {31st Symposium on Integrated Circuits and Systems Design, {SBCCI}
                  2018, Bento Gon{\c{c}}alves, RS, Brazil, August 27-31, 2018},
  pages        = {1--5},
  year         = {2018},
  crossref     = {DBLP:conf/sbcci/2018},
  url          = {https://doi.org/10.1109/SBCCI.2018.8533231},
  doi          = {10.1109/SBCCI.2018.8533231},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sbcci/SanchezSAM18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sepln/GraffMTMSOS18,
  author       = {Mario Graff and
                  Sabino Miranda{-}Jim{\'{e}}nez and
                  Eric Sadit Tellez and
                  Daniela Moctezuma and
                  Vladimir Salgado and
                  Jos{\'{e}} Ortiz{-}Bejar and
                  Claudia N. S{\'{a}}nchez},
  title        = {{INGEOTEC} at {MEX-A3T:} Author Profiling and Aggressiveness Analysis
                  in Twitter Using {\(\mu\)}TC and EvoMSA},
  booktitle    = {Proceedings of the Third Workshop on Evaluation of Human Language
                  Technologies for Iberian Languages (IberEval 2018) co-located with
                  34th Conference of the Spanish Society for Natural Language Processing
                  {(SEPLN} 2018), Sevilla, Spain, September 18th, 2018},
  pages        = {128--133},
  year         = {2018},
  crossref     = {DBLP:conf/sepln/2018ibereval},
  url          = {https://ceur-ws.org/Vol-2150/MEX-A3T\_paper6.pdf},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sepln/GraffMTMSOS18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/NaranjoSMBG17,
  author       = {Claudia Carricarte Naranjo and
                  Lazaro M. Sanchez{-}Rodriguez and
                  Marta Brown Mart{\'{\i}}nez and
                  Mario Est{\'{e}}vez B{\'{a}}ez and
                  Andr{\'{e}}s Machado Garc{\'{\i}}a},
  title        = {Permutation entropy analysis of heart rate variability for the assessment
                  of cardiovascular autonomic neuropathy in type 1 diabetes mellitus},
  journal      = {Comput. Biol. Medicine},
  volume       = {86},
  pages        = {90--97},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.compbiomed.2017.05.003},
  doi          = {10.1016/J.COMPBIOMED.2017.05.003},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cbm/NaranjoSMBG17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GonzalezDSR17,
  author       = {Mario Gonz{\'{a}}lez and
                  David Dominguez and
                  {\'{A}}ngel S{\'{a}}nchez and
                  Francisco B. Rodr{\'{\i}}guez},
  title        = {Increase attractor capacity using an ensembled neural network},
  journal      = {Expert Syst. Appl.},
  volume       = {71},
  pages        = {206--215},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.eswa.2016.11.035},
  doi          = {10.1016/J.ESWA.2016.11.035},
  timestamp    = {Sat, 01 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/GonzalezDSR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/TellezMGMSV17,
  author       = {Eric Sadit Tellez and
                  Sabino Miranda{-}Jim{\'{e}}nez and
                  Mario Graff and
                  Daniela Moctezuma and
                  Oscar S. Siordia and
                  Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
  title        = {A case study of Spanish text transformations for twitter sentiment
                  analysis},
  journal      = {Expert Syst. Appl.},
  volume       = {81},
  pages        = {457--471},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.eswa.2017.03.071},
  doi          = {10.1016/J.ESWA.2017.03.071},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/TellezMGMSV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ett/ContrerasCT17,
  author       = {David Contreras and
                  Mario Castro and
                  David S{\'{a}}nchez de la Torre},
  title        = {Performance evaluation of bluetooth low energy in indoor positioning
                  systems},
  journal      = {Trans. Emerg. Telecommun. Technol.},
  volume       = {28},
  number       = {1},
  year         = {2017},
  url          = {https://doi.org/10.1002/ett.2864},
  doi          = {10.1002/ETT.2864},
  timestamp    = {Wed, 04 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ett/ContrerasCT17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcopi/LorancaAVLSD17,
  author       = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
                  Mart{\'{\i}}n Estrada Analco and
                  Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
                  Abraham S{\'{a}}nchez L{\'{o}}pez and
                  Jorge Cerezo S{\'{a}}nchez and
                  Mario Bustillo D{\'{\i}}az},
  title        = {Quadratic Assignation Problem: {A} solution approach with parallel
                  {GRASP}},
  journal      = {Int. J. Comb. Optim. Probl. Informatics},
  volume       = {8},
  number       = {3},
  pages        = {33--38},
  year         = {2017},
  url          = {https://ijcopi.org/index.php/ojs/article/view/16},
  timestamp    = {Thu, 24 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijcopi/LorancaAVLSD17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcta/OsorioAPMVPM17,
  author       = {Ren{\'{e}} Osorio and
                  Jos{\'{e}} Marcos Alonso and
                  Sergio Pinto and
                  Gilberto Mart{\'{\i}}nez and
                  Nimrod V{\'{a}}zquez and
                  Mario Ponce{-}Silva and
                  A. J. Martinez},
  title        = {Simplified electrical modelling of power LEDs for {DC-DC} converter
                  analysis and simulation},
  journal      = {Int. J. Circuit Theory Appl.},
  volume       = {45},
  number       = {11},
  pages        = {1760--1772},
  year         = {2017},
  url          = {https://doi.org/10.1002/cta.2355},
  doi          = {10.1002/CTA.2355},
  timestamp    = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijcta/OsorioAPMVPM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jaihc/PastorMSNC17,
  author       = {Francisco Javier Ferr{\'{a}}ndez Pastor and
                  Higinio Mora Mora and
                  Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and
                  Mario Nieto{-}Hidalgo and
                  Juan Manuel Garc{\'{\i}}a Chamizo},
  title        = {Interpreting human activity from electrical consumption data using
                  reconfigurable hardware and hidden Markov models},
  journal      = {J. Ambient Intell. Humaniz. Comput.},
  volume       = {8},
  number       = {4},
  pages        = {469--483},
  year         = {2017},
  url          = {https://doi.org/10.1007/s12652-016-0431-y},
  doi          = {10.1007/S12652-016-0431-Y},
  timestamp    = {Fri, 09 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jaihc/PastorMSNC17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jrtip/SaldanhaSZPA17,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini},
  title        = {Energy-aware scheme for the 3D-HEVC depth maps prediction},
  journal      = {J. Real Time Image Process.},
  volume       = {13},
  number       = {1},
  pages        = {55--69},
  year         = {2017},
  url          = {https://doi.org/10.1007/s11554-016-0597-8},
  doi          = {10.1007/S11554-016-0597-8},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jrtip/SaldanhaSZPA17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/Sanchez-de-Madariaga17,
  author       = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
                  Adolfo Mu{\~{n}}oz and
                  Raimundo Lozano{-}Rub{\'{\i}} and
                  Pablo Serrano{-}Balazote and
                  Antonio L. Castro and
                  Oscar Moreno and
                  Mario Pascual Carrasco},
  title        = {Examining database persistence of {ISO/EN} 13606 standardized electronic
                  health record extracts: relational vs. NoSQL approaches},
  journal      = {{BMC} Medical Informatics Decis. Mak.},
  volume       = {17},
  number       = {1},
  pages        = {123:1--123:14},
  year         = {2017},
  url          = {https://doi.org/10.1186/s12911-017-0515-4},
  doi          = {10.1186/S12911-017-0515-4},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/midm/Sanchez-de-Madariaga17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nature/DudasCBTBFPLAAB17,
  author       = {Gytis Dudas and
                  Luiz Max Carvalho and
                  Trevor Bedford and
                  Andrew J. Tatem and
                  Guy Baele and
                  Nuno R. Faria and
                  Daniel J. Park and
                  Jason T. Ladner and
                  Armando Arias and
                  Danny Asogun and
                  Filip Bielejec and
                  Sarah L. Caddy and
                  Matthew Cotten and
                  Jonathan D'Ambrozio and
                  Simon Dellicour and
                  Antonino Di Caro and
                  Joseph W. Diclaro and
                  Sophie Duraffour and
                  Michael J. Elmore and
                  Lawrence S. Fakoli and
                  Ousmane Faye and
                  Merle L. Gilbert and
                  Sahr M. Gevao and
                  Stephen Gire and
                  Adrianne Gladden{-}Young and
                  Andreas Gnirke and
                  Augustine Goba and
                  Donald S. Grant and
                  Bart L. Haagmans and
                  Julian A. Hiscox and
                  Umaru Jah and
                  Jeffrey R. Kugelman and
                  Di Liu and
                  Jia Lu and
                  Christine M. Malboeuf and
                  Suzanne Mate and
                  David A. Matthews and
                  Christian B. Matranga and
                  Luke W. Meredith and
                  James Qu and
                  Joshua Quick and
                  Suzan D. Pas and
                  My V. T. Phan and
                  Georgios Pollakis and
                  Chantal B. Reusken and
                  Mariano Sanchez{-}Lockhart and
                  Stephen F. Schaffner and
                  John S. Schieffelin and
                  Rachel S. G. Sealfon and
                  Etienne Simon{-}Loriere and
                  Saskia L. Smits and
                  Kilian Stoecker and
                  Lucy Thorne and
                  Ekaete Alice Tobin and
                  Mohamed A. Vandi and
                  Simon J. Watson and
                  Kendra West and
                  Shannon Whitmer and
                  Michael R. Wiley and
                  Sarah M. Winnicki and
                  Shirlee Wohl and
                  Roman W{\"{o}}lfel and
                  Nathan L. Yozwiak and
                  Kristian G. Andersen and
                  Sylvia O. Blyden and
                  Fatorma Bolay and
                  Miles W. Carroll and
                  Bernice Dahn and
                  Boubacar Diallo and
                  Pierre Formenty and
                  Christophe Fraser and
                  George F. Gao and
                  Robert F. Garry and
                  Ian Goodfellow and
                  Stephan G{\"{u}}nther and
                  Christian T. Happi and
                  Edward C. Holmes and
                  Brima Kargbo and
                  Sakoba Ke{\"{\i}}ta and
                  Paul Kellam and
                  Marion Koopmans and
                  Jens H. Kuhn and
                  Nicholas J. Loman and
                  N'Faly Magassouba and
                  Dhamari Naidoo and
                  Stuart T. Nichol and
                  Tolbert Nyenswah and
                  Gustavo F. Palacios and
                  Oliver G. Pybus and
                  Pardis C. Sabeti and
                  Amadou Sall and
                  Ute Str{\"{o}}her and
                  Isatta Wurie and
                  Marc A. Suchard and
                  Philippe Lemey and
                  Andrew Rambaut},
  title        = {Virus genomes reveal factors that spread and sustained the Ebola epidemic},
  journal      = {Nat.},
  volume       = {544},
  number       = {7650},
  pages        = {309--315},
  year         = {2017},
  url          = {https://doi.org/10.1038/nature22040},
  doi          = {10.1038/NATURE22040},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nature/DudasCBTBFPLAAB17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/SanchezPVAA17,
  author       = {Francisco Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Mario Andr{\'{e}}s Paredes{-}Valverde and
                  Rafael Valencia{-}Garc{\'{\i}}a and
                  Gema Alcaraz{-}M{\'{a}}rmol and
                  {\'{A}}ngela Almela},
  title        = {{KBS4FIA:} Leveraging advanced knowledge-based systems for financial
                  information analysis},
  journal      = {Proces. del Leng. Natural},
  volume       = {59},
  pages        = {145--148},
  year         = {2017},
  url          = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/5507},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pdln/SanchezPVAA17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/TellezMGMSS17,
  author       = {Eric Sadit Tellez and
                  Sabino Miranda{-}Jim{\'{e}}nez and
                  Mario Graff and
                  Daniela Moctezuma and
                  Ranyart Rodrigo Su{\'{a}}rez and
                  Oscar S{\'{a}}nchez Siordia},
  title        = {A simple approach to multilingual polarity classification in Twitter},
  journal      = {Pattern Recognit. Lett.},
  volume       = {94},
  pages        = {68--74},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.patrec.2017.05.024},
  doi          = {10.1016/J.PATREC.2017.05.024},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/prl/TellezMGMSS17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sosym/Sanchez-Gonzalez17,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Francisco Ruiz and
                  Mario Piattini},
  title        = {A case study about the improvement of business process models driven
                  by indicators},
  journal      = {Softw. Syst. Model.},
  volume       = {16},
  number       = {3},
  pages        = {759--788},
  year         = {2017},
  url          = {https://doi.org/10.1007/s10270-015-0482-0},
  doi          = {10.1007/S10270-015-0482-0},
  timestamp    = {Fri, 18 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sosym/Sanchez-Gonzalez17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/ReyesSPH17,
  author       = {Benjam{\'{\i}}n T. Reyes and
                  Raul M. Sanchez and
                  Ariel L. Pola and
                  Mario R. Hueda},
  title        = {Design and Experimental Evaluation of a Time-Interleaved {ADC} Calibration
                  Algorithm for Application in High-Speed Communication Systems},
  journal      = {{IEEE} Trans. Circuits Syst. {I} Regul. Pap.},
  volume       = {64-I},
  number       = {5},
  pages        = {1019--1030},
  year         = {2017},
  url          = {https://doi.org/10.1109/TCSI.2016.2636209},
  doi          = {10.1109/TCSI.2016.2636209},
  timestamp    = {Mon, 20 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcas/ReyesSPH17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/RodriguezOMM17,
  author       = {Mario Rodr{\'{\i}}guez and
                  Carlos Orrite and
                  Carlos Medrano and
                  Dimitrios Makris},
  title        = {One-Shot Learning of Human Activity With an {MAP} Adapted {GMM} and
                  Simplex-HMM},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {47},
  number       = {7},
  pages        = {1769--1780},
  year         = {2017},
  url          = {https://doi.org/10.1109/TCYB.2016.2558447},
  doi          = {10.1109/TCYB.2016.2558447},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/RodriguezOMM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/GarridoSVG17,
  author       = {Mario Garrido and
                  Miguel Angel S{\'{a}}nchez and
                  Mar{\'{\i}}a Luisa L{\'{o}}pez Vallejo and
                  Jes{\'{u}}s Grajal},
  title        = {A 4096-Point Radix-4 Memory-Based {FFT} Using {DSP} Slices},
  journal      = {{IEEE} Trans. Very Large Scale Integr. Syst.},
  volume       = {25},
  number       = {1},
  pages        = {375--379},
  year         = {2017},
  url          = {https://doi.org/10.1109/TVLSI.2016.2567784},
  doi          = {10.1109/TVLSI.2016.2567784},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tvlsi/GarridoSVG17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bis/SaenzCSV17,
  author       = {Juan Pablo S{\'{a}}enz and
                  Steve C{\'{a}}rdenas and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Semi-automated Model-Based Generation of Enterprise Architecture Deliverables},
  booktitle    = {Business Information Systems - 20th International Conference, {BIS}
                  2017, Poznan, Poland, June 28-30, 2017, Proceedings},
  pages        = {59--73},
  year         = {2017},
  crossref     = {DBLP:conf/bis/2017},
  url          = {https://doi.org/10.1007/978-3-319-59336-4\_5},
  doi          = {10.1007/978-3-319-59336-4\_5},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/bis/SaenzCSV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/GomezSLR17,
  author       = {Nancy Lizbeth Cruz G{\'{o}}mez and
                  {\'{A}}ngel Quintero S{\'{a}}nchez and
                  Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and
                  Mario Alberto Moreno Rocha},
  title        = {{SBK:} Smart Braille Keyboard for Learning Braille Literacy in Blind
                  or Visually Impaired People},
  booktitle    = {Proceedings of the 8th Latin American Conference on Human-Computer
                  Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10,
                  2017},
  pages        = {26:1--26:4},
  year         = {2017},
  crossref     = {DBLP:conf/clihc/2017},
  url          = {https://doi.org/10.1145/3151470.3156645},
  doi          = {10.1145/3151470.3156645},
  timestamp    = {Mon, 06 Nov 2023 17:08:49 +0100},
  biburl       = {https://dblp.org/rec/conf/clihc/GomezSLR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/HerreraGSC17,
  author       = {Andres E. Acevedo Herrera and
                  Garc{\'{\i}}a Gonz{\'{a}}lez Gabriel and
                  Luis {\'{A}}ngel Ort{\'{\i}}z S{\'{a}}nchez and
                  Mario David May Cuevas},
  title        = {Light Cane: An Augmented Blind Cane to Help Users to Cross the Street},
  booktitle    = {Proceedings of the 8th Latin American Conference on Human-Computer
                  Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10,
                  2017},
  pages        = {13:1--13:4},
  year         = {2017},
  crossref     = {DBLP:conf/clihc/2017},
  url          = {https://doi.org/10.1145/3151470.3156635},
  doi          = {10.1145/3151470.3156635},
  timestamp    = {Thu, 25 Nov 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/clihc/HerreraGSC17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clihc/RochaSLG17,
  author       = {Mario Alberto Moreno Rocha and
                  {\'{A}}ngel Quintero S{\'{a}}nchez and
                  Eneas Kevin Garc{\'{\i}}a L{\'{o}}pez and
                  Nancy Lizbeth Cruz G{\'{o}}mez},
  title        = {Incorporating Technology into Braille Learning Through a User-Centered
                  Methodology},
  booktitle    = {Proceedings of the 8th Latin American Conference on Human-Computer
                  Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10,
                  2017},
  pages        = {15:1--15:4},
  year         = {2017},
  crossref     = {DBLP:conf/clihc/2017},
  url          = {https://doi.org/10.1145/3151470.3156638},
  doi          = {10.1145/3151470.3156638},
  timestamp    = {Thu, 25 Nov 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/clihc/RochaSLG17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conf-irm/GiraldoHSV17,
  author       = {David Giraldo and
                  Andrea Herrera and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Analysis of {ICT} services by observing "fit for use" attributes},
  booktitle    = {2017 International Conference on Information Resources Management
                  - Democratization and Participation: People's Roles in Digital World,
                  {CONF-IRM} 2017, Santiago de Chile, Chile, May 17-19, 2017},
  pages        = {3},
  year         = {2017},
  crossref     = {DBLP:conf/conf-irm/2017},
  url          = {http://aisel.aisnet.org/confirm2017/3},
  timestamp    = {Tue, 22 Aug 2017 11:34:43 +0200},
  biburl       = {https://dblp.org/rec/conf/conf-irm/GiraldoHSV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/csedu/CasasSV17,
  author       = {Lina Casas and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Using an {IT} Laboratory for Training {IT} Architects},
  booktitle    = {{CSEDU} 2017 - Proceedings of the 9th International Conference on
                  Computer Supported Education, Volume 1, Porto, Portugal, April 21-23,
                  2017},
  pages        = {108--119},
  year         = {2017},
  crossref     = {DBLP:conf/csedu/2017-1},
  url          = {https://doi.org/10.5220/0006319901080119},
  doi          = {10.5220/0006319901080119},
  timestamp    = {Fri, 16 Jun 2017 14:43:56 +0200},
  biburl       = {https://dblp.org/rec/conf/csedu/CasasSV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/RodriguezOMM17,
  author       = {Mario Rodr{\'{\i}}guez and
                  Carlos Orrite and
                  Carlos Medrano and
                  Dimitrios Makris},
  title        = {Fast Simplex-HMM for One-Shot Learning Activity Recognition},
  booktitle    = {2017 {IEEE} Conference on Computer Vision and Pattern Recognition
                  Workshops, {CVPR} Workshops 2017, Honolulu, HI, USA, July 21-26, 2017},
  pages        = {1259--1266},
  year         = {2017},
  crossref     = {DBLP:conf/cvpr/2017w},
  url          = {https://doi.org/10.1109/CVPRW.2017.166},
  doi          = {10.1109/CVPRW.2017.166},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/RodriguezOMM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV17,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Visualizing the Bias of Enterprise Metamodels towards Nuanced Concepts},
  booktitle    = {21st {IEEE} International Enterprise Distributed Object Computing
                  Conference, {EDOC} 2017, Quebec City, QC, Canada, October 10-13, 2017},
  pages        = {30--39},
  year         = {2017},
  crossref     = {DBLP:conf/edoc/2017},
  url          = {https://doi.org/10.1109/EDOC.2017.14},
  doi          = {10.1109/EDOC.2017.14},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/edoc/NaranjoSV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emoocs/RivoMCCMGAAA17,
  author       = {Manuel Sanjurjo Rivo and
                  Mario Merino and
                  Filippo Cichocki and
                  Xin Chen and
                  David Morante and
                  Daniel P{\'{e}}rez Grande and
                  Gonzalo S{\'{a}}nchez Arriaga and
                  Manuel Soler Arnedo and
                  Eduardo Ahedo},
  title        = {The Conquest of Space: un Curso {MOOC} y {SPOC} en Ingenier{\'{\i}}a
                  Aeroespacial},
  booktitle    = {Actas de la Jornada de MOOCs en Espa{\~{n}}ol en EMOOCs 2017, EMOOCs-ES
                  2017, Madrid, Spain, May 26, 2017},
  pages        = {91--97},
  year         = {2017},
  crossref     = {DBLP:conf/emoocs/2017es},
  url          = {https://ceur-ws.org/Vol-1836/10.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:22:15 +0100},
  biburl       = {https://dblp.org/rec/conf/emoocs/RivoMCCMGAAA17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/SanchezSAM17,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Luciano Volcan Agostini and
                  C{\'{e}}sar A. M. Marcon},
  title        = {Depth modeling modes complexity control system for the 3D-HEVC video
                  encoder},
  booktitle    = {25th European Signal Processing Conference, {EUSIPCO} 2017, Kos, Greece,
                  August 28 - September 2, 2017},
  pages        = {1021--1025},
  year         = {2017},
  crossref     = {DBLP:conf/eusipco/2017},
  url          = {https://doi.org/10.23919/EUSIPCO.2017.8081362},
  doi          = {10.23919/EUSIPCO.2017.8081362},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eusipco/SanchezSAM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/SanchezSZPAM17,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini and
                  C{\'{e}}sar A. M. Marcon},
  title        = {Edge-aware depth motion estimation - {A} complexity reduction scheme
                  for 3D-HEVC},
  booktitle    = {25th European Signal Processing Conference, {EUSIPCO} 2017, Kos, Greece,
                  August 28 - September 2, 2017},
  pages        = {1524--1528},
  year         = {2017},
  crossref     = {DBLP:conf/eusipco/2017},
  url          = {https://doi.org/10.23919/EUSIPCO.2017.8081464},
  doi          = {10.23919/EUSIPCO.2017.8081464},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eusipco/SanchezSZPAM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/GuervosBCRGRVHR17,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Israel Blancas{-}Alvarez and
                  Pedro A. Castillo and
                  Gustavo Romero and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  V{\'{\i}}ctor M. Rivas and
                  Mario Garc{\'{\i}}a Valdez and
                  Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and
                  Mario Rom{\'{a}}n},
  title        = {Ranking Programming Languages for Evolutionary Algorithm Operations},
  booktitle    = {Applications of Evolutionary Computation - 20th European Conference,
                  EvoApplications 2017, Amsterdam, The Netherlands, April 19-21, 2017,
                  Proceedings, Part {I}},
  pages        = {689--704},
  year         = {2017},
  crossref     = {DBLP:conf/evoW/2017a-1},
  url          = {https://doi.org/10.1007/978-3-319-55849-3\_44},
  doi          = {10.1007/978-3-319-55849-3\_44},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/evoW/GuervosBCRGRVHR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/MereloCGV17,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Paloma de las Cuevas and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Mario Garc{\'{\i}}a Valdez},
  title        = {A Performance Assessment of Evolutionary Algorithms in Volunteer Computing
                  Environments: The Importance of Entropy},
  booktitle    = {Applications of Evolutionary Computation - 20th European Conference,
                  EvoApplications 2017, Amsterdam, The Netherlands, April 19-21, 2017,
                  Proceedings, Part {I}},
  pages        = {806--821},
  year         = {2017},
  crossref     = {DBLP:conf/evoW/2017a-1},
  url          = {https://doi.org/10.1007/978-3-319-55849-3\_52},
  doi          = {10.1007/978-3-319-55849-3\_52},
  timestamp    = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/evoW/MereloCGV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/RodriguezOM17,
  author       = {Mario Rodr{\'{\i}}guez and
                  Carlos Orrite and
                  Carlos Medrano},
  title        = {Space-Time Flexible Kernel for Recognizing Activities from Wearable
                  Cameras},
  booktitle    = {Pattern Recognition and Image Analysis - 8th Iberian Conference, IbPRIA
                  2017, Faro, Portugal, June 20-23, 2017, Proceedings},
  pages        = {511--518},
  year         = {2017},
  crossref     = {DBLP:conf/ibpria/2017},
  url          = {https://doi.org/10.1007/978-3-319-58838-4\_56},
  doi          = {10.1007/978-3-319-58838-4\_56},
  timestamp    = {Tue, 07 May 2024 20:05:10 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/RodriguezOM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icar/SanchezR17,
  author       = {O. Nelson Andres Sanchez and
                  Mario Fernando De la Rosa Rosero},
  title        = {Path planning and following using genetic algorithms to solve the
                  multi-travel salesman problem in dynamic scenarios},
  booktitle    = {18th International Conference on Advanced Robotics, {ICAR} 2017, Hong
                  Kong, China, July 10-12, 2017},
  pages        = {204--209},
  year         = {2017},
  crossref     = {DBLP:conf/icar/2017},
  url          = {https://doi.org/10.1109/ICAR.2017.8023519},
  doi          = {10.1109/ICAR.2017.8023519},
  timestamp    = {Wed, 16 Oct 2019 14:14:48 +0200},
  biburl       = {https://dblp.org/rec/conf/icar/SanchezR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccS/TintoACCSSD17,
  author       = {Oriol Tint{\'{o}} and
                  Mario C. Acosta and
                  Miguel Castrillo and
                  Ana Cort{\'{e}}s and
                  Alicia Sanchez Lorente and
                  Kim Serradell and
                  Francisco J. Doblas{-}Reyes},
  title        = {Optimizing domain decomposition in an ocean model: the case of {NEMO}},
  booktitle    = {International Conference on Computational Science, {ICCS} 2017, 12-14
                  June 2017, Zurich, Switzerland},
  pages        = {776--785},
  year         = {2017},
  crossref     = {DBLP:conf/iccS/2017},
  url          = {https://doi.org/10.1016/j.procs.2017.05.257},
  doi          = {10.1016/J.PROCS.2017.05.257},
  timestamp    = {Thu, 08 Jul 2021 16:04:01 +0200},
  biburl       = {https://dblp.org/rec/conf/iccS/TintoACCSSD17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/RomeroSV17,
  author       = {Mar{\'{\i}}a Camila Romero and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Business Model Pattern Execution - {A} System Dynamics Application},
  booktitle    = {{ICEIS} 2017 - Proceedings of the 19th International Conference on
                  Enterprise Information Systems, Volume 3, Porto, Portugal, April 26-29,
                  2017},
  pages        = {440--447},
  year         = {2017},
  crossref     = {DBLP:conf/iceis/2017-3},
  url          = {https://doi.org/10.5220/0006369704400447},
  doi          = {10.5220/0006369704400447},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/RomeroSV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17,
  author       = {R{\'{o}}n{\'{a}}n O'Caoimh and
                  D. William Molloy and
                  Carol Fitzgerald and
                  Lex van Velsen and
                  Miriam Cabrita and
                  Mohammad Hossein Nassabi and
                  Frederiek de Vette and
                  Marit Dekker{-}van Weering and
                  Stephanie Jansen{-}Kosterink and
                  Wander Kenter and
                  Sanne Frazer and
                  Am{\'{e}}lia P. Rauter and
                  Maria Ant{\'{o}}nia Amaral Turkman and
                  Mar{\'{\i}}lia Antunes and
                  Feridun Turkman and
                  Marta Sousa Silva and
                  Alice Martins and
                  Helena S. Costa and
                  T{\^{a}}nia Gon{\c{c}}alves Albuquerque and
                  Ant{\'{o}}nio E. N. Ferreira and
                  Mario Scherillo and
                  Vincenzo De Luca and
                  Maddalena Illario and
                  Alejandro Garc{\'{\i}}a{-}Rudolph and
                  Rocio Sanchez{-}Carrion and
                  Javier Solana S{\'{a}}nchez and
                  Enrique J. G{\'{o}}mez Aguilera and
                  Hermie Hermens and
                  Miriam M. R. Vollenbroek{-}Hutten},
  title        = {Healthcare Recommendations from the Personalised {ICT} Supported Service
                  for Independent Living and Active Ageing {(PERSSILAA)} Study},
  booktitle    = {Proceedings of the 3rd International Conference on Information and
                  Communication Technologies for Ageing Well and e-Health, ICT4AgeingWell
                  2017, Porto, Portugal, April 28-29, 2017},
  pages        = {91--103},
  year         = {2017},
  crossref     = {DBLP:conf/ict4ageingwell/2017},
  url          = {https://doi.org/10.5220/0006331800910103},
  doi          = {10.5220/0006331800910103},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ict4ageingwell/OCaoimhMFVCNVWJ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ict4ageingwell/OCaoimhMFVCNVWJ17a,
  author       = {R{\'{o}}n{\'{a}}n O'Caoimh and
                  D. William Molloy and
                  Carol Fitzgerald and
                  Lex van Velsen and
                  Miriam Cabrita and
                  Mohammad Hossein Nassabi and
                  Frederiek de Vette and
                  Marit Dekker{-}van Weering and
                  Stephanie Jansen{-}Kosterink and
                  Wander Kenter and
                  Sanne Frazer and
                  Am{\'{e}}lia P. Rauter and
                  Maria Ant{\'{o}}nia Amaral Turkman and
                  Mar{\'{\i}}lia Antunes and
                  Feridun Turkman and
                  Marta Sousa Silva and
                  Alice Martins and
                  Helena S. Costa and
                  T{\^{a}}nia Gon{\c{c}}alves Albuquerque and
                  Ant{\'{o}}nio E. N. Ferreira and
                  Mario Scherillo and
                  Vincenzo De Luca and
                  Pasquale Abete and
                  Annamaria Colao and
                  Alejandro Garc{\'{\i}}a{-}Rudolph and
                  Rocio Sanchez{-}Carrion and
                  Javier Solana S{\'{a}}nchez and
                  Enrique J. G{\'{o}}mez Aguilera and
                  Maddalena Illario and
                  Hermie Hermens and
                  Miriam M. R. Vollenbroek{-}Hutten},
  title        = {ICT-Supported Interventions Targeting Pre-frailty: Healthcare Recommendations
                  from the Personalised {ICT} Supported Service for Independent Living
                  and Active Ageing {(PERSSILAA)} Study},
  booktitle    = {Information and Communication Technologies for Ageing Well and e-Health
                  - Third International Conference, {ICT4AWE} 2017, Porto, Portugal,
                  April 28-29, 2017, Revised Selected Papers},
  pages        = {69--92},
  year         = {2017},
  crossref     = {DBLP:conf/ict4ageingwell/2017s},
  url          = {https://doi.org/10.1007/978-3-319-93644-4\_4},
  doi          = {10.1007/978-3-319-93644-4\_4},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ict4ageingwell/OCaoimhMFVCNVWJ17a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/ZhangWBKS17,
  author       = {Ying Zhang and
                  Wenfei Wu and
                  Sujata Banerjee and
                  Joon{-}Myung Kang and
                  Mario A. S{\'{a}}nchez},
  title        = {SLA-verifier: Stateful and quantitative verification for service chaining},
  booktitle    = {2017 {IEEE} Conference on Computer Communications, {INFOCOM} 2017,
                  Atlanta, GA, USA, May 1-4, 2017},
  pages        = {1--9},
  year         = {2017},
  crossref     = {DBLP:conf/infocom/2017},
  url          = {https://doi.org/10.1109/INFOCOM.2017.8057041},
  doi          = {10.1109/INFOCOM.2017.8057041},
  timestamp    = {Tue, 23 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/infocom/ZhangWBKS17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/GonzalezDSR17,
  author       = {Mario Gonz{\'{a}}lez and
                  David Dominguez and
                  {\'{A}}ngel S{\'{a}}nchez and
                  Francisco B. Rodr{\'{\i}}guez},
  title        = {Capacity and Retrieval of a Modular Set of Diluted Attractor Networks
                  with Respect to the Global Number of Neurons},
  booktitle    = {Advances in Computational Intelligence - 14th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2017, Cadiz, Spain, June 14-16,
                  2017, Proceedings, Part {I}},
  pages        = {497--506},
  year         = {2017},
  crossref     = {DBLP:conf/iwann/2017-1},
  url          = {https://doi.org/10.1007/978-3-319-59153-7\_43},
  doi          = {10.1007/978-3-319-59153-7\_43},
  timestamp    = {Sat, 01 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/GonzalezDSR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwann/Rivas-SanchezGV17,
  author       = {Mario Rivas{-}S{\'{a}}nchez and
                  Maria De La Paz Guerrero{-}Lebrero and
                  Elisa Guerrero V{\'{a}}zquez and
                  Guillermo B{\'{a}}rcena{-}Gonzalez and
                  Jaime Martel and
                  Pedro L. Galindo},
  title        = {Using Deep Learning for Image Similarity in Product Matching},
  booktitle    = {Advances in Computational Intelligence - 14th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2017, Cadiz, Spain, June 14-16,
                  2017, Proceedings, Part {I}},
  pages        = {281--290},
  year         = {2017},
  crossref     = {DBLP:conf/iwann/2017-1},
  url          = {https://doi.org/10.1007/978-3-319-59153-7\_25},
  doi          = {10.1007/978-3-319-59153-7\_25},
  timestamp    = {Sun, 25 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/Rivas-SanchezGV17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/GonzalezSVCRZPS17,
  author       = {Sergio A. Gonz{\'{a}}lez and
                  Enrique Mario Spinelli and
                  Alejandro L. Veiga and
                  D. F. Coral and
                  M. B. Fernandez van Raap and
                  P. Mendoza Zelis and
                  G. A. Pasquevich and
                  F. H. Sanchez},
  title        = {Portable electromagnetic field applicator for magnetic hyperthermia
                  experiments},
  booktitle    = {8th {IEEE} Latin American Symposium on Circuits {\&} Systems,
                  {LASCAS} 2017, Bariloche, Argentina, February 20-23, 2017},
  pages        = {1--4},
  year         = {2017},
  crossref     = {DBLP:conf/lascas/2017},
  url          = {https://doi.org/10.1109/LASCAS.2017.7948091},
  doi          = {10.1109/LASCAS.2017.7948091},
  timestamp    = {Mon, 16 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/GonzalezSVCRZPS17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/somet/Sotelo-GarridoN17,
  author       = {Mario Sotelo{-}Garrido and
                  Mariko Nakano{-}Miyatake and
                  Gabriel Sanchez{-}Perez and
                  Manuel Cedillo{-}Hernandez and
                  H{\'{e}}ctor P{\'{e}}rez{-}Meana},
  title        = {Software Protection Against Illegal Copy Using Software Watermarking},
  booktitle    = {New Trends in Intelligent Software Methodologies, Tools and Techniques
                  - Proceedings of the 16th International Conference, SoMeT{\_}17, Kitakyushu
                  City, Japan, September 26-28, 2017},
  pages        = {503--511},
  year         = {2017},
  crossref     = {DBLP:conf/somet/2017},
  url          = {https://doi.org/10.3233/978-1-61499-800-6-503},
  doi          = {10.3233/978-1-61499-800-6-503},
  timestamp    = {Tue, 15 Nov 2022 15:22:38 +0100},
  biburl       = {https://dblp.org/rec/conf/somet/Sotelo-GarridoN17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ucami/Garcia-SanchezT17,
  author       = {Mario Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Miguel A. Teruel and
                  Elena Navarro and
                  Pascual Gonz{\'{a}}lez and
                  Antonio Fern{\'{a}}ndez{-}Caballero},
  title        = {A Distributed Tool to Perform Dynamic Therapies for Social Cognitive
                  Deficit Through Avatars},
  booktitle    = {Ubiquitous Computing and Ambient Intelligence - 11th International
                  Conference, UCAmI 2017, Philadelphia, PA, USA, November 7-10, 2017,
                  Proceedings},
  pages        = {731--741},
  year         = {2017},
  crossref     = {DBLP:conf/ucami/2017},
  url          = {https://doi.org/10.1007/978-3-319-67585-5\_71},
  doi          = {10.1007/978-3-319-67585-5\_71},
  timestamp    = {Mon, 07 Nov 2022 21:23:28 +0100},
  biburl       = {https://dblp.org/rec/conf/ucami/Garcia-SanchezT17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/HuacujaLCPR17,
  author       = {H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
                  Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
                  Norberto Castillo{-}Garc{\'{\i}}a and
                  Johnatan E. Pecero and
                  Rodolfo A. Pazos Rangel},
  title        = {Solving the Cut Width Optimization Problem with a Genetic Algorithm
                  Approach},
  booktitle    = {Nature-Inspired Design of Hybrid Intelligent Systems},
  pages        = {729--738},
  year         = {2017},
  crossref     = {DBLP:series/sci/2017-667},
  url          = {https://doi.org/10.1007/978-3-319-47054-2\_48},
  doi          = {10.1007/978-3-319-47054-2\_48},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/series/sci/HuacujaLCPR17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Arias-FisteusFM17,
  author       = {Jes{\'{u}}s Arias{-}Fisteus and
                  Luis S{\'{a}}nchez Fern{\'{a}}ndez and
                  V{\'{\i}}ctor Corcoba Maga{\~{n}}a and
                  Mario Mu{\~{n}}oz Organero and
                  Jorge Yago Fern{\'{a}}ndez Rodr{\'{\i}}guez and
                  Juan Antonio {\'{A}}lvarez{-}Garc{\'{\i}}a},
  title        = {A Scalable Data Streaming Infrastructure for Smart Cities},
  journal      = {CoRR},
  volume       = {abs/1703.02755},
  year         = {2017},
  url          = {http://arxiv.org/abs/1703.02755},
  eprinttype    = {arXiv},
  eprint       = {1703.02755},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/Arias-FisteusFM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amcs/LocesMPHBB16,
  author       = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
                  Jedrzej Musial and
                  Johnatan E. Pecero and
                  H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
                  Jacek Blazewicz and
                  Pascal Bouvry},
  title        = {Exact and heuristic approaches to solve the Internet shopping optimization
                  problem with delivery costs},
  journal      = {Int. J. Appl. Math. Comput. Sci.},
  volume       = {26},
  number       = {2},
  pages        = {391--406},
  year         = {2016},
  url          = {https://doi.org/10.1515/amcs-2016-0028},
  doi          = {10.1515/AMCS-2016-0028},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/amcs/LocesMPHBB16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/crossroads/Sanchez16,
  author       = {Daniel L{\'{o}}pez S{\'{a}}nchez},
  title        = {"ANN" helps Mario rescue Princess Toadstool},
  journal      = {{XRDS}},
  volume       = {23},
  number       = {1},
  pages        = {18--19},
  year         = {2016},
  url          = {https://doi.org/10.1145/2983465},
  doi          = {10.1145/2983465},
  timestamp    = {Fri, 03 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/crossroads/Sanchez16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/Sanchez-Escobedo16,
  author       = {Dalila S{\'{a}}nchez{-}Escobedo and
                  Mario Castel{\'{a}}n and
                  William A. P. Smith},
  title        = {Statistical 3D face shape estimation from occluding contours},
  journal      = {Comput. Vis. Image Underst.},
  volume       = {142},
  pages        = {111--124},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.cviu.2015.08.012},
  doi          = {10.1016/J.CVIU.2015.08.012},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cviu/Sanchez-Escobedo16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fi/ParraSRFP16,
  author       = {Antonio Santos{-}Olmo and
                  Luis Enrique S{\'{a}}nchez and
                  David Garcia Rosado and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Applying the Action-Research Method to Develop a Methodology to Reduce
                  the Installation and Maintenance Times of Information Security Management
                  Systems},
  journal      = {Future Internet},
  volume       = {8},
  number       = {3},
  pages        = {36},
  year         = {2016},
  url          = {https://doi.org/10.3390/fi8030036},
  doi          = {10.3390/FI8030036},
  timestamp    = {Mon, 29 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fi/ParraSRFP16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhis/LorancaRVALZGD16,
  author       = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
                  Jorge A. Ruiz{-}Vanoye and
                  Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
                  Mart{\'{\i}}n Estrada Analco and
                  Abraham S{\'{a}}nchez L{\'{o}}pez and
                  Alberto Ochoa{-}Zezzatti and
                  Gerardo {Mart{\'{\i}}nez Guzman} and
                  Mario Bustillo D{\'{\i}}az},
  title        = {An approximation method for the P-median problem: {A} bioinspired
                  tabu search and variable neighborhood search partitioning approach},
  journal      = {Int. J. Hybrid Intell. Syst.},
  volume       = {13},
  number       = {2},
  pages        = {87--98},
  year         = {2016},
  url          = {https://doi.org/10.3233/HIS-160227},
  doi          = {10.3233/HIS-160227},
  timestamp    = {Fri, 03 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijhis/LorancaRVALZGD16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/infsof/Barcelo-Valenzuela16,
  author       = {Mario Barcelo{-}Valenzuela and
                  Patricia Shihemy Carrillo{-}Villafa{\~{n}}a and
                  Alonso Perez{-}Soltero and
                  Gerardo Sanchez{-}Schmitz},
  title        = {A framework to acquire explicit knowledge stored on different versions
                  of software},
  journal      = {Inf. Softw. Technol.},
  volume       = {70},
  pages        = {40--48},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.infsof.2015.09.007},
  doi          = {10.1016/J.INFSOF.2015.09.007},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/infsof/Barcelo-Valenzuela16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/RodriguezOMM16,
  author       = {Mario Rodr{\'{\i}}guez and
                  Carlos Orrite and
                  Carlos Medrano and
                  Dimitrios Makris},
  title        = {A Time Flexible Kernel framework for video-based activity recognition},
  journal      = {Image Vis. Comput.},
  volume       = {48-49},
  pages        = {26--36},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.imavis.2015.12.006},
  doi          = {10.1016/J.IMAVIS.2015.12.006},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ivc/RodriguezOMM16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvis/VictoriaRRPO16,
  author       = {{\'{A}}yax Hernando Torres Victoria and
                  Mario S{\'{a}}nchez Rosas and
                  Fernando Arag{\'{o}}n Rivera and
                  Salom{\'{o}}n Peralta and
                  Abraham Medina Ovando},
  title        = {Visualization of isotherms around a heated horizontal cylinder embedded
                  in a porous medium},
  journal      = {J. Vis.},
  volume       = {19},
  number       = {4},
  pages        = {631--641},
  year         = {2016},
  url          = {https://doi.org/10.1007/s12650-016-0363-9},
  doi          = {10.1007/S12650-016-0363-9},
  timestamp    = {Thu, 09 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jvis/VictoriaRRPO16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/midm/Lozano-LozanoMG16,
  author       = {Mario Lozano{-}Lozano and
                  Lydia Mart{\'{\i}}n{-}Mart{\'{\i}}n and
                  Noelia Galiano{-}Castillo and
                  Francisco {\'{A}}lvarez{-}Salvago and
                  Irene Cantarero{-}Villanueva and
                  Carolina Fern{\'{a}}ndez{-}Lao and
                  Carmen S{\'{a}}nchez{-}Salado and
                  Manuel Arroyo Morales},
  title        = {Integral strategy to supportive care in breast cancer survivors through
                  occupational therapy and a m-health system: design of a randomized
                  clinical trial},
  journal      = {{BMC} Medical Informatics Decis. Mak.},
  volume       = {16},
  pages        = {150:1--150:10},
  year         = {2016},
  url          = {https://doi.org/10.1186/s12911-016-0394-0},
  doi          = {10.1186/S12911-016-0394-0},
  timestamp    = {Sun, 06 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/midm/Lozano-LozanoMG16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS16,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Miguel J. Hornos and
                  Patricia Paderewski{-}Rodr{\'{\i}}guez},
  title        = {Semantic Formalism for Modelling the Group Interaction},
  journal      = {Res. Comput. Sci.},
  volume       = {118},
  pages        = {137--147},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_118/Semantic\%20Formalism\%20for\%20Modelling\%20the\%20Group\%20Interaction.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS16a,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Miguel J. Hornos and
                  Patricia Paderewski{-}Rodr{\'{\i}}guez},
  title        = {Knowledge-based Workflow Ontology for Group Organizational Structure},
  journal      = {Res. Comput. Sci.},
  volume       = {123},
  pages        = {79--90},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_123/Knowledge-based\%20Workflow\%20Ontology\%20for\%20Group\%20Organizational\%20Structure.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS16a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/DominguezHPHC16,
  author       = {Mario Hernandez Dominguez and
                  Jos{\'{e}}{-}Isidro Hern{\'{a}}ndez{-}Vega and
                  Dolores{-}Gabriela Palomares{-}Gorham and
                  Carlos Hern{\'{a}}ndez{-}Santos and
                  Jonam L. S{\'{a}}nchez Cuevas},
  title        = {A {BDI} Agent System for the Collaboration of the Unmanned Aerial
                  Vehicle},
  journal      = {Res. Comput. Sci.},
  volume       = {121},
  pages        = {113--124},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_121/A\%20BDI\%20Agent\%20System\%20for\%20the\%20Collaboration\%20of\%20the\%20Unmanned\%20Aerial\%20Vehicle.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/DominguezHPHC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/LopezCPML16,
  author       = {Abraham S{\'{a}}nchez L{\'{o}}pez and
                  Viridiana Cruz{-}Guti{\'{e}}rrez and
                  Mario Alberto Posada{-}Zamora and
                  M. Teresa Torrijos M. and
                  Mar{\'{\i}}a Auxilio Osorio Lama},
  title        = {Estudio del an{\'{a}}lisis de componentes principales en bases
                  de datos de calidad del aire},
  journal      = {Res. Comput. Sci.},
  volume       = {120},
  pages        = {9--19},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_120/Estudio\%20del\%20analisis\%20de\%20componentes\%20principales\%20en\%20bases\%20de\%20datos\%20de\%20calidad\%20del\%20aire.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/LopezCPML16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/LorancaVDASSL16,
  author       = {Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
                  Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez and
                  Mario Bustillo D{\'{\i}}az and
                  Mart{\'{\i}}n Estrada Analco and
                  Jorge Cerezo S{\'{a}}nchez and
                  Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
                  Abraham S{\'{a}}nchez L{\'{o}}pez},
  title        = {Methodology for Location-Allocation Problem},
  journal      = {Res. Comput. Sci.},
  volume       = {123},
  pages        = {91--98},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_123/Methodology\%20for\%20Location-Allocation\%20Problem.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/LorancaVDASSL16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Saldana-Gonzalez16,
  author       = {Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
                  Jorge Cerezo S{\'{a}}nchez and
                  Mario Bustillo D{\'{\i}}az and
                  Apolonio Ata P{\'{e}}rez and
                  Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
                  Gerardo {Mart{\'{\i}}nez Guzman} and
                  Rogelio Gonz{\'{a}}lez Vel{\'{a}}zquez},
  title        = {Dise{\~{n}}o de un robot m{\'{o}}vil controlado por un agente
                  reactivo en tiempo real},
  journal      = {Res. Comput. Sci.},
  volume       = {125},
  pages        = {17--26},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_125/Diseno\%20de\%20un\%20robot\%20movil\%20controlado\%20por\%20un\%20agente\%20reactivo\%20en\%20tiempo\%20real.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/Saldana-Gonzalez16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/SanchezSDA16,
  author       = {Jorge Cerezo S{\'{a}}nchez and
                  Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
                  Mario Bustillo D{\'{\i}}az and
                  Apolonio Ata{-}P{\'{e}}rez},
  title        = {Sistema de planificaci{\'{o}}n de trayectorias utilizando visi{\'{o}}n
                  artificial},
  journal      = {Res. Comput. Sci.},
  volume       = {128},
  pages        = {141--148},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_128/Sistema\%20de\%20planificacion\%20de\%20trayectorias\%20utilizando\%20vision\%20artificial.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/SanchezSDA16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/SanchezSDPFLG16,
  author       = {Jorge Cerezo S{\'{a}}nchez and
                  Griselda Salda{\~{n}}a{-}Gonz{\'{a}}lez and
                  Mario Mauricio Bustillo D{\'{\i}}az and
                  Apolonio Ata P{\'{e}}rez and
                  Jos{\'{e}} Andr{\'{e}}s V{\'{a}}zquez Flores and
                  Mar{\'{\i}}a Beatr{\'{\i}}z {Bern{\'{a}}be Loranca} and
                  Gerardo {Mart{\'{\i}}nez Guzman}},
  title        = {Sistema de reconocimiento y clasificaci{\'{o}}n de se{\~{n}}as
                  para el lenguaje espa{\~{n}}ol},
  journal      = {Res. Comput. Sci.},
  volume       = {124},
  pages        = {73--80},
  year         = {2016},
  url          = {https://rcs.cic.ipn.mx/2016\_124/Sistema\%20de\%20reconocimiento\%20y\%20clasificacion\%20de\%20senas\%20para\%20el\%20lenguaje\%20espanol.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/SanchezSDPFLG16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/staeors/RiveiroDCSA16,
  author       = {Bel{\'{e}}n Riveiro and
                  Luc{\'{\i}}a D{\'{\i}}az{-}Vilari{\~{n}}o and
                  Borja Conde{-}Carnero and
                  Mario Soil{\'{a}}n and
                  Pedro Arias},
  title        = {Automatic Segmentation and Shape-Based Classification of Retro-Reflective
                  Traffic Signs from Mobile LiDAR Data},
  journal      = {{IEEE} J. Sel. Top. Appl. Earth Obs. Remote. Sens.},
  volume       = {9},
  number       = {1},
  pages        = {295--303},
  year         = {2016},
  url          = {https://doi.org/10.1109/JSTARS.2015.2461680},
  doi          = {10.1109/JSTARS.2015.2461680},
  timestamp    = {Tue, 31 Mar 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/staeors/RiveiroDCSA16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tetc/BarrioOS16,
  author       = {Cesar Morillas Barrio and
                  Mario Mu{\~{n}}oz Organero and
                  Joaqu{\'{\i}}n S{\'{a}}nchez{-}Soriano},
  title        = {Can Gamification Improve the Benefits of Student Response Systems
                  in Learning? An Experimental Study},
  journal      = {{IEEE} Trans. Emerg. Top. Comput.},
  volume       = {4},
  number       = {3},
  pages        = {429--438},
  year         = {2016},
  url          = {https://doi.org/10.1109/TETC.2015.2497459},
  doi          = {10.1109/TETC.2015.2497459},
  timestamp    = {Fri, 15 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tetc/BarrioOS16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/alife/Garcia-ValdezGC16,
  author       = {Mario Garc{\'{\i}}a{-}Valdez and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Paloma de las Cuevas and
                  Juan Juli{\'{a}}n Merelo},
  title        = {The human in the loop: volunteer-based metacomputers as a socio-technical
                  system},
  booktitle    = {Fifteenth International Conference on the Simulation and Synthesis
                  of Living Systems, {ALIFE} 2016, Cancun, Mexico, July 4-6, 2016},
  pages        = {648--655},
  year         = {2016},
  crossref     = {DBLP:conf/alife/2016},
  url          = {https://doi.org/10.7551/978-0-262-33936-0-ch103},
  doi          = {10.7551/978-0-262-33936-0-CH103},
  timestamp    = {Thu, 20 Jun 2024 22:18:45 +0200},
  biburl       = {https://dblp.org/rec/conf/alife/Garcia-ValdezGC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/FlorezSV16,
  author       = {Hector Florez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Analysis of Imprecise Enterprise Models},
  booktitle    = {Enterprise, Business-Process and Information Systems Modeling - 17th
                  International Conference, {BPMDS} 2016, 21st International Conference,
                  {EMMSAD} 2016, Held at CAiSE 2016, Ljubljana, Slovenia, June 13-14,
                  2016, Proceedings},
  pages        = {349--364},
  year         = {2016},
  crossref     = {DBLP:conf/caise/2016bpmds},
  url          = {https://doi.org/10.1007/978-3-319-39429-9\_22},
  doi          = {10.1007/978-3-319-39429-9\_22},
  timestamp    = {Fri, 19 Mar 2021 08:43:31 +0100},
  biburl       = {https://dblp.org/rec/conf/caise/FlorezSV16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/FelsbergKMLPHBE16,
  author       = {Michael Felsberg and
                  Matej Kristan and
                  Jiri Matas and
                  Ales Leonardis and
                  Roman P. Pflugfelder and
                  Gustav H{\"{a}}ger and
                  Amanda Berg and
                  Abdelrahman Eldesokey and
                  J{\"{o}}rgen Ahlberg and
                  Luka Cehovin and
                  Tom{\'{a}}s Voj{\'{\i}}r and
                  Alan Lukezic and
                  Gustavo Fern{\'{a}}ndez and
                  Alfredo Petrosino and
                  {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
                  Andr{\'{e}}s Sol{\'{\i}}s Montero and
                  Anton Varfolomieiev and
                  Aykut Erdem and
                  Bohyung Han and
                  Chang{-}Ming Chang and
                  Dawei Du and
                  Erkut Erdem and
                  Fahad Shahbaz Khan and
                  Fatih Porikli and
                  Fei Zhao and
                  Filiz Bunyak and
                  Francesco Battistone and
                  Gao Zhu and
                  Guna Seetharaman and
                  Hongdong Li and
                  Honggang Qi and
                  Horst Bischof and
                  Horst Possegger and
                  Hyeonseob Nam and
                  Jack Valmadre and
                  Jianke Zhu and
                  Jiayi Feng and
                  Jochen Lang and
                  Jos{\'{e}} M. Mart{\'{\i}}nez and
                  Kannappan Palaniappan and
                  Karel Lebeda and
                  Ke Gao and
                  Krystian Mikolajczyk and
                  Longyin Wen and
                  Luca Bertinetto and
                  Mahdieh Poostchi and
                  Mario Edoardo Maresca and
                  Martin Danelljan and
                  Michael Arens and
                  Ming Tang and
                  Mooyeol Baek and
                  Nana Fan and
                  Noor Al{-}Shakarji and
                  Ondrej Miksik and
                  Osman Akin and
                  Philip H. S. Torr and
                  Qingming Huang and
                  Rafael Martin Nieto and
                  Rengarajan Pelapur and
                  Richard Bowden and
                  Robert Lagani{\`{e}}re and
                  Sebastian Bernd Krah and
                  Shengkun Li and
                  Shizeng Yao and
                  Simon Hadfield and
                  Siwei Lyu and
                  Stefan Becker and
                  Stuart Golodetz and
                  Tao Hu and
                  Thomas Mauthner and
                  Vincenzo Santopietro and
                  Wenbo Li and
                  Wolfgang H{\"{u}}bner and
                  Xin Li and
                  Yang Li and
                  Zhan Xu and
                  Zhenyu He},
  title        = {The Thermal Infrared Visual Object Tracking {VOT-TIR2016} Challenge
                  Results},
  booktitle    = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
                  October 8-10 and 15-16, 2016, Proceedings, Part {II}},
  pages        = {824--849},
  year         = {2016},
  crossref     = {DBLP:conf/eccv/2016w2},
  url          = {https://doi.org/10.1007/978-3-319-48881-3\_55},
  doi          = {10.1007/978-3-319-48881-3\_55},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/FelsbergKMLPHBE16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/KristanLMFPCVHL16,
  author       = {Matej Kristan and
                  Ales Leonardis and
                  Jiri Matas and
                  Michael Felsberg and
                  Roman P. Pflugfelder and
                  Luka Cehovin and
                  Tom{\'{a}}s Voj{\'{\i}}r and
                  Gustav H{\"{a}}ger and
                  Alan Lukezic and
                  Gustavo Fern{\'{a}}ndez and
                  Abhinav Gupta and
                  Alfredo Petrosino and
                  Alireza Memarmoghadam and
                  {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
                  Andr{\'{e}}s Sol{\'{\i}}s Montero and
                  Andrea Vedaldi and
                  Andreas Robinson and
                  Andy Jinhua Ma and
                  Anton Varfolomieiev and
                  A. Aydin Alatan and
                  Aykut Erdem and
                  Bernard Ghanem and
                  Bin Liu and
                  Bohyung Han and
                  Brais Mart{\'{\i}}nez and
                  Chang{-}Ming Chang and
                  Changsheng Xu and
                  Chong Sun and
                  Daijin Kim and
                  Dapeng Chen and
                  Dawei Du and
                  Deepak Mishra and
                  Dit{-}Yan Yeung and
                  Erhan Gundogdu and
                  Erkut Erdem and
                  Fahad Shahbaz Khan and
                  Fatih Porikli and
                  Fei Zhao and
                  Filiz Bunyak and
                  Francesco Battistone and
                  Gao Zhu and
                  Giorgio Roffo and
                  Gorthi R. K. Sai Subrahmanyam and
                  Guilherme Sousa Bastos and
                  Guna Seetharaman and
                  Henry Medeiros and
                  Hongdong Li and
                  Honggang Qi and
                  Horst Bischof and
                  Horst Possegger and
                  Huchuan Lu and
                  Hyemin Lee and
                  Hyeonseob Nam and
                  Hyung Jin Chang and
                  Isabela Drummond and
                  Jack Valmadre and
                  Jae{-}chan Jeong and
                  Jaeil Cho and
                  Jae{-}Yeong Lee and
                  Jianke Zhu and
                  Jiayi Feng and
                  Jin Gao and
                  Jin Young Choi and
                  Jingjing Xiao and
                  Ji{-}Wan Kim and
                  Jiyeoup Jeong and
                  Jo{\~{a}}o F. Henriques and
                  Jochen Lang and
                  Jongwon Choi and
                  Jos{\'{e}} M. Mart{\'{\i}}nez and
                  Junliang Xing and
                  Junyu Gao and
                  Kannappan Palaniappan and
                  Karel Lebeda and
                  Ke Gao and
                  Krystian Mikolajczyk and
                  Lei Qin and
                  Lijun Wang and
                  Longyin Wen and
                  Luca Bertinetto and
                  Madan Kumar Rapuru and
                  Mahdieh Poostchi and
                  Mario Edoardo Maresca and
                  Martin Danelljan and
                  Matthias Mueller and
                  Mengdan Zhang and
                  Michael Arens and
                  Michel F. Valstar and
                  Ming Tang and
                  Mooyeol Baek and
                  Muhammad Haris Khan and
                  Naiyan Wang and
                  Nana Fan and
                  Noor Al{-}Shakarji and
                  Ondrej Miksik and
                  Osman Akin and
                  Payman Moallem and
                  Pedro Senna and
                  Philip H. S. Torr and
                  Pong C. Yuen and
                  Qingming Huang and
                  Rafael Martin Nieto and
                  Rengarajan Pelapur and
                  Richard Bowden and
                  Robert Lagani{\`{e}}re and
                  Rustam Stolkin and
                  Ryan Walsh and
                  Sebastian Bernd Krah and
                  Shengkun Li and
                  Shengping Zhang and
                  Shizeng Yao and
                  Simon Hadfield and
                  Simone Melzi and
                  Siwei Lyu and
                  Siyi Li and
                  Stefan Becker and
                  Stuart Golodetz and
                  Sumithra Kakanuru and
                  Sunglok Choi and
                  Tao Hu and
                  Thomas Mauthner and
                  Tianzhu Zhang and
                  Tony P. Pridmore and
                  Vincenzo Santopietro and
                  Weiming Hu and
                  Wenbo Li and
                  Wolfgang H{\"{u}}bner and
                  Xiangyuan Lan and
                  Xiaomeng Wang and
                  Xin Li and
                  Yang Li and
                  Yiannis Demiris and
                  Yifan Wang and
                  Yuankai Qi and
                  Zejian Yuan and
                  Zexiong Cai and
                  Zhan Xu and
                  Zhenyu He and
                  Zhizhen Chi},
  title        = {The Visual Object Tracking {VOT2016} Challenge Results},
  booktitle    = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
                  October 8-10 and 15-16, 2016, Proceedings, Part {II}},
  pages        = {777--823},
  year         = {2016},
  crossref     = {DBLP:conf/eccv/2016w2},
  url          = {https://doi.org/10.1007/978-3-319-48881-3\_54},
  doi          = {10.1007/978-3-319-48881-3\_54},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/KristanLMFPCVHL16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/LaraSV16,
  author       = {Paola Lara and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Bridging the {IT} and {OT} Worlds Using an Extensible Modeling Language},
  booktitle    = {Conceptual Modeling - 35th International Conference, {ER} 2016, Gifu,
                  Japan, November 14-17, 2016, Proceedings},
  pages        = {122--129},
  year         = {2016},
  crossref     = {DBLP:conf/er/2016},
  url          = {https://doi.org/10.1007/978-3-319-46397-1\_10},
  doi          = {10.1007/978-3-319-46397-1\_10},
  timestamp    = {Thu, 23 Jun 2022 19:56:58 +0200},
  biburl       = {https://dblp.org/rec/conf/er/LaraSV16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/evoW/MereloCBRGFRV16,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Pedro A. Castillo and
                  Israel Blancas and
                  Gustavo Romero and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Antonio Fern{\'{a}}ndez{-}Ares and
                  V{\'{\i}}ctor M. Rivas and
                  Mario Garc{\'{\i}}a Valdez},
  title        = {Benchmarking Languages for Evolutionary Algorithms},
  booktitle    = {Applications of Evolutionary Computation - 19th European Conference,
                  EvoApplications 2016, Porto, Portugal, March 30 - April 1, 2016, Proceedings,
                  Part {II}},
  pages        = {27--41},
  year         = {2016},
  crossref     = {DBLP:conf/evoW/2016a-2},
  url          = {https://doi.org/10.1007/978-3-319-31153-1\_3},
  doi          = {10.1007/978-3-319-31153-1\_3},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/evoW/MereloCBRGFRV16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/MereloCGCRV16,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Pedro A. Castillo and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Paloma de las Cuevas and
                  Nuria Rico and
                  Mario Garc{\'{\i}}a Valdez},
  title        = {Performance for the Masses: Experiments with {A} Web Based Architecture
                  to Harness Volunteer Resources for Low Cost Distributed Evolutionary
                  Computation},
  booktitle    = {Proceedings of the 2016 on Genetic and Evolutionary Computation Conference,
                  Denver, CO, USA, July 20 - 24, 2016},
  pages        = {837--844},
  year         = {2016},
  crossref     = {DBLP:conf/gecco/2016},
  url          = {https://doi.org/10.1145/2908812.2908849},
  doi          = {10.1145/2908812.2908849},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/gecco/MereloCGCRV16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gecco/MereloCGCV16,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Pedro A. Castillo and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Paloma de las Cuevas and
                  Mario Garc{\'{\i}}a Valdez},
  title        = {NodIO: {A} Framework and Architecture for Pool-based Evolutionary
                  Computation},
  booktitle    = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver,
                  CO, USA, July 20-24, 2016, Companion Material Proceedings},
  pages        = {1323--1330},
  year         = {2016},
  crossref     = {DBLP:conf/gecco/2016c},
  url          = {https://doi.org/10.1145/2908961.2931723},
  doi          = {10.1145/2908961.2931723},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/gecco/MereloCGCV16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icecsys/SanchezSPZAM16,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Marcelo Schiavon Porto and
                  Bruno Zatt and
                  Luciano Volcan Agostini and
                  C{\'{e}}sar A. M. Marcon},
  title        = {Real-time simplified edge detector architecture for 3D-HEVC depth
                  maps coding},
  booktitle    = {2016 {IEEE} International Conference on Electronics, Circuits and
                  Systems, {ICECS} 2016, Monte Carlo, Monaco, December 11-14, 2016},
  pages        = {352--355},
  year         = {2016},
  crossref     = {DBLP:conf/icecsys/2016},
  url          = {https://doi.org/10.1109/ICECS.2016.7841205},
  doi          = {10.1109/ICECS.2016.7841205},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icecsys/SanchezSPZAM16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez16,
  author       = {S. Dominguez{-}Sanchez and
                  Salvador Mendoza{-}Acevedo and
                  Mario Alfredo Reyes{-}Barranca and
                  Luis M. Flores{-}Nava and
                  Jose A. Moreno{-}Cadenas},
  title        = {Assessment of the possibility to couple a photo sensor to a Floating-gate
                  {MOS} transistor},
  booktitle    = {13th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2016, Mexico City, Mexico, September
                  26-30, 2016},
  pages        = {1--5},
  year         = {2016},
  crossref     = {DBLP:conf/iceee/2016},
  url          = {https://doi.org/10.1109/ICEEE.2016.7751201},
  doi          = {10.1109/ICEEE.2016.7751201},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/Dominguez-Sanchez16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/RomeroSV16,
  author       = {Mar{\'{\i}}a Camila Romero and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Weaving Business Model Patterns - Understanding Business Models},
  booktitle    = {{ICEIS} 2016 - Proceedings of the 18th International Conference on
                  Enterprise Information Systems, Volume 2, Rome, Italy, April 25-28,
                  2016},
  pages        = {496--505},
  year         = {2016},
  crossref     = {DBLP:conf/iceis/2016-2},
  url          = {https://doi.org/10.5220/0005838104960505},
  doi          = {10.5220/0005838104960505},
  timestamp    = {Thu, 15 Jun 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/RomeroSV16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/RomeroSV16a,
  author       = {Mar{\'{\i}}a Camila Romero and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Business Model Loom: {A} Pattern-Based Approach Towards the Definition
                  of Business Models},
  booktitle    = {Enterprise Information Systems - 18th International Conference, {ICEIS}
                  2016, Rome, Italy, April 25-28, 2016, Revised Selected Papers},
  pages        = {463--487},
  year         = {2016},
  crossref     = {DBLP:conf/iceis/2016sp},
  url          = {https://doi.org/10.1007/978-3-319-62386-3\_21},
  doi          = {10.1007/978-3-319-62386-3\_21},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/RomeroSV16a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/OrriteRM16,
  author       = {Carlos Orrite and
                  Mario Rodr{\'{\i}}guez and
                  Carlos Medrano},
  title        = {One-shot learning of temporal sequences using a distance dependent
                  Chinese Restaurant Process},
  booktitle    = {23rd International Conference on Pattern Recognition, {ICPR} 2016,
                  Canc{\'{u}}n, Mexico, December 4-8, 2016},
  pages        = {2694--2699},
  year         = {2016},
  crossref     = {DBLP:conf/icpr/2016},
  url          = {https://doi.org/10.1109/ICPR.2016.7900042},
  doi          = {10.1109/ICPR.2016.7900042},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/OrriteRM16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/MorianoBMRR16,
  author       = {Javier Moriano and
                  Emilio Bueno and
                  Rocio Martin and
                  Francisco Javier Rodr{\'{\i}}guez and
                  Mario Rizo},
  title        = {Multi-frequency stationary frame grid synchronization using multiple
                  reduced order generalized integrators},
  booktitle    = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
                  Society, Florence, Italy, October 23-26, 2016},
  pages        = {2349--2354},
  year         = {2016},
  crossref     = {DBLP:conf/iecon/2016},
  url          = {https://doi.org/10.1109/IECON.2016.7793332},
  doi          = {10.1109/IECON.2016.7793332},
  timestamp    = {Wed, 16 Oct 2019 14:14:49 +0200},
  biburl       = {https://dblp.org/rec/conf/iecon/MorianoBMRR16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcci/GuervosBCRGSVHR16,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Israel Blancas{-}Alvarez and
                  Pedro A. Castillo and
                  Gustavo Romero and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  V{\'{\i}}ctor Manuel Rivas Santos and
                  Mario Garc{\'{\i}}a Valdez and
                  Amaury Hern{\'{a}}ndez{-}{\'{A}}guila and
                  Mario Rom{\'{a}}n},
  title        = {Ranking the Performance of Compiled and Interpreted Languages in Genetic
                  Algorithms},
  booktitle    = {Proceedings of the 8th International Joint Conference on Computational
                  Intelligence, {IJCCI} 2016, Volume 1: ECTA, Porto, Portugal, November
                  9-11, 2016},
  pages        = {164--170},
  year         = {2016},
  crossref     = {DBLP:conf/ijcci/2016ecta},
  url          = {https://doi.org/10.5220/0006048101640170},
  doi          = {10.5220/0006048101640170},
  timestamp    = {Sun, 25 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcci/GuervosBCRGSVHR16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/SaldanhaZPAS16,
  author       = {M{\'{a}}rio Saldanha and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini and
                  Gustavo Sanchez},
  title        = {Solutions for {DMM-1} complexity reduction in 3D-HEVC based on gradient
                  calculation},
  booktitle    = {{IEEE} 7th Latin American Symposium on Circuits {\&} Systems,
                  {LASCAS} 2016, Florianopolis, Brazil, February 28 - March 2, 2016},
  pages        = {211--214},
  year         = {2016},
  crossref     = {DBLP:conf/lascas/2016},
  url          = {https://doi.org/10.1109/LASCAS.2016.7451047},
  doi          = {10.1109/LASCAS.2016.7451047},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/SaldanhaZPAS16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/SanchezRPH16,
  author       = {Raul M. Sanchez and
                  Benjam{\'{\i}}n T. Reyes and
                  Ariel L. Pola and
                  Mario Rafael Hueda},
  title        = {An FPGA-based emulation platform for evaluation of time-interleaved
                  {ADC} calibration systems},
  booktitle    = {{IEEE} 7th Latin American Symposium on Circuits {\&} Systems,
                  {LASCAS} 2016, Florianopolis, Brazil, February 28 - March 2, 2016},
  pages        = {187--190},
  year         = {2016},
  crossref     = {DBLP:conf/lascas/2016},
  url          = {https://doi.org/10.1109/LASCAS.2016.7451041},
  doi          = {10.1109/LASCAS.2016.7451041},
  timestamp    = {Mon, 20 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/lascas/SanchezRPH16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/Cruz-GutierrezP16,
  author       = {Viridiana Cruz{-}Guti{\'{e}}rrez and
                  Mario Alberto Posada{-}Zamora and
                  Abraham S{\'{a}}nchez L{\'{o}}pez},
  title        = {An Efficient Expert System for Diabetes with a Bayesian Inference
                  Engine},
  booktitle    = {Advances in Soft Computing - 15th Mexican International Conference
                  on Artificial Intelligence, {MICAI} 2016, Canc{\'{u}}n, Mexico,
                  October 23-28, 2016, Proceedings, Part {II}},
  pages        = {54--64},
  year         = {2016},
  crossref     = {DBLP:conf/micai/2016-2},
  url          = {https://doi.org/10.1007/978-3-319-62428-0\_5},
  doi          = {10.1007/978-3-319-62428-0\_5},
  timestamp    = {Tue, 14 May 2019 10:00:49 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/Cruz-GutierrezP16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/GuervosVCGCR16,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Mario Garc{\'{\i}}a Valdez and
                  Pedro {\'{A}}ngel Castillo Valdivieso and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Paloma de las Cuevas and
                  Nuria Rico},
  title        = {NodIO, a JavaScript framework for volunteer-based evolutionary algorithms
                  : first results},
  journal      = {CoRR},
  volume       = {abs/1601.01607},
  year         = {2016},
  url          = {http://arxiv.org/abs/1601.01607},
  eprinttype    = {arXiv},
  eprint       = {1601.01607},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/GuervosVCGCR16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/Poncela-Casasnovas16,
  author       = {Julia Poncela{-}Casasnovas and
                  Mario Guti{\'{e}}rrez{-}Roig and
                  Carlos Gracia{-}L{\'{a}}zaro and
                  Juli{\'{a}}n Vicens and
                  Jes{\'{u}}s G{\'{o}}mez{-}Garde{\~{n}}es and
                  Josep Perello and
                  Yamir Moreno and
                  Jordi Duch and
                  {\'{A}}ngel S{\'{a}}nchez},
  title        = {Humans display a reduced set of consistent behavioral phenotypes in
                  dyadic games},
  journal      = {CoRR},
  volume       = {abs/1608.02015},
  year         = {2016},
  url          = {http://arxiv.org/abs/1608.02015},
  eprinttype    = {arXiv},
  eprint       = {1608.02015},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/Poncela-Casasnovas16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/TellezMGMSS16,
  author       = {Eric Sadit Tellez and
                  Sabino Miranda{-}Jim{\'{e}}nez and
                  Mario Graff and
                  Daniela Moctezuma and
                  Ranyart Rodrigo Su{\'{a}}rez and
                  Oscar S{\'{a}}nchez Siordia},
  title        = {A Simple Approach to Multilingual Polarity Classification in Twitter},
  journal      = {CoRR},
  volume       = {abs/1612.05270},
  year         = {2016},
  url          = {http://arxiv.org/abs/1612.05270},
  eprinttype    = {arXiv},
  eprint       = {1612.05270},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/TellezMGMSS16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jam/Filobello-NinoV15,
  author       = {Uriel Filobello{-}Ni{\~{n}}o and
                  H{\'{e}}ctor V{\'{a}}zquez{-}Leal and
                  Karem Boubaker and
                  Arturo Sarmiento{-}Reyes and
                  Agustin Perez{-}Sesma and
                  Alejandro D{\'{\i}}az{-}S{\'{a}}nchez and
                  V{\'{\i}}ctor Manuel Jimenez{-}Fernandez and
                  Juan Cervantes{-}Perez and
                  Jesus Sanchez{-}Orea and
                  Jesus Huerta{-}Chua and
                  Luis J. Morales{-}Mendoza and
                  Mario Gonzalez{-}Lee and
                  Carlos Hern{\'{a}}ndez{-}Mej{\'{\i}}a and
                  Francisco Javier Gonzalez{-}Martinez},
  title        = {Nonlinearities Distribution Homotopy Perturbation Method Applied to
                  Solve Nonlinear Problems: Thomas-Fermi Equation as a Case Study},
  journal      = {J. Appl. Math.},
  volume       = {2015},
  pages        = {405108:1--405108:9},
  year         = {2015},
  url          = {https://doi.org/10.1155/2015/405108},
  doi          = {10.1155/2015/405108},
  timestamp    = {Sun, 25 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jam/Filobello-NinoV15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jei/SanchezSBZPA15,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Gabriel Balota and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini},
  title        = {DMMFast: a complexity reduction scheme for three-dimensional high-efficiency
                  video coding intraframe depth map coding},
  journal      = {J. Electronic Imaging},
  volume       = {24},
  number       = {2},
  pages        = {023011},
  year         = {2015},
  url          = {https://doi.org/10.1117/1.JEI.24.2.023011},
  doi          = {10.1117/1.JEI.24.2.023011},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jei/SanchezSBZPA15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jot/NaranjoSV15,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Evaluating the capabilities of Enterprise Architecture modeling tools
                  for Visual Analysis},
  journal      = {J. Object Technol.},
  volume       = {14},
  number       = {1},
  pages        = {3:1--32},
  year         = {2015},
  url          = {https://doi.org/10.5381/jot.2015.14.1.a3},
  doi          = {10.5381/JOT.2015.14.1.A3},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jot/NaranjoSV15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jpdc/Aartsen15,
  author       = {Mark G. Aartsen and
                  Rasha U. Abbasi and
                  Markus Ackermann and
                  Jenni Adams and
                  Juan Antonio Aguilar S{\'{a}}nchez and
                  Markus Ahlers and
                  David Altmann and
                  Carlos A. Arg{\"{u}}elles Delgado and
                  Jan Auffenberg and
                  Xinhua Bai and
                  Michael F. Baker and
                  Steven W. Barwick and
                  Volker Baum and
                  Ryan Bay and
                  James J. Beatty and
                  Julia K. Becker Tjus and
                  Karl{-}Heinz Becker and
                  Segev BenZvi and
                  Patrick Berghaus and
                  David Berley and
                  Elisa Bernardini and
                  Anna Bernhard and
                  David Z. Besson and
                  G. Binder and
                  Daniel Bindig and
                  Martin Bissok and
                  Erik Blaufuss and
                  Jan Blumenthal and
                  David J. Boersma and
                  Christian Bohm and
                  Debanjan Bose and
                  Sebastian B{\"{o}}ser and
                  Olga Botner and
                  Lionel Brayeur and
                  Hans{-}Peter Bretz and
                  Anthony M. Brown and
                  Ronald Bruijn and
                  James Casey and
                  Martin Casier and
                  Dmitry Chirkin and
                  Asen Christov and
                  Brian John Christy and
                  Ken Clark and
                  Lew Classen and
                  Fabian Clevermann and
                  Stefan Coenders and
                  Shirit Cohen and
                  Doug F. Cowen and
                  Angel H. Cruz Silva and
                  Matthias Danninger and
                  Jacob Daughhetee and
                  James C. Davis and
                  Melanie Day and
                  Catherine De Clercq and
                  Sam De Ridder and
                  Paolo Desiati and
                  Krijn D. de Vries and
                  Meike de With and
                  Tyce DeYoung and
                  Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
                  Matthew Dunkman and
                  Ryan Eagan and
                  Benjamin Eberhardt and
                  Bj{\"{o}}rn Eichmann and
                  Jonathan Eisch and
                  Sebastian Euler and
                  Paul A. Evenson and
                  Oladipo O. Fadiran and
                  Ali R. Fazely and
                  Anatoli Fedynitch and
                  Jacob Feintzeig and
                  Tom Feusels and
                  Kirill Filimonov and
                  Chad Finley and
                  Tobias Fischer{-}Wasels and
                  Samuel Flis and
                  Anna Franckowiak and
                  Katharina Frantzen and
                  Tomasz Fuchs and
                  Thomas K. Gaisser and
                  Joseph S. Gallagher and
                  Lisa Marie Gerhardt and
                  Laura E. Gladstone and
                  Thorsten Gl{\"{u}}senkamp and
                  Azriel Goldschmidt and
                  Geraldina Golup and
                  Javier G. Gonz{\'{a}}lez and
                  Jordan A. Goodman and
                  Dariusz G{\'{o}}ra and
                  Dylan T. Grandmont and
                  Darren Grant and
                  Pavel Gretskov and
                  John C. Groh and
                  Andreas Gro{\ss} and
                  Chang Hyon Ha and
                  Abd Al Karim Haj Ismail and
                  Patrick Hallen and
                  Allan Hallgren and
                  Francis Halzen and
                  Kael D. Hanson and
                  Dustin Hebecker and
                  David Heereman and
                  Dirk Heinen and
                  Klaus Helbing and
                  Robert Eugene Hellauer III and
                  Stephanie Virginia Hickford and
                  Gary C. Hill and
                  Kara D. Hoffman and
                  Ruth Hoffmann and
                  Andreas Homeier and
                  Kotoyo Hoshina and
                  Feifei Huang and
                  Warren Huelsnitz and
                  Per Olof Hulth and
                  Klas Hultqvist and
                  Shahid Hussain and
                  Aya Ishihara and
                  Emanuel Jacobi and
                  John E. Jacobsen and
                  Kai Jagielski and
                  George S. Japaridze and
                  Kyle Jero and
                  Ola Jlelati and
                  Basho Kaminsky and
                  Alexander Kappes and
                  Timo Karg and
                  Albrecht Karle and
                  Matthew Kauer and
                  John Lawrence Kelley and
                  Joanna Kiryluk and
                  J. Kl{\"{a}}s and
                  Spencer R. Klein and
                  Jan{-}Hendrik K{\"{o}}hne and
                  Georges Kohnen and
                  Hermann Kolanoski and
                  Lutz K{\"{o}}pke and
                  Claudio Kopper and
                  Sandro Kopper and
                  D. Jason Koskinen and
                  Marek Kowalski and
                  Mark Krasberg and
                  Anna Kriesten and
                  Kai Michael Krings and
                  G{\"{o}}sta Kroll and
                  Jan Kunnen and
                  Naoko Kurahashi and
                  Takao Kuwabara and
                  Mathieu L. M. Labare and
                  Hagar Landsman and
                  Michael James Larson and
                  Mariola Lesiak{-}Bzdak and
                  Martin Leuermann and
                  Julia Leute and
                  Jan L{\"{u}}nemann and
                  Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
                  James Madsen and
                  Giuliano Maggi and
                  Reina Maruyama and
                  Keiichi Mase and
                  Howard S. Matis and
                  Frank McNally and
                  Kevin James Meagher and
                  Martin Merck and
                  Gonzalo Merino Ar{\'{e}}valo and
                  Thomas Meures and
                  Sandra Miarecki and
                  Eike Middell and
                  Natalie Milke and
                  John Lester Miller and
                  Lars Mohrmann and
                  Teresa Montaruli and
                  Robert M. Morse and
                  Rolf Nahnhauer and
                  Uwe Naumann and
                  Hans Niederhausen and
                  Sarah C. Nowicki and
                  David R. Nygren and
                  Anna Obertacke and
                  Sirin Odrowski and
                  Alex Olivas and
                  Ahmad Omairat and
                  Aongus Starbuck {\'{O}} Murchadha and
                  Larissa Paul and
                  Joshua A. Pepper and
                  Carlos P{\'{e}}rez de los Heros and
                  Carl Pfendner and
                  Damian Pieloth and
                  Elisa Pinat and
                  Jonas Posselt and
                  P. Buford Price and
                  Gerald T. Przybylski and
                  Melissa Quinnan and
                  Leif R{\"{a}}del and
                  Ian Rae and
                  Mohamed Rameez and
                  Katherine Rawlins and
                  Peter Christian Redl and
                  Ren{\'{e}} Reimann and
                  Elisa Resconi and
                  Wolfgang Rhode and
                  Mathieu Ribordy and
                  Michael Richman and
                  Benedikt Riedel and
                  J. P. Rodrigues and
                  Carsten Rott and
                  Tim Ruhe and
                  Bakhtiyar Ruzybayev and
                  Dirk Ryckbosch and
                  Sabine M. Saba and
                  Heinz{-}Georg Sander and
                  Juan Marcos Santander and
                  Subir Sarkar and
                  Kai Schatto and
                  Florian Scheriau and
                  Torsten Schmidt and
                  Martin Schmitz and
                  Sebastian Schoenen and
                  Sebastian Sch{\"{o}}neberg and
                  Arne Sch{\"{o}}nwald and
                  Anne Schukraft and
                  Lukas Schulte and
                  David Schultz and
                  Olaf Schulz and
                  David Seckel and
                  Yolanda Sestayo de la Cerra and
                  Surujhdeo Seunarine and
                  Rezo Shanidze and
                  Chris Sheremata and
                  Miles W. E. Smith and
                  Dennis Soldin and
                  Glenn M. Spiczak and
                  Christian Spiering and
                  Michael Stamatikos and
                  Todor Stanev and
                  Nick A. Stanisha and
                  Alexander Stasik and
                  Thorsten Stezelberger and
                  Robert G. Stokstad and
                  Achim St{\"{o}}{\ss}l and
                  Erik A. Strahler and
                  Rickard Str{\"{o}}m and
                  Nora Linn Strotjohann and
                  Gregory W. Sullivan and
                  Henric Taavola and
                  Ignacio J. Taboada and
                  Alessio Tamburro and
                  Andreas Tepe and
                  Samvel Ter{-}Antonyan and
                  Gordana Tesic and
                  Serap Tilav and
                  Patrick A. Toale and
                  Moriah Natasha Tobin and
                  Simona Toscano and
                  Maria Tselengidou and
                  Elisabeth Unger and
                  Marcel Usner and
                  Sofia Vallecorsa and
                  Nick van Eijndhoven and
                  Arne Van Overloop and
                  Jakob van Santen and
                  Markus Vehring and
                  Markus Voge and
                  Matthias Vraeghe and
                  Christian Walck and
                  Tilo Waldenmaier and
                  Marius Wallraff and
                  Christopher N. Weaver and
                  Mark T. Wellons and
                  Christopher H. Wendt and
                  Stefan Westerhoff and
                  Nathan Whitehorn and
                  Klaus Wiebe and
                  Christopher Wiebusch and
                  Dawn R. Williams and
                  Henrike Wissing and
                  Martin Wolf and
                  Terri R. Wood and
                  Kurt Woschnagg and
                  Donglian Xu and
                  Xianwu Xu and
                  Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
                  Gaurang B. Yodh and
                  Shigeru Yoshida and
                  Pavel Zarzhitsky and
                  Jan Ziemann and
                  Simon Zierke and
                  Marcel Zoll},
  title        = {The IceProd framework: Distributed data processing for the IceCube
                  neutrino observatory},
  journal      = {J. Parallel Distributed Comput.},
  volume       = {75},
  pages        = {198--211},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.jpdc.2014.08.001},
  doi          = {10.1016/J.JPDC.2014.08.001},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jpdc/Aartsen15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jsce/Amezquita-Brooks15,
  author       = {Luis Antonio Amezquita{-}Brooks and
                  Diana Hernandez{-}Alcantara and
                  Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and
                  Juan Carlos Tud{\'{o}}n{-}Mart{\'{\i}}nez},
  title        = {Linear programming predictive control with actuator saturation: Experimental
                  robustness and performance results},
  journal      = {J. Syst. Control. Eng.},
  volume       = {229},
  number       = {8},
  pages        = {700--710},
  year         = {2015},
  url          = {https://doi.org/10.1177/0959651815582130},
  doi          = {10.1177/0959651815582130},
  timestamp    = {Thu, 20 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jsce/Amezquita-Brooks15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Anzures-GarciaS15,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Miguel J. Hornos and
                  Patricia Paderewski{-}Rodr{\'{\i}}guez},
  title        = {A Software Architecture for Defining a Methodologic Approach to Develop
                  Collaborative Applications},
  journal      = {Res. Comput. Sci.},
  volume       = {105},
  pages        = {9--20},
  year         = {2015},
  url          = {https://rcs.cic.ipn.mx/2015\_105/A\%20Software\%20Architecture\%20for\%20Defining\%20a\%20Methodologic\%20Approach\%20to\%20Develop\%20Collaborative.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/Anzures-GarciaS15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcs/Cruz-GutierrezP15,
  author       = {Viridiana Cruz{-}Guti{\'{e}}rrez and
                  Mario Alberto Posada{-}Zamora and
                  Maya Carrillo and
                  Luis Enrique Colmenares Guill{\'{e}}n and
                  Abraham S{\'{a}}nchez L{\'{o}}pez},
  title        = {Preprocesamiento de un corpus empleando correcci{\'{o}}n probabil{\'{\i}}stica
                  para precisar el vocabulario},
  journal      = {Res. Comput. Sci.},
  volume       = {99},
  pages        = {43--54},
  year         = {2015},
  url          = {https://rcs.cic.ipn.mx/2015\_99/Preprocesamiento\%20de\%20un\%20corpus\%20empleando\%20correccion\%20probabilistica\%20para\%20precisar\%20el\%20vocabulario.pdf},
  timestamp    = {Fri, 08 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcs/Cruz-GutierrezP15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/simulation/ManzurUSV15,
  author       = {Laura Manzur and
                  Jorge Mario Ulloa and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {xArchiMate: Enterprise Architecture simulation, experimentation and
                  analysis},
  journal      = {Simul.},
  volume       = {91},
  number       = {3},
  pages        = {276--301},
  year         = {2015},
  url          = {https://doi.org/10.1177/0037549715575188},
  doi          = {10.1177/0037549715575188},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/simulation/ManzurUSV15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tii/RizoLBRG15,
  author       = {Mario Rizo and
                  Marco Liserre and
                  Emilio Jos{\'{e}} Bueno and
                  Francisco J. Rodr{\'{\i}}guez and
                  Carlos Giron},
  title        = {Voltage Control Architectures for the Universal Operation of {DPGS}},
  journal      = {{IEEE} Trans. Ind. Informatics},
  volume       = {11},
  number       = {2},
  pages        = {313--321},
  year         = {2015},
  url          = {https://doi.org/10.1109/TII.2015.2389657},
  doi          = {10.1109/TII.2015.2389657},
  timestamp    = {Thu, 25 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tii/RizoLBRG15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/SomolinosCHPTSF15,
  author       = {Roberto Somolinos and
                  Adolfo Mu{\~{n}}oz Carrero and
                  M. Elena Hernando and
                  Mario Pascual Carrasco and
                  Jes{\'{u}}s C{\'{a}}ceres Tello and
                  Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
                  Juan A. Fragua and
                  Pablo Serrano and
                  Carlos Hern{\'{a}}ndez Salvador},
  title        = {Service for the Pseudonymization of Electronic Healthcare Records
                  Based on {ISO/EN} 13606 for the Secondary Use of Information},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {19},
  number       = {6},
  pages        = {1937--1944},
  year         = {2015},
  url          = {https://doi.org/10.1109/JBHI.2014.2360546},
  doi          = {10.1109/JBHI.2014.2360546},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/titb/SomolinosCHPTSF15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ton/SanchezOBCBKW15,
  author       = {Mario A. S{\'{a}}nchez and
                  John S. Otto and
                  Zachary S. Bischof and
                  David R. Choffnes and
                  Fabian E. Bustamante and
                  Balachander Krishnamurthy and
                  Walter Willinger},
  title        = {A Measurement Experimentation Platform at the Internet's Edge},
  journal      = {{IEEE/ACM} Trans. Netw.},
  volume       = {23},
  number       = {6},
  pages        = {1944--1958},
  year         = {2015},
  url          = {https://doi.org/10.1109/TNET.2014.2354348},
  doi          = {10.1109/TNET.2014.2354348},
  timestamp    = {Sat, 27 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ton/SanchezOBCBKW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/approx/BrodyS15,
  author       = {Joshua Brody and
                  Mario S{\'{a}}nchez},
  title        = {Dependent Random Graphs and Multi-Party Pointer Jumping},
  booktitle    = {Approximation, Randomization, and Combinatorial Optimization. Algorithms
                  and Techniques, {APPROX/RANDOM} 2015, August 24-26, 2015, Princeton,
                  NJ, {USA}},
  pages        = {606--624},
  year         = {2015},
  crossref     = {DBLP:conf/approx/2015},
  url          = {https://doi.org/10.4230/LIPIcs.APPROX-RANDOM.2015.606},
  doi          = {10.4230/LIPICS.APPROX-RANDOM.2015.606},
  timestamp    = {Thu, 20 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/approx/BrodyS15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/NaranjoSV15,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {The Devil in the Details: Fine-Grained Enterprise Model Weaving},
  booktitle    = {Advanced Information Systems Engineering Workshops - CAiSE 2015 International
                  Workshops, Stockholm, Sweden, June 8-9, 2015, Proceedings},
  pages        = {233--244},
  year         = {2015},
  crossref     = {DBLP:conf/caise/2015w},
  url          = {https://doi.org/10.1007/978-3-319-19243-7\_23},
  doi          = {10.1007/978-3-319-19243-7\_23},
  timestamp    = {Sun, 02 Jun 2019 21:20:00 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/NaranjoSV15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/RamosSSV15,
  author       = {Andr{\'{e}}s Ramos and
                  Juan Pablo S{\'{a}}enz and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {On the Support of Automated Analysis Chains on Enterprise Models},
  booktitle    = {Enterprise, Business-Process and Information Systems Modeling - 16th
                  International Conference, {BPMDS} 2015, 20th International Conference,
                  {EMMSAD} 2015, Held at CAiSE 2015, Stockholm, Sweden, June 8-9, 2015,
                  Proceedings},
  pages        = {345--359},
  year         = {2015},
  crossref     = {DBLP:conf/caise/2015bpmds},
  url          = {https://doi.org/10.1007/978-3-319-19237-6\_22},
  doi          = {10.1007/978-3-319-19237-6\_22},
  timestamp    = {Fri, 19 Mar 2021 08:43:31 +0100},
  biburl       = {https://dblp.org/rec/conf/caise/RamosSSV15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fskd/Sanchez-Camacho15,
  author       = {Mario Garcia{-}Munoz Sanchez{-}Camacho and
                  Hongying Wu and
                  Carlos Alberto Nunes Cosenza and
                  Fabio Krykhtine and
                  F{\'{e}}lix Mora{-}Camino},
  title        = {Fuzzy setting of cost Index for improved flight management},
  booktitle    = {12th International Conference on Fuzzy Systems and Knowledge Discovery,
                  {FSKD} 2015, Zhangjiajie, China, August 15-17, 2015},
  pages        = {433--438},
  year         = {2015},
  crossref     = {DBLP:conf/fskd/2015},
  url          = {https://doi.org/10.1109/FSKD.2015.7381981},
  doi          = {10.1109/FSKD.2015.7381981},
  timestamp    = {Wed, 16 Oct 2019 14:14:57 +0200},
  biburl       = {https://dblp.org/rec/conf/fskd/Sanchez-Camacho15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/RodriguezMHO15,
  author       = {Mario Rodr{\'{\i}}guez and
                  Carlos Medrano and
                  El{\'{\i}}as Herrero and
                  Carlos Orrite},
  title        = {Spectral Clustering Using Friendship Path Similarity},
  booktitle    = {Pattern Recognition and Image Analysis - 7th Iberian Conference, IbPRIA
                  2015, Santiago de Compostela, Spain, June 17-19, 2015, Proceedings},
  pages        = {319--326},
  year         = {2015},
  crossref     = {DBLP:conf/ibpria/2015},
  url          = {https://doi.org/10.1007/978-3-319-19390-8\_36},
  doi          = {10.1007/978-3-319-19390-8\_36},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/RodriguezMHO15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/SaldanhaSZPA15,
  author       = {M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini},
  title        = {Complexity reduction for the 3D-HEVC depth maps coding},
  booktitle    = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
                  2015, Lisbon, Portugal, May 24-27, 2015},
  pages        = {621--624},
  year         = {2015},
  crossref     = {DBLP:conf/iscas/2015},
  url          = {https://doi.org/10.1109/ISCAS.2015.7168710},
  doi          = {10.1109/ISCAS.2015.7168710},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/SaldanhaSZPA15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwbbio/SanchezFCAC15,
  author       = {Horacio P{\'{e}}rez S{\'{a}}nchez and
                  Afshin Fassihi and
                  Jos{\'{e}} M. Cecilia and
                  Hesham H. Ali and
                  Mario Cannataro},
  title        = {Applications of High Performance Computing in Bioinformatics, Computational
                  Biology and Computational Chemistry},
  booktitle    = {Bioinformatics and Biomedical Engineering - Third International Conference,
                  {IWBBIO} 2015, Granada, Spain, April 15-17, 2015. Proceedings, Part
                  {II}},
  pages        = {527--541},
  year         = {2015},
  crossref     = {DBLP:conf/iwbbio/2015-2},
  url          = {https://doi.org/10.1007/978-3-319-16480-9\_51},
  doi          = {10.1007/978-3-319-16480-9\_51},
  timestamp    = {Fri, 11 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwbbio/SanchezFCAC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/SanchezSZPA15,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini},
  title        = {{S-GMOF:} {A} gradient-based complexity reduction algorithm for depth-maps
                  intra prediction on 3D-HEVC},
  booktitle    = {{IEEE} 6th Latin American Symposium on Circuits {\&} Systems,
                  {LASCAS} 2015, Montevideo, Uruguay, February 24-27, 2015},
  pages        = {1--4},
  year         = {2015},
  crossref     = {DBLP:conf/lascas/2015},
  url          = {https://doi.org/10.1109/LASCAS.2015.7250455},
  doi          = {10.1109/LASCAS.2015.7250455},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/SanchezSZPA15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/MorenoGCLLSBGWC15,
  author       = {Pedro A. Moreno and
                  Jos{\'{e}} Luis Garcia{-}Pacheco and
                  Jim Charvill and
                  Ahmad Lotfi and
                  Caroline S. Langensiepen and
                  Alison Saunders and
                  Kris Berckmans and
                  Jozef Gaspersic and
                  Louise Walton and
                  Montserrat Carmona Rodriguez and
                  S. Perez de la Camara and
                  Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
                  J. Pozo and
                  Adolfo Mu{\~{n}}oz and
                  Mario Pascual Carrasco and
                  Enrique J. G{\'{o}}mez},
  title        = {iCarer: {AAL} for the Informal Carers of the Elderly},
  booktitle    = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015,
                  Madrid Spain, 27-29 May, 2015},
  pages        = {678--680},
  year         = {2015},
  crossref     = {DBLP:conf/mie/2015},
  url          = {https://doi.org/10.3233/978-1-61499-512-8-678},
  doi          = {10.3233/978-1-61499-512-8-678},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mie/MorenoGCLLSBGWC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mie/Sanchez-de-Madariaga15,
  author       = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
                  Adolfo Mu{\~{n}}oz Carrero and
                  Roberto Somolinos and
                  Antonio L. Castro and
                  Iker Vel{\'{a}}zquez and
                  Oscar Moreno and
                  Jos{\'{e}} L. Garc{\'{\i}}a{-}Pacheco and
                  Mario Pascual Carrasco and
                  Carlos Hern{\'{a}}ndez Salvador},
  title        = {Normalized medical information visualization},
  booktitle    = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015,
                  Madrid Spain, 27-29 May, 2015},
  pages        = {215--217},
  year         = {2015},
  crossref     = {DBLP:conf/mie/2015},
  url          = {https://doi.org/10.3233/978-1-61499-512-8-215},
  doi          = {10.3233/978-1-61499-512-8-215},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mie/Sanchez-de-Madariaga15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mswim/Sanchez-Hernandez15,
  author       = {Jairo Javier Sanchez{-}Hernandez and
                  Rolando Menchaca{-}M{\'{e}}ndez and
                  Ricardo Menchaca{-}Mendez and
                  Jesus Garcia{-}Diaz and
                  Mario E. Rivero{-}Angeles and
                  Jose Joaquin Garcia{-}Luna{-}Aceves},
  title        = {A Bloom Filter-Based Algorithm for Routing in Intermittently Connected
                  Mobile Networks},
  booktitle    = {Proceedings of the 18th {ACM} International Conference on Modeling,
                  Analysis and Simulation of Wireless and Mobile Systems, MSWiM 2015,
                  Cancun, Mexico, November 2-6, 2015},
  pages        = {319--326},
  year         = {2015},
  crossref     = {DBLP:conf/mswim/2015},
  url          = {https://doi.org/10.1145/2811587.2811609},
  doi          = {10.1145/2811587.2811609},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mswim/Sanchez-Hernandez15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sepln/SiordiaMGMTV15,
  author       = {Oscar S. Siordia and
                  Daniela Moctezuma and
                  Mario Graff and
                  Sabino Miranda{-}Jim{\'{e}}nez and
                  Eric Sadit T{\'{e}}llez and
                  Elio{-}Aten{\'{o}}genes Villase{\~{n}}or},
  title        = {Sentiment Analysis for Twitter: {TASS} 2015},
  booktitle    = {Proceedings of {TASS} 2015: Workshop on Sentiment Analysis at {SEPLN}
                  co-located with 31st {SEPLN} Conference {(SEPLN} 2015), Alicante,
                  Spain, September 15, 2015},
  pages        = {65--70},
  year         = {2015},
  crossref     = {DBLP:conf/sepln/2015tass},
  url          = {https://ceur-ws.org/Vol-1397/centroGEO\_Infotec.pdf},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sepln/SiordiaMGMTV15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/SanchezBKW15,
  author       = {Mario A. S{\'{a}}nchez and
                  Fabi{\'{a}}n E. Bustamante and
                  Balachander Krishnamurthy and
                  Walter Willinger},
  title        = {Experiment Coordination for Large-scale Measurement Platforms},
  booktitle    = {Proceedings of the 2015 {ACM} {SIGCOMM} Workshop on Crowdsourcing
                  and Crowdsharing of Big (Internet) Data, C2B(I)D@SIGCOMM 2015, London,
                  United Kingdom, August 17, 2015},
  pages        = {21--26},
  year         = {2015},
  crossref     = {DBLP:conf/sigcomm/2015s2bid},
  url          = {https://doi.org/10.1145/2787394.2787401},
  doi          = {10.1145/2787394.2787401},
  timestamp    = {Tue, 06 Nov 2018 11:07:11 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcomm/SanchezBKW15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ucami/Ferrandez-Pastor15,
  author       = {Francisco Javier Ferr{\'{a}}ndez Pastor and
                  Higinio Mora Mora and
                  Jos{\'{e}}{-}Luis S{\'{a}}nchez{-}Romero and
                  Mario Nieto{-}Hidalgo},
  title        = {Smart Sensor Design for Power Signal Processing},
  booktitle    = {Ubiquitous Computing and Ambient Intelligence. Sensing, Processing,
                  and Using Environmental Information - 9th International Conference,
                  UCAmI 2015, Puerto Varas, Chile, December 1-4, 2015, Proceedings},
  pages        = {387--393},
  year         = {2015},
  crossref     = {DBLP:conf/ucami/2015},
  url          = {https://doi.org/10.1007/978-3-319-26401-1\_36},
  doi          = {10.1007/978-3-319-26401-1\_36},
  timestamp    = {Tue, 14 May 2019 10:00:41 +0200},
  biburl       = {https://dblp.org/rec/conf/ucami/Ferrandez-Pastor15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/LocesRPBH15,
  author       = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
                  Kavita Rege and
                  Johnatan E. Pecero and
                  Pascal Bouvry and
                  H{\'{e}}ctor J. {Fraire H.}},
  title        = {Trajectory Metaheuristics for the Internet Shopping Optimization Problem},
  booktitle    = {Design of Intelligent Systems Based on Fuzzy Logic, Neural Networks
                  and Nature-Inspired Optimization},
  pages        = {527--536},
  year         = {2015},
  crossref     = {DBLP:series/sci/2015-601},
  url          = {https://doi.org/10.1007/978-3-319-17747-2\_41},
  doi          = {10.1007/978-3-319-17747-2\_41},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/series/sci/LocesRPBH15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/BrodyS15,
  author       = {Joshua Brody and
                  Mario S{\'{a}}nchez},
  title        = {Dependent Random Graphs and Multiparty Pointer Jumping},
  journal      = {CoRR},
  volume       = {abs/1506.01083},
  year         = {2015},
  url          = {http://arxiv.org/abs/1506.01083},
  eprinttype    = {arXiv},
  eprint       = {1506.01083},
  timestamp    = {Thu, 20 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/BrodyS15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/MereloGVB15,
  author       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Mario Garc{\'{\i}}a Valdez and
                  Israel Blancas},
  title        = {There is no fast lunch: an examination of the running speed of evolutionary
                  algorithms in several languages},
  journal      = {CoRR},
  volume       = {abs/1511.01088},
  year         = {2015},
  url          = {http://arxiv.org/abs/1511.01088},
  eprinttype    = {arXiv},
  eprint       = {1511.01088},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/MereloGVB15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eccc/BrodyS15,
  author       = {Joshua Brody and
                  Mario S{\'{a}}nchez},
  title        = {Dependent Random Graphs and Multiparty Pointer Jumping},
  journal      = {Electron. Colloquium Comput. Complex.},
  volume       = {{TR15-091}},
  year         = {2015},
  url          = {https://eccc.weizmann.ac.il/report/2015/091},
  eprinttype    = {ECCC},
  eprint       = {TR15-091},
  timestamp    = {Thu, 20 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eccc/BrodyS15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/computing/GansnerKWBS14,
  author       = {Emden R. Gansner and
                  Balachander Krishnamurthy and
                  Walter Willinger and
                  Fabi{\'{a}}n E. Bustamante and
                  Mario A. S{\'{a}}nchez},
  title        = {Demo abstract: towards extracting semantics by visualizing large traceroute
                  datasets},
  journal      = {Computing},
  volume       = {96},
  number       = {1},
  pages        = {81--83},
  year         = {2014},
  url          = {https://doi.org/10.1007/s00607-013-0290-8},
  doi          = {10.1007/S00607-013-0290-8},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/computing/GansnerKWBS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/Rodriguez-DiazS14,
  author       = {Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az and
                  Hermilo S{\'{a}}nchez{-}Cruz},
  title        = {Refined fixed double pass binary object classification for document
                  image compression},
  journal      = {Digit. Signal Process.},
  volume       = {30},
  pages        = {114--130},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.dsp.2014.03.007},
  doi          = {10.1016/J.DSP.2014.03.007},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/dsp/Rodriguez-DiazS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejwcn/Cortes-SanchezVLRS14,
  author       = {Jorge Cort{\'{e}}s{-}S{\'{a}}nchez and
                  Andr{\'{e}}s Vel{\'{a}}zquez{-}Ram{\'{\i}}rez and
                  Andr{\'{e}}s Lucas{-}Bravo and
                  Mario E. Rivero{-}Angeles and
                  Victor A. Salinas{-}Reyes},
  title        = {On the use of electromagnetic waves as means of power supply in wireless
                  sensor networks},
  journal      = {{EURASIP} J. Wirel. Commun. Netw.},
  volume       = {2014},
  pages        = {36},
  year         = {2014},
  url          = {https://doi.org/10.1186/1687-1499-2014-36},
  doi          = {10.1186/1687-1499-2014-36},
  timestamp    = {Thu, 27 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ejwcn/Cortes-SanchezVLRS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/evi/MoraGGCRH14,
  author       = {Antonio Miguel Mora and
                  Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Pedro A. Castillo and
                  M. S. Rodr{\'{\i}}guez{-}Domingo and
                  R. M. Hidalgo{-}Berm{\'{u}}dez},
  title        = {Creating autonomous agents for playing Super Mario Bros game by means
                  of evolutionary finite state machines},
  journal      = {Evol. Intell.},
  volume       = {6},
  number       = {4},
  pages        = {205--218},
  year         = {2014},
  url          = {https://doi.org/10.1007/s12065-014-0105-7},
  doi          = {10.1007/S12065-014-0105-7},
  timestamp    = {Thu, 16 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/evi/MoraGGCRH14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijns/GonzalezDRS14,
  author       = {Mario Gonz{\'{a}}lez and
                  David Dominguez and
                  Francisco B. Rodr{\'{\i}}guez and
                  {\'{A}}ngel S{\'{a}}nchez},
  title        = {Retrieval of noisy Fingerprint Patterns using Metric Attractor Networks},
  journal      = {Int. J. Neural Syst.},
  volume       = {24},
  number       = {7},
  year         = {2014},
  url          = {https://doi.org/10.1142/S0129065714500257},
  doi          = {10.1142/S0129065714500257},
  timestamp    = {Sat, 01 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijns/GonzalezDRS14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jot/GomezSFV14,
  author       = {Paola G{\'{o}}mez and
                  Mario E. S{\'{a}}nchez and
                  Hector Florez and
                  Jorge Villalobos},
  title        = {An approach to the co-creation of models and metamodels in Enterprise
                  Architecture Projects},
  journal      = {J. Object Technol.},
  volume       = {13},
  number       = {3},
  pages        = {2: 1--29},
  year         = {2014},
  url          = {https://doi.org/10.5381/jot.2014.13.3.a2},
  doi          = {10.5381/JOT.2014.13.3.A2},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jot/GomezSFV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pnas/Gavalda-Miralles14,
  author       = {Arnau Gavald{\`{a}}{-}Miralles and
                  David R. Choffnes and
                  John S. Otto and
                  Mario A. S{\'{a}}nchez and
                  Fabi{\'{a}}n E. Bustamante and
                  Lu{\'{\i}}s A. Nunes Amaral and
                  Jordi Duch and
                  Roger Guimer{\`{a}}},
  title        = {Impact of heterogeneity and socioeconomic factors on individual behavior
                  in decentralized sharing ecosystems},
  journal      = {Proc. Natl. Acad. Sci. {USA}},
  volume       = {111},
  number       = {43},
  pages        = {15322--15327},
  year         = {2014},
  url          = {https://doi.org/10.1073/pnas.1309389111},
  doi          = {10.1073/PNAS.1309389111},
  timestamp    = {Thu, 16 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pnas/Gavalda-Miralles14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/polibits/JaramilloSP14,
  author       = {Carlos Mario Zapata Jaramillo and
                  Rafael Esteban Arango Sanchez and
                  Leidy Diana Jim{\'{e}}nez Pinz{\'{o}}n},
  title        = {Mejoramiento de la consistencia entre la sintaxis textual y gr{\'{a}}fica
                  del lenguaje de Semat},
  journal      = {Polibits},
  volume       = {49},
  pages        = {83--89},
  year         = {2014},
  url          = {https://doi.org/10.17562/pb-49-10},
  doi          = {10.17562/PB-49-10},
  timestamp    = {Fri, 10 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/polibits/JaramilloSP14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/RamosGSV14,
  author       = {Andr{\'{e}}s Ramos and
                  Paola G{\'{o}}mez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Automated Enterprise-Level Analysis of ArchiMate Models},
  booktitle    = {Enterprise, Business-Process and Information Systems Modeling - 15th
                  International Conference, {BPMDS} 2014, 19th International Conference,
                  {EMMSAD} 2014, Held at CAiSE 2014, Thessaloniki, Greece, June 16-17,
                  2014. Proceedings},
  pages        = {439--453},
  year         = {2014},
  crossref     = {DBLP:conf/caise/2014bpmds},
  url          = {https://doi.org/10.1007/978-3-662-43745-2\_30},
  doi          = {10.1007/978-3-662-43745-2\_30},
  timestamp    = {Thu, 02 Aug 2018 16:14:14 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/RamosGSV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/SanchezRV14,
  author       = {Mario E. S{\'{a}}nchez and
                  Julio Cesar Reyes and
                  Jorge Villalobos},
  title        = {Extraction and Reconstruction of Enterprise Models},
  booktitle    = {Enterprise and Organizational Modeling and Simulation - 10th International
                  Workshop, {EOMAS} 2014, Held at CAiSE 2014, Thessaloniki, Greece,
                  June 16-17, 2014, Selected Papers},
  pages        = {3--20},
  year         = {2014},
  crossref     = {DBLP:conf/caise/2014eomas},
  url          = {https://doi.org/10.1007/978-3-662-44860-1\_1},
  doi          = {10.1007/978-3-662-44860-1\_1},
  timestamp    = {Thu, 15 Jun 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/SanchezRV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/DiazPBSVC14,
  author       = {Cesar O. Diaz and
                  Johnatan E. Pecero and
                  Pascal Bouvry and
                  German Sotelo and
                  Mario Villamizar and
                  Harold E. Castro},
  title        = {Performance Evaluation of an IaaS Opportunistic Cloud Computing},
  booktitle    = {14th {IEEE/ACM} International Symposium on Cluster, Cloud and Grid
                  Computing, CCGrid 2014, Chicago, IL, USA, May 26-29, 2014},
  pages        = {546--547},
  year         = {2014},
  crossref     = {DBLP:conf/ccgrid/2014},
  url          = {https://doi.org/10.1109/CCGrid.2014.116},
  doi          = {10.1109/CCGRID.2014.116},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ccgrid/DiazPBSVC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clei/DivanORCFM14,
  author       = {Mario Jos{\'{e}} Div{\'{a}}n and
                  Ana Oddone and
                  Mar{\'{\i}}a Laura S{\'{a}}nchez Reynoso and
                  Bruno Sebastian Cavallo and
                  Marcos Alejandro Fredes and
                  Alejandro Maximiliano Martinez},
  title        = {A data monitoring strategy based in snapshots for the score calculation
                  in the housing distribution},
  booktitle    = {{XL} Latin American Computing Conference, {CLEI} 2014, Montevideo,
                  Uruguay, September 15-19, 2014},
  pages        = {1--12},
  year         = {2014},
  crossref     = {DBLP:conf/clei/2014},
  url          = {https://doi.org/10.1109/CLEI.2014.6965104},
  doi          = {10.1109/CLEI.2014.6965104},
  timestamp    = {Thu, 14 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/clei/DivanORCFM14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/FlorezSV14,
  author       = {Hector Florez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Extensible Model-Based Approach for Supporting Automatic Enterprise
                  Analysis},
  booktitle    = {18th {IEEE} International Enterprise Distributed Object Computing
                  Conference, {EDOC} 2014, Ulm, Germany, September 1-5, 2014},
  pages        = {32--41},
  year         = {2014},
  crossref     = {DBLP:conf/edoc/2014},
  url          = {https://doi.org/10.1109/EDOC.2014.15},
  doi          = {10.1109/EDOC.2014.15},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/edoc/FlorezSV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/FlorezSV14a,
  author       = {Hector Florez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {iArchiMate: {A} Tool for Managing Imperfection in Enterprise Models},
  booktitle    = {18th {IEEE} International Enterprise Distributed Object Computing
                  Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm,
                  Germany, September 1-2, 2014},
  pages        = {201--210},
  year         = {2014},
  crossref     = {DBLP:conf/edoc/2014w},
  url          = {https://doi.org/10.1109/EDOCW.2014.38},
  doi          = {10.1109/EDOCW.2014.38},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/edoc/FlorezSV14a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV14,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Towards a Unified and Modular Approach for Visual Analysis of Enterprise
                  Models},
  booktitle    = {18th {IEEE} International Enterprise Distributed Object Computing
                  Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm,
                  Germany, September 1-2, 2014},
  pages        = {77--86},
  year         = {2014},
  crossref     = {DBLP:conf/edoc/2014w},
  url          = {https://doi.org/10.1109/EDOCW.2014.20},
  doi          = {10.1109/EDOCW.2014.20},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/edoc/NaranjoSV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceee/Dominguez-Sanchez14,
  author       = {S. Dominguez{-}Sanchez and
                  Mario Alfredo Reyes{-}Barranca and
                  G. S. Abarca{-}Jimenez and
                  Salvador Mendoza{-}Acevedo},
  title        = {A prototype design for an accelerometer using a multiple floating-gate
                  {MOSFET} as a transducer},
  booktitle    = {11th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2014, Campeche, Mexico, September
                  29 - October 3, 2014},
  pages        = {1--6},
  year         = {2014},
  crossref     = {DBLP:conf/iceee/2014},
  url          = {https://doi.org/10.1109/ICEEE.2014.6978255},
  doi          = {10.1109/ICEEE.2014.6978255},
  timestamp    = {Wed, 16 Oct 2019 14:14:56 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/Dominguez-Sanchez14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/NaranjoSV14,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {PRIMROSe - {A} Tool for Enterprise Architecture Analysis and Diagnosis},
  booktitle    = {{ICEIS} 2014 - Proceedings of the 16th International Conference on
                  Enterprise Information Systems, Volume 3, Lisbon, Portugal, 27-30
                  April, 2014},
  pages        = {201--213},
  year         = {2014},
  crossref     = {DBLP:conf/iceis/2014-3},
  url          = {https://doi.org/10.5220/0004884702010213},
  doi          = {10.5220/0004884702010213},
  timestamp    = {Wed, 12 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iceis/NaranjoSV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/NaranjoSV14a,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {PRIMROSe: {A} Graph-Based Approach for Enterprise Architecture Analysis},
  booktitle    = {Enterprise Information Systems - 16th International Conference, {ICEIS}
                  2014, Lisbon, Portugal, April 27-30, 2014, Revised Selected Papers},
  pages        = {434--452},
  year         = {2014},
  crossref     = {DBLP:conf/iceis/2014sp},
  url          = {https://doi.org/10.1007/978-3-319-22348-3\_24},
  doi          = {10.1007/978-3-319-22348-3\_24},
  timestamp    = {Sat, 19 Oct 2019 20:26:20 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/NaranjoSV14a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icete/MusialPLFBB14,
  author       = {Jedrzej Musial and
                  Johnatan E. Pecero and
                  Mario C. Lopez and
                  H{\'{e}}ctor J. {Fraire H.} and
                  Pascal Bouvry and
                  Jacek Blazewicz},
  title        = {How to Efficiently Solve Internet Shopping Optimization Problem with
                  Price Sensitive Discounts?},
  booktitle    = {{ICE-B} 2014 - Proceedings of the 11th International Conference on
                  e-Business, Vienna, Austria, 28-30 August, 2014},
  pages        = {209--215},
  year         = {2014},
  crossref     = {DBLP:conf/icete/2014},
  url          = {https://doi.org/10.5220/0005112602090215},
  doi          = {10.5220/0005112602090215},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icete/MusialPLFBB14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/SanchezSBZPA14,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Gabriel Balota and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini},
  title        = {Complexity reduction for 3D-HEVC depth maps intra-frame prediction
                  using simplified edge detector algorithm},
  booktitle    = {2014 {IEEE} International Conference on Image Processing, {ICIP} 2014,
                  Paris, France, October 27-30, 2014},
  pages        = {3209--3213},
  year         = {2014},
  crossref     = {DBLP:conf/icip/2014},
  url          = {https://doi.org/10.1109/ICIP.2014.7025649},
  doi          = {10.1109/ICIP.2014.7025649},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/SanchezSBZPA14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icira/PrudencioSGL14,
  author       = {Alejandro Prudencio and
                  Eduardo Morales Sanchez and
                  Mario A. Garc{\'{\i}}a and
                  Alejandro Lozano},
  title        = {Anthropometric and Anthropomorphic Features Applied to a Mechanical
                  Finger},
  booktitle    = {Intelligent Robotics and Applications - 7th International Conference,
                  {ICIRA} 2014, Guangzhou, China, December 17-20, 2014, Proceedings,
                  Part {I}},
  pages        = {254--265},
  year         = {2014},
  crossref     = {DBLP:conf/icira/2014-1},
  url          = {https://doi.org/10.1007/978-3-319-13966-1\_26},
  doi          = {10.1007/978-3-319-13966-1\_26},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icira/PrudencioSGL14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imc/SanchezBKWSE14,
  author       = {Mario A. S{\'{a}}nchez and
                  Fabi{\'{a}}n E. Bustamante and
                  Balachander Krishnamurthy and
                  Walter Willinger and
                  Georgios Smaragdakis and
                  Jeffrey Erman},
  title        = {Inter-Domain Traffic Estimation for the Outsider},
  booktitle    = {Proceedings of the 2014 Internet Measurement Conference, {IMC} 2014,
                  Vancouver, BC, Canada, November 5-7, 2014},
  pages        = {1--14},
  year         = {2014},
  crossref     = {DBLP:conf/imc/2014},
  url          = {https://doi.org/10.1145/2663716.2663740},
  doi          = {10.1145/2663716.2663740},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/imc/SanchezBKWSE14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEG14,
  author       = {Antonio Sanchez{-}Clemente and
                  Luis Entrena and
                  Mario Garc{\'{\i}}a{-}Valderas},
  title        = {Error masking with approximate logic circuits using dynamic probability
                  estimations},
  booktitle    = {2014 {IEEE} 20th International On-Line Testing Symposium, {IOLTS}
                  2014, Platja d'Aro, Girona, Spain, July 7-9, 2014},
  pages        = {134--139},
  year         = {2014},
  crossref     = {DBLP:conf/iolts/2014},
  url          = {https://doi.org/10.1109/IOLTS.2014.6873685},
  doi          = {10.1109/IOLTS.2014.6873685},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/iolts/Sanchez-ClementeEG14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lanmr/Anzures-GarciaSHP14,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Miguel J. Hornos and
                  Patricia Paderewski},
  title        = {Knowledge Representation for Development of Collaborative Applications},
  booktitle    = {Proceedings of the Ninth Latin American Workshop on Logic/Languages,
                  Algorithms and New Methods of Reasoning, Valle de Bravo, Mexico, November
                  5-7, 2014},
  pages        = {1--9},
  year         = {2014},
  crossref     = {DBLP:conf/lanmr/2014},
  url          = {https://ceur-ws.org/Vol-1287/preface.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:23:17 +0100},
  biburl       = {https://dblp.org/rec/conf/lanmr/Anzures-GarciaSHP14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/BalotaSSZPA14,
  author       = {Gabriel Balota and
                  M{\'{a}}rio Saldanha and
                  Gustavo Sanchez and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini},
  title        = {Overview and quality analysis in 3D-HEVC emergent video coding standard},
  booktitle    = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS}
                  2014, Santiago, Chile, February 25-28, 2014},
  pages        = {1--4},
  year         = {2014},
  crossref     = {DBLP:conf/lascas/2014},
  url          = {https://doi.org/10.1109/LASCAS.2014.6820260},
  doi          = {10.1109/LASCAS.2014.6820260},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/BalotaSSZPA14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/ReyesPTLSMH14,
  author       = {Benjam{\'{\i}}n T. Reyes and
                  German Paulina and
                  Lucas Tealdi and
                  Emanuel Labat and
                  Raul M. Sanchez and
                  Pablo Sergio Mandolesi and
                  Mario Rafael Hueda},
  title        = {A 1.6Gb/s {CMOS} {LVDS} transmitter with a programmable pre-emphasis
                  system},
  booktitle    = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS}
                  2014, Santiago, Chile, February 25-28, 2014},
  pages        = {1--4},
  year         = {2014},
  crossref     = {DBLP:conf/lascas/2014},
  url          = {https://doi.org/10.1109/LASCAS.2014.6820268},
  doi          = {10.1109/LASCAS.2014.6820268},
  timestamp    = {Mon, 20 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/lascas/ReyesPTLSMH14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lascas/ReyesTPLSMH14,
  author       = {Benjam{\'{\i}}n T. Reyes and
                  Lucas Tealdi and
                  German Paulina and
                  Emanuel Labat and
                  Raul M. Sanchez and
                  Pablo Sergio Mandolesi and
                  Mario Rafael Hueda},
  title        = {A 6-bit 2GS/s {CMOS} time-interleaved {ADC} for analysis of mixed-signal
                  calibration techniques},
  booktitle    = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS}
                  2014, Santiago, Chile, February 25-28, 2014},
  pages        = {1--4},
  year         = {2014},
  crossref     = {DBLP:conf/lascas/2014},
  url          = {https://doi.org/10.1109/LASCAS.2014.6820267},
  doi          = {10.1109/LASCAS.2014.6820267},
  timestamp    = {Mon, 20 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/lascas/ReyesTPLSMH14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/vcip/SanchezSBZPA14,
  author       = {Gustavo Sanchez and
                  M{\'{a}}rio Saldanha and
                  Gabriel Balota and
                  Bruno Zatt and
                  Marcelo Schiavon Porto and
                  Luciano Volcan Agostini},
  title        = {A complexity reduction algorithm for depth maps intra prediction on
                  the 3D-HEVC},
  booktitle    = {2014 {IEEE} Visual Communications and Image Processing Conference,
                  {VCIP} 2014, Valletta, Malta, December 7-10, 2014},
  pages        = {137--140},
  year         = {2014},
  crossref     = {DBLP:conf/vcip/2014},
  url          = {https://doi.org/10.1109/VCIP.2014.7051523},
  doi          = {10.1109/VCIP.2014.7051523},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/vcip/SanchezSBZPA14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/LocesCHBPRBV14,
  author       = {Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
                  Norberto Castillo{-}Garc{\'{\i}}a and
                  H{\'{e}}ctor J. {Fraire H.} and
                  Pascal Bouvry and
                  Johnatan E. Pecero and
                  Rodolfo A. Pazos Rangel and
                  Juan Javier Gonz{\'{a}}lez Barbosa and
                  Fevrier Valdez},
  title        = {A New Integer Linear Programming Model for the Cutwidth Minimization
                  Problem of a Connected Undirected Graph},
  booktitle    = {Recent Advances on Hybrid Approaches for Designing Intelligent Systems},
  pages        = {509--517},
  year         = {2014},
  crossref     = {DBLP:series/sci/2014-547},
  url          = {https://doi.org/10.1007/978-3-319-05170-3\_35},
  doi          = {10.1007/978-3-319-05170-3\_35},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/series/sci/LocesCHBPRBV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cluster/CastroVSDPB13,
  author       = {Harold E. Castro and
                  Mario Villamizar and
                  German Sotelo and
                  Cesar O. Diaz and
                  Johnatan E. Pecero and
                  Pascal Bouvry},
  title        = {Green flexible opportunistic computing with task consolidation and
                  virtualization},
  journal      = {Clust. Comput.},
  volume       = {16},
  number       = {3},
  pages        = {545--557},
  year         = {2013},
  url          = {https://doi.org/10.1007/s10586-012-0222-y},
  doi          = {10.1007/S10586-012-0222-Y},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cluster/CastroVSDPB13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/Martinez-ZarzuelaGPFH13,
  author       = {Mario Mart{\'{\i}}nez{-}Zarzuela and
                  Carlos G{\'{o}}mez and
                  Francisco Javier D{\'{\i}}az Pernas and
                  Alberto Fern{\'{a}}ndez and
                  Roberto Hornero},
  title        = {Cross-Approximate Entropy parallel computation on GPUs for biomedical
                  signal analysis. Application to {MEG} recordings},
  journal      = {Comput. Methods Programs Biomed.},
  volume       = {112},
  number       = {1},
  pages        = {189--199},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.cmpb.2013.07.005},
  doi          = {10.1016/J.CMPB.2013.07.005},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cmpb/Martinez-ZarzuelaGPFH13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/envsoft/RodriguezMDAHM13,
  author       = {Juan Pablo Rodr{\'{\i}}guez and
                  Neil Duncan McIntyre and
                  Mario D{\'{\i}}az{-}Granados and
                  Stefan Achleitner and
                  Martin Hochedlinger and
                  Cedo Maksimovic},
  title        = {Generating time-series of dry weather loads to sewers},
  journal      = {Environ. Model. Softw.},
  volume       = {43},
  pages        = {133--143},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.envsoft.2013.02.007},
  doi          = {10.1016/J.ENVSOFT.2013.02.007},
  timestamp    = {Thu, 18 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/envsoft/RodriguezMDAHM13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcis/Sanchez-GonzalezGRP13,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Francisco Ruiz and
                  Mario Piattini},
  title        = {Toward a Quality Framework for Business Process Models},
  journal      = {Int. J. Cooperative Inf. Syst.},
  volume       = {22},
  number       = {1},
  year         = {2013},
  url          = {https://doi.org/10.1142/S0218843013500032},
  doi          = {10.1142/S0218843013500032},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijcis/Sanchez-GonzalezGRP13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jamia/Sanchez-de-MadariagaCTSPMSM13,
  author       = {Ricardo S{\'{a}}nchez{-}de{-}Madariaga and
                  Adolfo Mu{\~{n}}oz Carrero and
                  Jes{\'{u}}s C{\'{a}}ceres Tello and
                  Roberto Somolinos and
                  Mario Pascual Carrasco and
                  Ignacio Mart{\'{\i}}nez and
                  Carlos Hern{\'{a}}ndez Salvador and
                  Jose Luis Monteagudo},
  title        = {ccML, a new mark-up language to improve {ISO/EN} 13606-based electronic
                  health record extracts practical edition},
  journal      = {J. Am. Medical Informatics Assoc.},
  volume       = {20},
  number       = {2},
  pages        = {298--304},
  year         = {2013},
  url          = {https://doi.org/10.1136/amiajnl-2011-000722},
  doi          = {10.1136/AMIAJNL-2011-000722},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jamia/Sanchez-de-MadariagaCTSPMSM13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/mcs/RizoLBRH13,
  author       = {Mario Rizo and
                  Marco Liserre and
                  Emilio Jos{\'{e}} Bueno and
                  Francisco J. Rodr{\'{\i}}guez and
                  Francisco Huerta},
  title        = {Universal wind turbine working in grid-connected and island operating
                  modes},
  journal      = {Math. Comput. Simul.},
  volume       = {91},
  pages        = {41--51},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.matcom.2012.07.006},
  doi          = {10.1016/J.MATCOM.2012.07.006},
  timestamp    = {Thu, 25 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/mcs/RizoLBRH13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/Sanchez-EscobedoC13,
  author       = {Dalila S{\'{a}}nchez{-}Escobedo and
                  Mario Castel{\'{a}}n},
  title        = {3D face shape prediction from a frontal image using cylindrical coordinates
                  and partial least squares},
  journal      = {Pattern Recognit. Lett.},
  volume       = {34},
  number       = {4},
  pages        = {389--399},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.patrec.2012.09.007},
  doi          = {10.1016/J.PATREC.2012.09.007},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/Sanchez-EscobedoC13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rcc/SanchezV13,
  author       = {Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {An Expanded and Refined Catalog of Time Patterns for Workflows},
  journal      = {Rev. Colomb. de Computaci{\'{o}}n},
  volume       = {14},
  number       = {2},
  pages        = {122--140},
  year         = {2013},
  url          = {https://doi.org/10.29375/25392115.2018},
  doi          = {10.29375/25392115.2018},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rcc/SanchezV13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/GarridoGSG13,
  author       = {Mario Garrido and
                  Jes{\'{u}}s Grajal and
                  Miguel A. S{\'{a}}nchez Marcos and
                  Oscar Gustafsson},
  title        = {Pipelined Radix-2\({}^{\mbox{k}}\) Feedforward {FFT} Architectures},
  journal      = {{IEEE} Trans. Very Large Scale Integr. Syst.},
  volume       = {21},
  number       = {1},
  pages        = {23--32},
  year         = {2013},
  url          = {https://doi.org/10.1109/TVLSI.2011.2178275},
  doi          = {10.1109/TVLSI.2011.2178275},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tvlsi/GarridoGSG13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccgrid/DiazCVPB13,
  author       = {Cesar O. Diaz and
                  Harold E. Castro and
                  Mario Villamizar and
                  Johnatan E. Pecero and
                  Pascal Bouvry},
  title        = {Energy-aware {VM} Allocation on an Opportunistic Cloud Infrastructure},
  booktitle    = {13th {IEEE/ACM} International Symposium on Cluster, Cloud, and Grid
                  Computing, CCGrid 2013, Delft, Netherlands, May 13-16, 2013},
  pages        = {663--670},
  year         = {2013},
  crossref     = {DBLP:conf/ccgrid/2013},
  url          = {https://doi.org/10.1109/CCGrid.2013.96},
  doi          = {10.1109/CCGRID.2013.96},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ccgrid/DiazCVPB13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/Gonzalez-SanchezALZ13,
  author       = {Mario Francisco Gonz{\'{a}}lez{-}S{\'{a}}nchez and
                  Luis Antonio Amezquita{-}Brooks and
                  Eduardo Lic{\'{e}}aga{-}Castro and
                  Patricia del C. Zambrano{-}Robledo},
  title        = {Simplifying quadrotor controllers by using simplified design models},
  booktitle    = {Proceedings of the 52nd {IEEE} Conference on Decision and Control,
                  {CDC} 2013, Florence, Italy, December 10-13, 2013},
  pages        = {4236--4241},
  year         = {2013},
  crossref     = {DBLP:conf/cdc/2013},
  url          = {https://doi.org/10.1109/CDC.2013.6760540},
  doi          = {10.1109/CDC.2013.6760540},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/Gonzalez-SanchezALZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/GomezSV13,
  author       = {Paola G{\'{o}}mez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {\emph{GraCoT}, a tool for co-creation of models and metamodels in
                  specific domains},
  booktitle    = {Proceedings of the workshop on ACadeMics Tooling with Eclipse, ACME@ECOOP
                  2013, Montpellier, France, July 2, 2013},
  pages        = {5:1--5:10},
  year         = {2013},
  crossref     = {DBLP:conf/ecoop/2013acme},
  url          = {https://doi.org/10.1145/2491279.2491284},
  doi          = {10.1145/2491279.2491284},
  timestamp    = {Tue, 06 Nov 2018 16:59:31 +0100},
  biburl       = {https://dblp.org/rec/conf/ecoop/GomezSV13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecoop/MeloSV13,
  author       = {Ivan Melo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Composing graphical languages},
  booktitle    = {Proceedings of the First Workshop on the Globalization of Domain Specific
                  Languages, GlobalDSL@ECOOP 2013, Montpellier, France, July 1, 2013},
  pages        = {12--17},
  year         = {2013},
  crossref     = {DBLP:conf/ecoop/2013globaldsl},
  url          = {https://doi.org/10.1145/2489812.2489816},
  doi          = {10.1145/2489812.2489816},
  timestamp    = {Tue, 06 Nov 2018 16:59:31 +0100},
  biburl       = {https://dblp.org/rec/conf/ecoop/MeloSV13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/LoddeFA13,
  author       = {Mario Lodde and
                  Jos{\'{e}} Flich and
                  Manuel E. Acacio},
  title        = {Towards Efficient Dynamic {LLC} Home Bank Mapping with NoC-Level Support},
  booktitle    = {Euro-Par 2013 Parallel Processing - 19th International Conference,
                  Aachen, Germany, August 26-30, 2013. Proceedings},
  pages        = {178--190},
  year         = {2013},
  crossref     = {DBLP:conf/europar/2013},
  url          = {https://doi.org/10.1007/978-3-642-40047-6\_20},
  doi          = {10.1007/978-3-642-40047-6\_20},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/europar/LoddeFA13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/hbu/RodriguezMHO13,
  author       = {Mario Rodr{\'{\i}}guez and
                  Carlos Medrano and
                  El{\'{\i}}as Herrero and
                  Carlos Orrite},
  title        = {Transfer Learning of Human Poses for Action Recognition},
  booktitle    = {Human Behavior Understanding - 4th International Workshop, {HBU} 2013,
                  Barcelona, Spain, October 22, 2013. Proceedings},
  pages        = {89--101},
  year         = {2013},
  crossref     = {DBLP:conf/hbu/2013},
  url          = {https://doi.org/10.1007/978-3-319-02714-2\_8},
  doi          = {10.1007/978-3-319-02714-2\_8},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/hbu/RodriguezMHO13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ica3pp/SoteloDVCPB13,
  author       = {German Sotelo and
                  Cesar O. Diaz and
                  Mario Villamizar and
                  Harold E. Castro and
                  Johnatan E. Pecero and
                  Pascal Bouvry},
  title        = {Building Platform as a Service for High Performance Computing over
                  an Opportunistic Cloud Computing},
  booktitle    = {Algorithms and Architectures for Parallel Processing - 13th International
                  Conference, {ICA3PP} 2013, Vietri sul Mare, Italy, December 18-20,
                  2013, Proceedings, Part {I}},
  pages        = {380--389},
  year         = {2013},
  crossref     = {DBLP:conf/ica3pp/2013-1},
  url          = {https://doi.org/10.1007/978-3-319-03859-9\_33},
  doi          = {10.1007/978-3-319-03859-9\_33},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ica3pp/SoteloDVCPB13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/KhouryVFVBFDKKCSGZCSBMPABSLGNBVVPMGPHRSABCM13,
  author       = {Elie Khoury and
                  Bostjan Vesnicer and
                  Javier Franco{-}Pedroso and
                  Ricardo P. V. Violato and
                  Z. Boulkcnafet and
                  L. M. Mazaira Fernandez and
                  Mireia D{\'{\i}}ez and
                  J. Kosmala and
                  Houssemeddine Khemiri and
                  T. Cipr and
                  Rahim Saeidi and
                  Manuel G{\"{u}}nther and
                  Jerneja Zganec{-}Gros and
                  Rub{\'{e}}n Zazo{-}Candil and
                  Fl{\'{a}}vio Olmos Sim{\~{o}}es and
                  Messaoud Bengherabi and
                  Agust{\'{\i}}n {\'{A}}lvarez Marquina and
                  Mikel Pe{\~{n}}agarikano and
                  Alberto Abad and
                  M. Boulayemen and
                  Petr Schwarz and
                  David A. van Leeuwen and
                  Javier Gonzalez{-}Dominguez and
                  M{\'{a}}rio Uliani Neto and
                  Elhocine Boutellaa and
                  Pedro G{\'{o}}mez Vilda and
                  Amparo Varona and
                  Dijana Petrovska{-}Delacr{\'{e}}taz and
                  Pavel Matejka and
                  Joaqu{\'{\i}}n Gonz{\'{a}}lez{-}Rodr{\'{\i}}guez and
                  Tiago Freitas Pereira and
                  Farid Harizi and
                  Luis Javier Rodr{\'{\i}}guez{-}Fuentes and
                  Laurent El Shafey and
                  Marcus A. Angeloni and
                  Germ{\'{a}}n Bordel and
                  G{\'{e}}rard Chollet and
                  S{\'{e}}bastien Marcel},
  title        = {The 2013 speaker recognition evaluation in mobile environment},
  booktitle    = {International Conference on Biometrics, {ICB} 2013, 4-7 June, 2013,
                  Madrid, Spain},
  pages        = {1--8},
  year         = {2013},
  crossref     = {DBLP:conf/icb/2013},
  url          = {https://doi.org/10.1109/ICB.2013.6613025},
  doi          = {10.1109/ICB.2013.6613025},
  timestamp    = {Thu, 01 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/KhouryVFVBFDKKCSGZCSBMPABSLGNBVVPMGPHRSABCM13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoc/PeceroDCVSB13,
  author       = {Johnatan E. Pecero and
                  Cesar O. Diaz and
                  Harold E. Castro and
                  Mario Villamizar and
                  German Sotelo and
                  Pascal Bouvry},
  title        = {Energy Savings on a Cloud-Based Opportunistic Infrastructure},
  booktitle    = {Service-Oriented Computing - {ICSOC} 2013 Workshops - CCSA, CSB, PASCEB,
                  SWESE, WESOA, and PhD Symposium, Berlin, Germany, December 2-5, 2013.
                  Revised Selected Papers},
  pages        = {366--378},
  year         = {2013},
  crossref     = {DBLP:conf/icsoc/2013w},
  url          = {https://doi.org/10.1007/978-3-319-06859-6\_32},
  doi          = {10.1007/978-3-319-06859-6\_32},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icsoc/PeceroDCVSB13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip8-1/FlorezSV13,
  author       = {Hector Florez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Embracing Imperfection in Enterprise Architecture Models},
  booktitle    = {Short Paper Proceedings of the 6th {IFIP} {WG} 8.1 Working Conference
                  on the Practice of Enterprise Modeling (PoEM 2013), Riga, Latvia,
                  November 6-7, 2013},
  pages        = {8--17},
  year         = {2013},
  crossref     = {DBLP:conf/ifip8-1/2013s},
  url          = {https://ceur-ws.org/Vol-1023/paper1.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:22:10 +0100},
  biburl       = {https://dblp.org/rec/conf/ifip8-1/FlorezSV13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip8-1/NaranjoSV13,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Connecting the Dots: Examining Visualization Techniques for Enterprise
                  Architecture Model Analysis},
  booktitle    = {Short Paper Proceedings of the 6th {IFIP} {WG} 8.1 Working Conference
                  on the Practice of Enterprise Modeling (PoEM 2013), Riga, Latvia,
                  November 6-7, 2013},
  pages        = {29--38},
  year         = {2013},
  crossref     = {DBLP:conf/ifip8-1/2013s},
  url          = {https://ceur-ws.org/Vol-1023/paper3.pdf},
  timestamp    = {Fri, 10 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ifip8-1/NaranjoSV13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isami/SanchezSO13,
  author       = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
                  Daniel D{\'{\i}}az S{\'{a}}nchez and
                  Mario Mu{\~{n}}oz Organero},
  title        = {Optimizing OSGi Services on Gateways},
  booktitle    = {Ambient Intelligence - Software and Applications - 4th International
                  Symposium on Ambient Intelligence, ISAmI 2013, Salamanca, Spain, May
                  22-24, 2013},
  pages        = {155--162},
  year         = {2013},
  crossref     = {DBLP:conf/isami/2013},
  url          = {https://doi.org/10.1007/978-3-319-00566-9\_20},
  doi          = {10.1007/978-3-319-00566-9\_20},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/isami/SanchezSO13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/lion/Hidalgo-BermudezRMGGF13,
  author       = {R. M. Hidalgo{-}Berm{\'{u}}dez and
                  M. S. Rodr{\'{\i}}guez{-}Domingo and
                  Antonio Miguel Mora and
                  Pablo Garc{\'{\i}}a{-}S{\'{a}}nchez and
                  Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Antonio Jos{\'{e}} Fern{\'{a}}ndez Leiva},
  title        = {Evolutionary FSM-Based Agents for Playing Super Mario Game},
  booktitle    = {Learning and Intelligent Optimization - 7th International Conference,
                  {LION} 7, Catania, Italy, January 7-11, 2013, Revised Selected Papers},
  pages        = {357--363},
  year         = {2013},
  crossref     = {DBLP:conf/lion/2013},
  url          = {https://doi.org/10.1007/978-3-642-44973-4\_39},
  doi          = {10.1007/978-3-642-44973-4\_39},
  timestamp    = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/lion/Hidalgo-BermudezRMGGF13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nsdi/SanchezOBCBKW13,
  author       = {Mario A. S{\'{a}}nchez and
                  John S. Otto and
                  Zachary S. Bischof and
                  David R. Choffnes and
                  Fabi{\'{a}}n E. Bustamante and
                  Balachander Krishnamurthy and
                  Walter Willinger},
  title        = {Dasu: Pushing Experiments to the Internet's Edge},
  booktitle    = {Proceedings of the 10th {USENIX} Symposium on Networked Systems Design
                  and Implementation, {NSDI} 2013, Lombard, IL, USA, April 2-5, 2013},
  pages        = {487--499},
  year         = {2013},
  crossref     = {DBLP:conf/nsdi/2013},
  url          = {https://www.usenix.org/conference/nsdi13/technical-sessions/presentation/sanchez},
  timestamp    = {Tue, 02 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nsdi/SanchezOBCBKW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pam/SanchezOBB13,
  author       = {Mario A. S{\'{a}}nchez and
                  John S. Otto and
                  Zachary S. Bischof and
                  Fabi{\'{a}}n E. Bustamante},
  title        = {Trying Broadband Characterization at Home},
  booktitle    = {Passive and Active Measurement - 14th International Conference, {PAM}
                  2013, Hong Kong, China, March 18-19, 2013. Proceedings},
  pages        = {198--207},
  year         = {2013},
  crossref     = {DBLP:conf/pam/2013},
  url          = {https://doi.org/10.1007/978-3-642-36516-4\_20},
  doi          = {10.1007/978-3-642-36516-4\_20},
  timestamp    = {Tue, 14 May 2019 10:00:52 +0200},
  biburl       = {https://dblp.org/rec/conf/pam/SanchezOBB13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcsc/Ornelas-TellezGSA13,
  author       = {Fernando Ornelas{-}Tellez and
                  Mario Graff and
                  Edgar N. S{\'{a}}nchez and
                  Alma Y. Alanis},
  title        = {{PSO} Optimal Tracking Control for State-Dependent Coefficient Nonlinear
                  Systems},
  booktitle    = {Advance Trends in Soft Computing - Proceedings of {WCSC} 2013, December
                  16-18, San Antonio, Texas, {USA}},
  pages        = {403--410},
  year         = {2013},
  crossref     = {DBLP:conf/wcsc/2013},
  url          = {https://doi.org/10.1007/978-3-319-03674-8\_38},
  doi          = {10.1007/978-3-319-03674-8\_38},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wcsc/Ornelas-TellezGSA13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/AartsenA13,
  author       = {Mark G. Aartsen and
                  Rasha U. Abbasi and
                  Markus Ackermann and
                  Jenni Adams and
                  Juan Antonio Aguilar S{\'{a}}nchez and
                  Markus Ahlers and
                  David Altmann and
                  Carlos A. Arg{\"{u}}elles Delgado and
                  Jan Auffenberg and
                  Xinhua Bai and
                  Michael F. Baker and
                  Steven W. Barwick and
                  Volker Baum and
                  Ryan Bay and
                  James J. Beatty and
                  Julia K. Becker Tjus and
                  Karl{-}Heinz Becker and
                  Segev BenZvi and
                  Patrick Berghaus and
                  David Berley and
                  Elisa Bernardini and
                  Anna Bernhard and
                  David Z. Besson and
                  G. Binder and
                  Daniel Bindig and
                  Martin Bissok and
                  Erik Blaufuss and
                  Jan Blumenthal and
                  David J. Boersma and
                  Christian Bohm and
                  Debanjan Bose and
                  Sebastian B{\"{o}}ser and
                  Olga Botner and
                  Lionel Brayeur and
                  Hans{-}Peter Bretz and
                  Anthony M. Brown and
                  Ronald Bruijn and
                  James Casey and
                  Martin Casier and
                  Dmitry Chirkin and
                  Asen Christov and
                  Brian John Christy and
                  Ken Clark and
                  Lew Classen and
                  Fabian Clevermann and
                  Stefan Coenders and
                  Shirit Cohen and
                  Doug F. Cowen and
                  Angel H. Cruz Silva and
                  Matthias Danninger and
                  Jacob Daughhetee and
                  James C. Davis and
                  Melanie Day and
                  Catherine De Clercq and
                  Sam De Ridder and
                  Paolo Desiati and
                  Krijn D. de Vries and
                  Meike de With and
                  Tyce DeYoung and
                  Juan Carlos D{\'{\i}}az{-}V{\'{e}}lez and
                  Matthew Dunkman and
                  Ryan Eagan and
                  Benjamin Eberhardt and
                  Bj{\"{o}}rn Eichmann and
                  Jonathan Eisch and
                  Sebastian Euler and
                  Paul A. Evenson and
                  Oladipo O. Fadiran and
                  Ali R. Fazely and
                  Anatoli Fedynitch and
                  Jacob Feintzeig and
                  Tom Feusels and
                  Kirill Filimonov and
                  Chad Finley and
                  Tobias Fischer{-}Wasels and
                  Samuel Flis and
                  Anna Franckowiak and
                  Katharina Frantzen and
                  Tomasz Fuchs and
                  Thomas K. Gaisser and
                  Joseph S. Gallagher and
                  Lisa Marie Gerhardt and
                  Laura E. Gladstone and
                  Thorsten Gl{\"{u}}senkamp and
                  Azriel Goldschmidt and
                  Geraldina Golup and
                  Javier G. Gonz{\'{a}}lez and
                  Jordan A. Goodman and
                  Dariusz G{\'{o}}ra and
                  Dylan T. Grandmont and
                  Darren Grant and
                  Pavel Gretskov and
                  John C. Groh and
                  Andreas Gro{\ss} and
                  Chang Hyon Ha and
                  Abd Al Karim Haj Ismail and
                  Patrick Hallen and
                  Allan Hallgren and
                  Francis Halzen and
                  Kael D. Hanson and
                  Dustin Hebecker and
                  David Heereman and
                  Dirk Heinen and
                  Klaus Helbing and
                  Robert Eugene Hellauer III and
                  Stephanie Virginia Hickford and
                  Gary C. Hill and
                  Kara D. Hoffman and
                  Ruth Hoffmann and
                  Andreas Homeier and
                  Kotoyo Hoshina and
                  Feifei Huang and
                  Warren Huelsnitz and
                  Per Olof Hulth and
                  Klas Hultqvist and
                  Shahid Hussain and
                  Aya Ishihara and
                  Emanuel Jacobi and
                  John E. Jacobsen and
                  Kai Jagielski and
                  George S. Japaridze and
                  Kyle Jero and
                  Ola Jlelati and
                  Basho Kaminsky and
                  Alexander Kappes and
                  Timo Karg and
                  Albrecht Karle and
                  Matthew Kauer and
                  John Lawrence Kelley and
                  Joanna Kiryluk and
                  J. Kl{\"{a}}s and
                  Spencer R. Klein and
                  Jan{-}Hendrik K{\"{o}}hne and
                  Georges Kohnen and
                  Hermann Kolanoski and
                  Lutz K{\"{o}}pke and
                  Claudio Kopper and
                  Sandro Kopper and
                  D. Jason Koskinen and
                  Marek Kowalski and
                  Mark Krasberg and
                  Anna Kriesten and
                  Kai Michael Krings and
                  G{\"{o}}sta Kroll and
                  Jan Kunnen and
                  Naoko Kurahashi and
                  Takao Kuwabara and
                  Mathieu L. M. Labare and
                  Hagar Landsman and
                  Michael James Larson and
                  Mariola Lesiak{-}Bzdak and
                  Martin Leuermann and
                  Julia Leute and
                  Jan L{\"{u}}nemann and
                  Oscar A. Mac{\'{\i}}as{-}Ram{\'{\i}}rez and
                  James Madsen and
                  Giuliano Maggi and
                  Reina Maruyama and
                  Keiichi Mase and
                  Howard S. Matis and
                  Frank McNally and
                  Kevin James Meagher and
                  Martin Merck and
                  Gonzalo Merino Ar{\'{e}}valo and
                  Thomas Meures and
                  Sandra Miarecki and
                  Eike Middell and
                  Natalie Milke and
                  John Lester Miller and
                  Lars Mohrmann and
                  Teresa Montaruli and
                  Robert M. Morse and
                  Rolf Nahnhauer and
                  Uwe Naumann and
                  Hans Niederhausen and
                  Sarah C. Nowicki and
                  David R. Nygren and
                  Anna Obertacke and
                  Sirin Odrowski and
                  Alex Olivas and
                  Ahmad Omairat and
                  Aongus Starbuck {\'{O}} Murchadha and
                  Larissa Paul and
                  Joshua A. Pepper and
                  Carlos P{\'{e}}rez de los Heros and
                  Carl Pfendner and
                  Damian Pieloth and
                  Elisa Pinat and
                  Jonas Posselt and
                  P. Buford Price and
                  Gerald T. Przybylski and
                  Melissa Quinnan and
                  Leif R{\"{a}}del and
                  Ian Rae and
                  Mohamed Rameez and
                  Katherine Rawlins and
                  Peter Christian Redl and
                  Ren{\'{e}} Reimann and
                  Elisa Resconi and
                  Wolfgang Rhode and
                  Mathieu Ribordy and
                  Michael Richman and
                  Benedikt Riedel and
                  J. P. Rodrigues and
                  Carsten Rott and
                  Tim Ruhe and
                  Bakhtiyar Ruzybayev and
                  Dirk Ryckbosch and
                  Sabine M. Saba and
                  Heinz{-}Georg Sander and
                  Juan Marcos Santander and
                  Subir Sarkar and
                  Kai Schatto and
                  Florian Scheriau and
                  Torsten Schmidt and
                  Martin Schmitz and
                  Sebastian Schoenen and
                  Sebastian Sch{\"{o}}neberg and
                  Arne Sch{\"{o}}nwald and
                  Anne Schukraft and
                  Lukas Schulte and
                  David Schultz and
                  Olaf Schulz and
                  David Seckel and
                  Yolanda Sestayo de la Cerra and
                  Surujhdeo Seunarine and
                  Rezo Shanidze and
                  Chris Sheremata and
                  Miles W. E. Smith and
                  Dennis Soldin and
                  Glenn M. Spiczak and
                  Christian Spiering and
                  Michael Stamatikos and
                  Todor Stanev and
                  Nick A. Stanisha and
                  Alexander Stasik and
                  Thorsten Stezelberger and
                  Robert G. Stokstad and
                  Achim St{\"{o}}{\ss}l and
                  Erik A. Strahler and
                  Rickard Str{\"{o}}m and
                  Nora Linn Strotjohann and
                  Gregory W. Sullivan and
                  Henric Taavola and
                  Ignacio J. Taboada and
                  Alessio Tamburro and
                  Andreas Tepe and
                  Samvel Ter{-}Antonyan and
                  Gordana Tesic and
                  Serap Tilav and
                  Patrick A. Toale and
                  Moriah Natasha Tobin and
                  Simona Toscano and
                  Maria Tselengidou and
                  Elisabeth Unger and
                  Marcel Usner and
                  Sofia Vallecorsa and
                  Nick van Eijndhoven and
                  Arne Van Overloop and
                  Jakob van Santen and
                  Markus Vehring and
                  Markus Voge and
                  Matthias Vraeghe and
                  Christian Walck and
                  Tilo Waldenmaier and
                  Marius Wallraff and
                  Christopher N. Weaver and
                  Mark T. Wellons and
                  Christopher H. Wendt and
                  Stefan Westerhoff and
                  Nathan Whitehorn and
                  Klaus Wiebe and
                  Christopher Wiebusch and
                  Dawn R. Williams and
                  Henrike Wissing and
                  Martin Wolf and
                  Terri R. Wood and
                  Kurt Woschnagg and
                  Donglian Xu and
                  Xianwu Xu and
                  Juan Pablo Y{\'{a}}{\~{n}}ez Garza and
                  Gaurang B. Yodh and
                  Shigeru Yoshida and
                  Pavel Zarzhitsky and
                  Jan Ziemann and
                  Simon Zierke and
                  Marcel Zoll},
  title        = {The IceProd Framework: Distributed Data Processing for the IceCube
                  Neutrino Observatory},
  journal      = {CoRR},
  volume       = {abs/1311.5904},
  year         = {2013},
  url          = {http://arxiv.org/abs/1311.5904},
  eprinttype    = {arXiv},
  eprint       = {1311.5904},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/AartsenA13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aeog/Rodriguez-GalianoPSCC12,
  author       = {Victor F. Rodriguez{-}Galiano and
                  Eulogio Pardo{-}Ig{\'{u}}zquiza and
                  Manuel Sanchez{-}Castillo and
                  Mario Chica{-}Olmo and
                  Mario Chica{-}Rivas},
  title        = {Downscaling Landsat 7 {ETM+} thermal imagery using land surface temperature
                  and {NDVI} images},
  journal      = {Int. J. Appl. Earth Obs. Geoinformation},
  volume       = {18},
  pages        = {515--527},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.jag.2011.10.002},
  doi          = {10.1016/J.JAG.2011.10.002},
  timestamp    = {Tue, 30 Jul 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/aeog/Rodriguez-GalianoPSCC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijbpim/SanchezPV12,
  author       = {Mario E. S{\'{a}}nchez and
                  Diana Puentes and
                  Jorge Villalobos},
  title        = {Building a modular {YAWL} engine with Cumbia},
  journal      = {Int. J. Bus. Process. Integr. Manag.},
  volume       = {6},
  number       = {1},
  pages        = {41--51},
  year         = {2012},
  url          = {https://doi.org/10.1504/IJBPIM.2012.047912},
  doi          = {10.1504/IJBPIM.2012.047912},
  timestamp    = {Sun, 17 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijbpim/SanchezPV12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijsita/DonateGC12,
  author       = {Mario Javier Donate and
                  F{\'{a}}tima Guadamillas and
                  Jes{\'{u}}s David S{\'{a}}nchez de Pablo Gonz{\'{a}}lez del Campo},
  title        = {Knowledge Management for Strategic Alliances: {A} Case Study},
  journal      = {Int. J. Strateg. Inf. Technol. Appl.},
  volume       = {3},
  number       = {3},
  pages        = {1--19},
  year         = {2012},
  url          = {https://doi.org/10.4018/jsita.2012070101},
  doi          = {10.4018/JSITA.2012070101},
  timestamp    = {Fri, 03 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijsita/DonateGC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jei/Sanchez-CruzR12,
  author       = {Hermilo S{\'{a}}nchez{-}Cruz and
                  Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az},
  title        = {Binary document image compression using a three-symbol grouped code
                  dictionary},
  journal      = {J. Electronic Imaging},
  volume       = {21},
  number       = {2},
  pages        = {023013},
  year         = {2012},
  url          = {https://doi.org/10.1117/1.JEI.21.2.023013},
  doi          = {10.1117/1.JEI.21.2.023013},
  timestamp    = {Fri, 02 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jei/Sanchez-CruzR12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/DiezPAMDBLHL12,
  author       = {Isabel de la Torre D{\'{\i}}ez and
                  Francisco Javier D{\'{\i}}az Pernas and
                  M{\'{\i}}riam Ant{\'{o}}n{-}Rodr{\'{\i}}guez and
                  Mario Mart{\'{\i}}nez{-}Zarzuela and
                  Jos{\'{e}} Fernando D{\'{\i}}ez Higuera and
                  Daniel Boto{-}Giralda and
                  Miguel Maldonado L{\'{o}}pez and
                  Roberto Hornero and
                  Mar{\'{\i}}a Isabel L{\'{o}}pez},
  title        = {Performance Evaluation of a Web-Based System to Exchange Electronic
                  Health Records Using Queueing Model {(M/M/1)}},
  journal      = {J. Medical Syst.},
  volume       = {36},
  number       = {2},
  pages        = {915--924},
  year         = {2012},
  url          = {https://doi.org/10.1007/s10916-010-9555-3},
  doi          = {10.1007/S10916-010-9555-3},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jms/DiezPAMDBLHL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pnc/PuypeMCSPMD12,
  author       = {Bart Puype and
                  Eva Mar{\'{\i}}n{-}Tordera and
                  Didier Colle and
                  Sergio S{\'{a}}nchez{-}L{\'{o}}pez and
                  Mario Pickavet and
                  Xavier Masip{-}Bruin and
                  Piet Demeester},
  title        = {Prediction-based routing as {RWA} in multilayer traffic engineering},
  journal      = {Photonic Netw. Commun.},
  volume       = {23},
  number       = {2},
  pages        = {172--182},
  year         = {2012},
  url          = {https://doi.org/10.1007/s11107-011-0348-5},
  doi          = {10.1007/S11107-011-0348-5},
  timestamp    = {Tue, 29 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pnc/PuypeMCSPMD12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/Anton-CanalisHS12,
  author       = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
                  Mario Hern{\'{a}}ndez{-}Tejera and
                  Elena S{\'{a}}nchez{-}Nielsen},
  title        = {Distance maps from unthresholded magnitudes},
  journal      = {Pattern Recognit.},
  volume       = {45},
  number       = {9},
  pages        = {3125--3130},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.patcog.2012.02.010},
  doi          = {10.1016/J.PATCOG.2012.02.010},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/Anton-CanalisHS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/ManzurSSV12,
  author       = {Laura Manzur and
                  John Santa and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Experimentation in Executable Enterprise Architecture Models},
  booktitle    = {Advanced Information Systems Engineering Workshops - CAiSE 2012 International
                  Workshops, Gda{\'{n}}sk, Poland, June 25-26, 2012. Proceedings},
  pages        = {455--469},
  year         = {2012},
  crossref     = {DBLP:conf/caise/2012w},
  url          = {https://doi.org/10.1007/978-3-642-31069-0\_36},
  doi          = {10.1007/978-3-642-31069-0\_36},
  timestamp    = {Sun, 23 Dec 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/caise/ManzurSSV12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cescit/FernandezPSMSP12,
  author       = {J. Javier Fernandez and
                  Mario Prats and
                  Juan Carlos Garc{\'{\i}}a S{\'{a}}nchez and
                  Ra{\'{u}}l Mar{\'{\i}}n and
                  Pedro J. Sanz and
                  Antonio Pe{\~{n}}alver Benavent},
  title        = {Manipulation in the Seabed: {A} New Underwater Manipulation System
                  for Shallow Water Intervention},
  booktitle    = {1st Conference on Embedded Systems, Computational Intelligence and
                  Telematics in Control, {CESCIT} 2012, W{\"{u}}rzburg, Germany,
                  April 03-05, 2012},
  pages        = {314--319},
  year         = {2012},
  crossref     = {DBLP:conf/cescit/2012},
  url          = {https://doi.org/10.3182/20120403-3-DE-3010.00029},
  doi          = {10.3182/20120403-3-DE-3010.00029},
  timestamp    = {Fri, 24 Jul 2020 14:08:14 +0200},
  biburl       = {https://dblp.org/rec/conf/cescit/FernandezPSMSP12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cgames/SalazarMOS12,
  author       = {Mario Gonzalez Salazar and
                  Hugo A. Mitre{-}Hern{\'{a}}ndez and
                  Cuauht{\'{e}}moc Lemus Olalde and
                  Jos{\'{e}} Luis Gonz{\'{a}}lez S{\'{a}}nchez},
  title        = {Proposal of Game Design Document from software engineering requirements
                  perspective},
  booktitle    = {17th International Conference on Computer Games, {CGAMES} 2012, Louisville,
                  KY, USA, July 30 - Aug. 1, 2012},
  pages        = {81--85},
  year         = {2012},
  crossref     = {DBLP:conf/cgames/2012},
  url          = {https://doi.org/10.1109/CGames.2012.6314556},
  doi          = {10.1109/CGAMES.2012.6314556},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cgames/SalazarMOS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Trujillo-CaballeroPSMST12,
  author       = {Mario Arturo Trujillo{-}Caballero and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Oscar Osvaldo Sandoval{-}Gonzalez and
                  Albino Mart{\'{\i}}nez{-}Sibaja and
                  Blanca E. Gonz{\'{a}}lez S{\'{a}}nchez and
                  Juan Carlos Trujillo{-}Caballero},
  title        = {A remote monitoring system for a mechanotherapy device in neuromuscular
                  rehabilitation},
  booktitle    = {22nd International Conference on Electrical Communications and Computers,
                  {CONIELECOMP} 2012, Cholula, Puebla, Mexico, February 27-29, 2012},
  pages        = {55--58},
  year         = {2012},
  crossref     = {DBLP:conf/conielecomp/2012},
  url          = {https://doi.org/10.1109/CONIELECOMP.2012.6189881},
  doi          = {10.1109/CONIELECOMP.2012.6189881},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/conielecomp/Trujillo-CaballeroPSMST12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/edoc/NaranjoSV12,
  author       = {David Naranjo and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Visual Analysis of Enterprise Models},
  booktitle    = {16th {IEEE} International Enterprise Distributed Object Computing
                  Conference Workshops, {EDOC} Workshops, Beijing, China, September
                  10-14, 2012},
  pages        = {19--28},
  year         = {2012},
  crossref     = {DBLP:conf/edoc/2012w},
  url          = {https://doi.org/10.1109/EDOCW.2012.13},
  doi          = {10.1109/EDOCW.2012.13},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/edoc/NaranjoSV12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/GomezMPP0H12,
  author       = {Carlos G{\'{o}}mez and
                  Mario Mart{\'{\i}}nez{-}Zarzuela and
                  Jes{\'{u}}s Poza and
                  Francisco Javier D{\'{\i}}az Pernas and
                  Alberto Fern{\'{a}}ndez and
                  Roberto Hornero},
  title        = {Synchrony analysis of spontaneous {MEG} activity in Alzheimer's disease
                  patients},
  booktitle    = {Annual International Conference of the {IEEE} Engineering in Medicine
                  and Biology Society, {EMBC} 2012, San Diego, CA, USA, August 28 -
                  September 1, 2012},
  pages        = {6188--6191},
  year         = {2012},
  crossref     = {DBLP:conf/embc/2012},
  url          = {https://doi.org/10.1109/EMBC.2012.6347407},
  doi          = {10.1109/EMBC.2012.6347407},
  timestamp    = {Sat, 04 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/embc/GomezMPP0H12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/europar/LoddeFA12,
  author       = {Mario Lodde and
                  Jos{\'{e}} Flich and
                  Manuel E. Acacio},
  title        = {Dynamic Last-Level Cache Allocation to Reduce Area and Power Overhead
                  in Directory Coherence Protocols},
  booktitle    = {Euro-Par 2012 Parallel Processing - 18th International Conference,
                  Euro-Par 2012, Rhodes Island, Greece, August 27-31, 2012. Proceedings},
  pages        = {206--218},
  year         = {2012},
  crossref     = {DBLP:conf/europar/2012},
  url          = {https://doi.org/10.1007/978-3-642-32820-6\_22},
  doi          = {10.1007/978-3-642-32820-6\_22},
  timestamp    = {Mon, 18 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/europar/LoddeFA12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icce-berlin/SanchezSO12,
  author       = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
                  Daniel D{\'{\i}}az S{\'{a}}nchez and
                  Mario Mu{\~{n}}oz Organero},
  title        = {Flex-box: {A} flexible software architecture for {IPTV} set-top boxes},
  booktitle    = {{IEEE} Second International Conference on Consumer Electronics - Berlin,
                  ICCE-Berlin 2012, Berlin, Germany, September 3-5, 2012},
  pages        = {121--125},
  year         = {2012},
  crossref     = {DBLP:conf/icce-berlin/2012},
  url          = {https://doi.org/10.1109/ICCE-Berlin.2012.6336480},
  doi          = {10.1109/ICCE-BERLIN.2012.6336480},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icce-berlin/SanchezSO12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccel/SanchezSO12,
  author       = {Iv{\'{a}}n Bernab{\'{e}} S{\'{a}}nchez and
                  Daniel D{\'{\i}}az S{\'{a}}nchez and
                  Mario Mu{\~{n}}oz Organero},
  title        = {Optimizing resources on gateways using OSGi},
  booktitle    = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012,
                  Las Vegas, NV, USA, January 13-16, 2012},
  pages        = {526--527},
  year         = {2012},
  crossref     = {DBLP:conf/iccel/2012},
  url          = {https://doi.org/10.1109/ICCE.2012.6161957},
  doi          = {10.1109/ICCE.2012.6161957},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccel/SanchezSO12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/Sanchez-EscobedoC12,
  author       = {Dalila S{\'{a}}nchez{-}Escobedo and
                  Mario Castel{\'{a}}n},
  title        = {Face synthesis from a frontal pose image using partial least squares
                  and b-splines},
  booktitle    = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012,
                  Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012},
  pages        = {1801--1804},
  year         = {2012},
  crossref     = {DBLP:conf/icip/2012},
  url          = {https://doi.org/10.1109/ICIP.2012.6467231},
  doi          = {10.1109/ICIP.2012.6467231},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/Sanchez-EscobedoC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iecon/RizoRRBL12,
  author       = {Mario Rizo and
                  Ana Rodr{\'{\i}}guez and
                  Francisco J. Rodr{\'{\i}}guez and
                  Emilio Bueno and
                  Marco Liserre},
  title        = {Different approaches of stationary reference frames saturators},
  booktitle    = {38th Annual Conference on {IEEE} Industrial Electronics Society, {IECON}
                  2012, Montreal, QC, Canada, October 25-28, 2012},
  pages        = {2245--2250},
  year         = {2012},
  crossref     = {DBLP:conf/iecon/2012},
  url          = {https://doi.org/10.1109/IECON.2012.6388887},
  doi          = {10.1109/IECON.2012.6388887},
  timestamp    = {Mon, 09 Aug 2021 14:54:01 +0200},
  biburl       = {https://dblp.org/rec/conf/iecon/RizoRRBL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ieeehpcs/PeceroHBPLB12,
  author       = {Johnatan E. Pecero and
                  H{\'{e}}ctor Joaqu{\'{\i}}n {Fraire Huacuja} and
                  Pascal Bouvry and
                  Alejandro {Santiago Pineda} and
                  Mario C{\'{e}}sar L{\'{o}}pez Loc{\'{e}}s and
                  Juan Javier Gonz{\'{a}}lez Barbosa},
  title        = {On the energy optimization for precedence constrained applications
                  using local search algorithms},
  booktitle    = {2012 International Conference on High Performance Computing {\&}
                  Simulation, {HPCS} 2012, Madrid, Spain, July 2-6, 2012},
  pages        = {133--139},
  year         = {2012},
  crossref     = {DBLP:conf/ieeehpcs/2012},
  url          = {https://doi.org/10.1109/HPCSim.2012.6266902},
  doi          = {10.1109/HPCSIM.2012.6266902},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ieeehpcs/PeceroHBPLB12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/igarss/RankineSSV12,
  author       = {Cassidy Rankine and
                  G. Arturo Sanchez{-}Azofeifa and
                  Mario Marcos do Espirito Santo and
                  Marco Tulio S. Viera},
  title        = {Optical wireless sensor networks observe leaf phenology and photosynthetic
                  radiation interception in a Brazilian tropical dry forest},
  booktitle    = {2012 {IEEE} International Geoscience and Remote Sensing Symposium,
                  {IGARSS} 2012, Munich, Germany, July 22-27, 2012},
  pages        = {6914--6915},
  year         = {2012},
  crossref     = {DBLP:conf/igarss/2012},
  url          = {https://doi.org/10.1109/IGARSS.2012.6352573},
  doi          = {10.1109/IGARSS.2012.6352573},
  timestamp    = {Wed, 16 Oct 2019 14:14:53 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/RankineSSV12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/imc/OttoSRB12,
  author       = {John S. Otto and
                  Mario A. S{\'{a}}nchez and
                  John P. Rula and
                  Fabi{\'{a}}n E. Bustamante},
  title        = {Content delivery and the natural evolution of {DNS:} remote dns trends,
                  performance issues and alternative solutions},
  booktitle    = {Proceedings of the 12th {ACM} {SIGCOMM} Internet Measurement Conference,
                  {IMC} '12, Boston, MA, USA, November 14-16, 2012},
  pages        = {523--536},
  year         = {2012},
  crossref     = {DBLP:conf/imc/2012},
  url          = {https://doi.org/10.1145/2398776.2398831},
  doi          = {10.1145/2398776.2398831},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/imc/OttoSRB12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iolts/Sanchez-ClementeEGL12,
  author       = {Antonio Sanchez{-}Clemente and
                  Luis Entrena and
                  Mario Garc{\'{\i}}a{-}Valderas and
                  Celia L{\'{o}}pez{-}Ongil},
  title        = {Logic masking for {SET} Mitigation Using Approximate Logic Circuits},
  booktitle    = {18th {IEEE} International On-Line Testing Symposium, {IOLTS} 2012,
                  Sitges, Spain, June 27-29, 2012},
  pages        = {176--181},
  year         = {2012},
  crossref     = {DBLP:conf/iolts/2012},
  url          = {https://doi.org/10.1109/IOLTS.2012.6313868},
  doi          = {10.1109/IOLTS.2012.6313868},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iolts/Sanchez-ClementeEGL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/its/KarlovcecCP12,
  author       = {Mario Karlovcec and
                  Mariheida Cordova{-}Sanchez and
                  Zachary A. Pardos},
  title        = {Knowledge Component Suggestion for Untagged Content in an Intelligent
                  Tutoring System},
  booktitle    = {Intelligent Tutoring Systems - 11th International Conference, {ITS}
                  2012, Chania, Crete, Greece, June 14-18, 2012. Proceedings},
  pages        = {195--200},
  year         = {2012},
  crossref     = {DBLP:conf/its/2012},
  url          = {https://doi.org/10.1007/978-3-642-30950-2\_25},
  doi          = {10.1007/978-3-642-30950-2\_25},
  timestamp    = {Sun, 02 Oct 2022 16:10:26 +0200},
  biburl       = {https://dblp.org/rec/conf/its/KarlovcecCP12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/models/FlorezSVV12,
  author       = {Hector Florez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos and
                  Germ{\'{a}}n Vega},
  title        = {Coevolution assistance for enterprise architecture models},
  booktitle    = {Proceedings of the 6th International Workshop on Models and Evolution,
                  ME@MoDELS 2012, Innsbruck, Austria, October 1-5, 2012},
  pages        = {27--32},
  year         = {2012},
  crossref     = {DBLP:conf/models/2012me},
  url          = {https://doi.org/10.1145/2523599.2523605},
  doi          = {10.1145/2523599.2523605},
  timestamp    = {Tue, 06 Nov 2018 16:57:17 +0100},
  biburl       = {https://dblp.org/rec/conf/models/FlorezSVV12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/models/GomezSFV12,
  author       = {Paola G{\'{o}}mez and
                  Mario E. S{\'{a}}nchez and
                  Hector Florez and
                  Jorge Villalobos},
  title        = {Co-creation of models and metamodels for enterprise architecture projects},
  booktitle    = {Proceedings of the 2012 Extreme Modeling Workshop, {XM} '12, Innsbruck,
                  Austria, October 1, 2012},
  pages        = {21--26},
  year         = {2012},
  crossref     = {DBLP:conf/models/2012xm},
  url          = {https://doi.org/10.1145/2467307.2467312},
  doi          = {10.1145/2467307.2467312},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/models/GomezSFV12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nocs/LoddeFA12,
  author       = {Mario Lodde and
                  Jos{\'{e}} Flich and
                  Manuel E. Acacio},
  title        = {Heterogeneous NoC Design for Efficient Broadcast-based Coherence Protocol
                  Support},
  booktitle    = {2012 Sixth {IEEE/ACM} International Symposium on Networks-on-Chip
                  (NoCS), Copenhagen, Denmark, 9-11 May, 2012},
  pages        = {59--66},
  year         = {2012},
  crossref     = {DBLP:conf/nocs/2012},
  url          = {https://doi.org/10.1109/NOCS.2012.14},
  doi          = {10.1109/NOCS.2012.14},
  timestamp    = {Mon, 18 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nocs/LoddeFA12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/OttoSRSB12,
  author       = {John S. Otto and
                  Mario A. S{\'{a}}nchez and
                  John P. Rula and
                  Ted Stein and
                  Fabi{\'{a}}n E. Bustamante},
  title        = {namehelp: intelligent client-side {DNS} resolution},
  booktitle    = {{ACM} {SIGCOMM} 2012 Conference, {SIGCOMM} '12, Helsinki, Finland
                  - August 13 - 17, 2012},
  pages        = {287--288},
  year         = {2012},
  crossref     = {DBLP:conf/sigcomm/2012},
  url          = {https://doi.org/10.1145/2342356.2342413},
  doi          = {10.1145/2342356.2342413},
  timestamp    = {Mon, 22 Mar 2021 16:55:03 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcomm/OttoSRSB12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cys/SanchezJV11,
  author       = {Mario E. S{\'{a}}nchez and
                  Camilo Jim{\'{e}}nez and
                  Jorge Villalobos},
  title        = {Model Based Testing for Workflow Enabled Applications},
  journal      = {Computaci{\'{o}}n y Sistemas},
  volume       = {14},
  number       = {4},
  year         = {2011},
  url          = {http://cys.cic.ipn.mx/ojs/index.php/CyS/article/view/1280},
  timestamp    = {Thu, 11 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cys/SanchezJV11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/GonzalezDS11,
  author       = {Mario Gonz{\'{a}}lez and
                  David Dominguez and
                  {\'{A}}ngel S{\'{a}}nchez},
  title        = {Learning sequences of sparse correlated patterns using small-world
                  attractor neural networks: An application to traffic videos},
  journal      = {Neurocomputing},
  volume       = {74},
  number       = {14-15},
  pages        = {2361--2367},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.neucom.2011.03.014},
  doi          = {10.1016/J.NEUCOM.2011.03.014},
  timestamp    = {Sat, 01 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/GonzalezDS11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jvcir/Sanchez-NielsenH11,
  author       = {Elena S{\'{a}}nchez{-}Nielsen and
                  Mario Hern{\'{a}}ndez{-}Tejera},
  title        = {Heuristic algorithm for visual tracking of deformable objects},
  journal      = {J. Vis. Commun. Image Represent.},
  volume       = {22},
  number       = {6},
  pages        = {465--478},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.jvcir.2011.05.005},
  doi          = {10.1016/J.JVCIR.2011.05.005},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jvcir/Sanchez-NielsenH11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/CavalieriFFPGS11,
  author       = {Daniel Cruz Cavalieri and
                  Teodiano Freire Bastos{-}Filho and
                  M{\'{a}}rio Sarcinelli Filho and
                  Sira E. Palazuelos{-}Cagigas and
                  Javier Mac{\'{\i}}as Guarasa and
                  Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez},
  title        = {A Part-of-Speech Tag Clustering for a Word Prediction System in Portuguese
                  Language},
  journal      = {Proces. del Leng. Natural},
  volume       = {47},
  pages        = {197--205},
  year         = {2011},
  url          = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/984},
  timestamp    = {Mon, 30 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pdln/CavalieriFFPGS11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/PastorelloSN11,
  author       = {Gilberto Zonta Pastorello Jr. and
                  G. Arturo Sanchez{-}Azofeifa and
                  Mario A. Nascimento},
  title        = {Enviro-Net: From Networks of Ground-Based Sensor Systems to a Web
                  Platform for Sensor Data Management},
  journal      = {Sensors},
  volume       = {11},
  number       = {6},
  pages        = {6454--6479},
  year         = {2011},
  url          = {https://doi.org/10.3390/s110606454},
  doi          = {10.3390/S110606454},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sensors/PastorelloSN11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bpm/SanchezPV11,
  author       = {Mario E. S{\'{a}}nchez and
                  Diana Puentes and
                  Jorge Villalobos},
  title        = {A Modular Approach to Build Workflow Engines},
  booktitle    = {Business Process Management Workshops - {BPM} 2011 International Workshops,
                  Clermont-Ferrand, France, August 29, 2011, Revised Selected Papers,
                  Part {II}},
  pages        = {289--300},
  year         = {2011},
  crossref     = {DBLP:conf/bpm/2011w2},
  url          = {https://doi.org/10.1007/978-3-642-28115-0\_28},
  doi          = {10.1007/978-3-642-28115-0\_28},
  timestamp    = {Sun, 02 Jun 2019 21:21:25 +0200},
  biburl       = {https://dblp.org/rec/conf/bpm/SanchezPV11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eScience/Sanchez-AzofeifaRSFG11,
  author       = {G. Arturo Sanchez{-}Azofeifa and
                  Cassidy Rankine and
                  Mario Marcos do Espirito Santo and
                  Rob Fatland and
                  Milton Garcia},
  title        = {Wireless Sensing Networks for Environmental Monitoring: Two Case Studies
                  from Tropical Forests},
  booktitle    = {{IEEE} 7th International Conference on E-Science, e-Science 2011,
                  Stockholm, Sweden, December 5-8, 2011},
  pages        = {70--76},
  year         = {2011},
  crossref     = {DBLP:conf/eScience/2011},
  url          = {https://doi.org/10.1109/eScience.2011.18},
  doi          = {10.1109/ESCIENCE.2011.18},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/eScience/Sanchez-AzofeifaRSFG11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enase/Sanchez-Gonzalez11,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  Francisco Ruiz and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Mario Piattini},
  title        = {Improving Quality of Business Process Models},
  booktitle    = {Evaluation of Novel Approaches to Software Engineering - 6th International
                  Conference, {ENASE} 2011, Beijing, China, June 8-11, 2011. Revised
                  Selected Papers},
  pages        = {130--144},
  year         = {2011},
  crossref     = {DBLP:conf/enase/2011s},
  url          = {https://doi.org/10.1007/978-3-642-32341-6\_9},
  doi          = {10.1007/978-3-642-32341-6\_9},
  timestamp    = {Mon, 08 Jan 2024 21:46:47 +0100},
  biburl       = {https://dblp.org/rec/conf/enase/Sanchez-Gonzalez11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enase/Sanchez-GonzalezRGP11,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  Francisco Ruiz and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Mario Piattini},
  title        = {Business Process Model Improvement based on Measurement Activities},
  booktitle    = {{ENASE} 2011 - Proceedings of the 6th International Conference on
                  Evaluation of Novel Approaches to Software Engineering, Beijing, China,
                  8-11 June, 2011},
  pages        = {104--113},
  year         = {2011},
  crossref     = {DBLP:conf/enase/2011},
  timestamp    = {Thu, 15 Aug 2024 07:54:18 +0200},
  biburl       = {https://dblp.org/rec/conf/enase/Sanchez-GonzalezRGP11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esem/Perez-CastilloSPGG11,
  author       = {Ricardo P{\'{e}}rez{-}Castillo and
                  Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  Mario Piattini and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Ignacio Garc{\'{\i}}a Rodr{\'{\i}}guez de Guzm{\'{a}}n},
  title        = {Obtaining Thresholds for the Effectiveness of Business Process Mining},
  booktitle    = {Proceedings of the 5th International Symposium on Empirical Software
                  Engineering and Measurement, {ESEM} 2011, Banff, AB, Canada, September
                  22-23, 2011},
  pages        = {453--462},
  year         = {2011},
  crossref     = {DBLP:conf/esem/2011},
  url          = {https://doi.org/10.1109/ESEM.2011.64},
  doi          = {10.1109/ESEM.2011.64},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/esem/Perez-CastilloSPGG11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eusipco/GrajalOSGL11,
  author       = {Jes{\'{u}}s Grajal and
                  Omar A. Yeste Ojeda and
                  Miguel Angel S{\'{a}}nchez and
                  Mario Garrido and
                  Marisa L{\'{o}}pez{-}Vallejo},
  title        = {Real time {FPGA} implementation of an automatic modulation classifier
                  for electronic warfare applications},
  booktitle    = {Proceedings of the 19th European Signal Processing Conference, {EUSIPCO}
                  2011, Barcelona, Spain, August 29 - Sept. 2, 2011},
  pages        = {1514--1518},
  year         = {2011},
  crossref     = {DBLP:conf/eusipco/2011},
  url          = {https://ieeexplore.ieee.org/document/7074233/},
  timestamp    = {Mon, 09 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eusipco/GrajalOSGL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS11,
  author       = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
                  Mario Hern{\'{a}}ndez{-}Tejera and
                  Elena S{\'{a}}nchez{-}Nielsen},
  title        = {Distance Maps from Unthresholded Magnitudes},
  booktitle    = {Pattern Recognition and Image Analysis - 5th Iberian Conference, IbPRIA
                  2011, Las Palmas de Gran Canaria, Spain, June 8-10, 2011. Proceedings},
  pages        = {92--99},
  year         = {2011},
  crossref     = {DBLP:conf/ibpria/2011},
  url          = {https://doi.org/10.1007/978-3-642-21257-4\_12},
  doi          = {10.1007/978-3-642-21257-4\_12},
  timestamp    = {Sun, 02 Oct 2022 16:02:57 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/Anton-CanalisHS11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/RodriguezSV11,
  author       = {Carlos Rodr{\'{\i}}guez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Executable model composition: a multilevel approach},
  booktitle    = {Proceedings of the 2011 {ACM} Symposium on Applied Computing (SAC),
                  TaiChung, Taiwan, March 21 - 24, 2011},
  pages        = {877--884},
  year         = {2011},
  crossref     = {DBLP:conf/sac/2011},
  url          = {https://doi.org/10.1145/1982185.1982376},
  doi          = {10.1145/1982185.1982376},
  timestamp    = {Tue, 06 Nov 2018 11:06:49 +0100},
  biburl       = {https://dblp.org/rec/conf/sac/RodriguezSV11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/BischofOSRCB11,
  author       = {Zachary S. Bischof and
                  John S. Otto and
                  Mario A. S{\'{a}}nchez and
                  John P. Rula and
                  David R. Choffnes and
                  Fabi{\'{a}}n E. Bustamante},
  title        = {Crowdsourcing {ISP} characterization to the network edge},
  booktitle    = {Proceedings of the first {ACM} {SIGCOMM} workshop on Measurements
                  up the stack, W-MUST@SIGCOMM 2011, Toronto, Ontario, Canada, August
                  19, 2011},
  pages        = {61--66},
  year         = {2011},
  crossref     = {DBLP:conf/sigcomm/2011wmust},
  url          = {https://doi.org/10.1145/2018602.2018617},
  doi          = {10.1145/2018602.2018617},
  timestamp    = {Tue, 06 Nov 2018 11:07:11 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcomm/BischofOSRCB11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/OttoSCBS11,
  author       = {John S. Otto and
                  Mario A. S{\'{a}}nchez and
                  David R. Choffnes and
                  Fabi{\'{a}}n E. Bustamante and
                  Georgos Siganos},
  title        = {On blind mice and the elephant: understanding the network impact of
                  a large distributed system},
  booktitle    = {Proceedings of the {ACM} {SIGCOMM} 2011 Conference on Applications,
                  Technologies, Architectures, and Protocols for Computer Communications,
                  Toronto, ON, Canada, August 15-19, 2011},
  pages        = {110--121},
  year         = {2011},
  crossref     = {DBLP:conf/sigcomm/2011},
  url          = {https://doi.org/10.1145/2018436.2018450},
  doi          = {10.1145/2018436.2018450},
  timestamp    = {Fri, 12 Mar 2021 14:14:34 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcomm/OttoSCBS11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigcomm/SanchezOBB11,
  author       = {Mario A. S{\'{a}}nchez and
                  John S. Otto and
                  Zachary S. Bischof and
                  Fabi{\'{a}}n E. Bustamante},
  title        = {Dasu - {ISP} characterization from the edge: a BitTorrent implementation},
  booktitle    = {Proceedings of the {ACM} {SIGCOMM} 2011 Conference on Applications,
                  Technologies, Architectures, and Protocols for Computer Communications,
                  Toronto, ON, Canada, August 15-19, 2011},
  pages        = {454--455},
  year         = {2011},
  crossref     = {DBLP:conf/sigcomm/2011},
  url          = {https://doi.org/10.1145/2018436.2018517},
  doi          = {10.1145/2018436.2018517},
  timestamp    = {Fri, 12 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sigcomm/SanchezOBB11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/ParraSFP11,
  author       = {Antonio Santos{-}Olmo and
                  Luis Enrique S{\'{a}}nchez and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Desirable Characteristics for an {ISMS} oriented to SMEs},
  booktitle    = {{WOSIS} 2011 - Proceedings of the 8th International Workshop on Security
                  in Information Systems, In conjunction with {ICEIS} 2011, Beijing,
                  China, 8-9 June, 2011},
  pages        = {151--158},
  year         = {2011},
  crossref     = {DBLP:conf/sis/2011},
  timestamp    = {Mon, 29 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/ParraSFP11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tools/RodriguezSV11,
  author       = {Carlos Rodr{\'{\i}}guez and
                  Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {Metamodel Dependencies for Executable Models},
  booktitle    = {Objects, Models, Components, Patterns - 49th International Conference,
                  {TOOLS} 2011, Zurich, Switzerland, June 28-30, 2011. Proceedings},
  pages        = {83--98},
  year         = {2011},
  crossref     = {DBLP:conf/tools/49-2011},
  url          = {https://doi.org/10.1007/978-3-642-21952-8\_8},
  doi          = {10.1007/978-3-642-21952-8\_8},
  timestamp    = {Tue, 14 May 2019 10:00:45 +0200},
  biburl       = {https://dblp.org/rec/conf/tools/RodriguezSV11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1106-5489,
  author       = {Gilberto Zonta Pastorello Jr. and
                  G. Arturo Sanchez{-}Azofeifa and
                  Mario A. Nascimento},
  title        = {A Review of the Enviro-Net Project},
  journal      = {CoRR},
  volume       = {abs/1106.5489},
  year         = {2011},
  url          = {http://arxiv.org/abs/1106.5489},
  eprinttype    = {arXiv},
  eprint       = {1106.5489},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1106-5489.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bmcbi/Segura-BedmarCPM10,
  author       = {Isabel Segura{-}Bedmar and
                  Mario Crespo and
                  C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and
                  Paloma Mart{\'{\i}}nez},
  title        = {Resolving anaphoras for the extraction of drug-drug interactions in
                  pharmacological documents},
  journal      = {{BMC} Bioinform.},
  volume       = {11},
  number       = {{S-2}},
  pages        = {1},
  year         = {2010},
  url          = {https://doi.org/10.1186/1471-2105-11-S2-S1},
  doi          = {10.1186/1471-2105-11-S2-S1},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bmcbi/Segura-BedmarCPM10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bpmj/Sanchez-GonzalezGRV10,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Francisco Ruiz and
                  Mario Piattini Velthuis},
  title        = {Measurement in business processes: a systematic review},
  journal      = {Bus. Process. Manag. J.},
  volume       = {16},
  number       = {1},
  pages        = {114--134},
  year         = {2010},
  url          = {https://doi.org/10.1108/14637151011017976},
  doi          = {10.1108/14637151011017976},
  timestamp    = {Thu, 18 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/bpmj/Sanchez-GonzalezGRV10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dam/BilbaoO10,
  author       = {Jes{\'{u}}s Mario Bilbao and
                  Manuel Ord{\'{o}}{\~{n}}ez},
  title        = {The core and the Weber set of games on augmenting systems},
  journal      = {Discret. Appl. Math.},
  volume       = {158},
  number       = {3},
  pages        = {180--188},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.dam.2009.09.016},
  doi          = {10.1016/J.DAM.2009.09.016},
  timestamp    = {Thu, 11 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/dam/BilbaoO10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/NevesSBCRR10,
  author       = {Francisco A. S. Neves and
                  Helber E. P. de Souza and
                  Fabr{\'{\i}}cio Bradaschia and
                  Marcelo Cabral Cavalcanti and
                  Mario Rizo and
                  Francisco J. Rodr{\'{\i}}guez},
  title        = {A Space-Vector Discrete Fourier Transform for Unbalanced and Distorted
                  Three-Phase Signals},
  journal      = {{IEEE} Trans. Ind. Electron.},
  volume       = {57},
  number       = {8},
  pages        = {2858--2867},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIE.2009.2036646},
  doi          = {10.1109/TIE.2009.2036646},
  timestamp    = {Fri, 10 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tie/NevesSBCRR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tie/SanchezVHRPJ10,
  author       = {Ren{\'{e}} Osorio Sanchez and
                  Nimrod V{\'{a}}zquez and
                  Claudia Hern{\'{a}}ndez and
                  Elias Rodr{\'{\i}}guez and
                  Sergio Pinto and
                  Mario A. Ju{\'{a}}rez},
  title        = {Electric Dynamic Modeling of {HID} Lamps for Electronic Ballast Design},
  journal      = {{IEEE} Trans. Ind. Electron.},
  volume       = {57},
  number       = {5},
  pages        = {1655--1662},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIE.2009.2033095},
  doi          = {10.1109/TIE.2009.2033095},
  timestamp    = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tie/SanchezVHRPJ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEares/SanchezRFP10,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Carlos Ruiz and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Managing the Asset Risk of SMEs},
  booktitle    = {{ARES} 2010, Fifth International Conference on Availability, Reliability
                  and Security, 15-18 February 2010, Krakow, Poland},
  pages        = {422--429},
  year         = {2010},
  crossref     = {DBLP:conf/IEEEares/2010},
  url          = {https://doi.org/10.1109/ARES.2010.52},
  doi          = {10.1109/ARES.2010.52},
  timestamp    = {Sat, 27 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/IEEEares/SanchezRFP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/centeris/SanchezPFP10,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Antonio Santos{-}Olmo and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Security Culture in Small and Medium-Size Enterprise},
  booktitle    = {ENTERprise Information Systems - International Conference, {CENTERIS}
                  2010, Viana do Castelo, Portugal, October 20-22, 2010, Proceedings,
                  Part {II}},
  pages        = {315--324},
  year         = {2010},
  crossref     = {DBLP:conf/centeris/2010-2},
  url          = {https://doi.org/10.1007/978-3-642-16419-4\_32},
  doi          = {10.1007/978-3-642-16419-4\_32},
  timestamp    = {Mon, 29 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/centeris/SanchezPFP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cibse/Sanchez-Gonzalez10,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Francisco Ruiz and
                  Mario Piattini},
  title        = {{BILMA:} Entorno para la Mejora Continua de Procesos de Negocio guiada
                  por la Medici{\'{o}}n},
  booktitle    = {Proceedings of the 13th Iberoamerican Conference on Software Engineering,
                  CIbSE 2010, Cuenca, Ecuador, April 12-16, 2010},
  pages        = {293--298},
  year         = {2010},
  crossref     = {DBLP:conf/cibse/2010},
  timestamp    = {Tue, 09 Feb 2021 15:58:30 +0100},
  biburl       = {https://dblp.org/rec/conf/cibse/Sanchez-Gonzalez10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Anzures-GarciaS10,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Elizabeth L{\'{o}}pez{-}Mel{\'{e}}ndez and
                  Gilberto Andrade{-}Andrade and
                  Ricardo Rivera{-}Morales},
  title        = {Platform to supports learning based on Social Network, Web Intelligence
                  and {CSCL}},
  booktitle    = {20th International Conference on Electronics, Communications and Computer,
                  {CONIELECOMP} 2010, Cholula, Puebla, Mexico, February 22-24, 2010},
  pages        = {201--205},
  year         = {2010},
  crossref     = {DBLP:conf/conielecomp/2010},
  url          = {https://doi.org/10.1109/CONIELECOMP.2010.5440769},
  doi          = {10.1109/CONIELECOMP.2010.5440769},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/conielecomp/Anzures-GarciaS10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/Sanchez-GonzalezGMRP10,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Jan Mendling and
                  Francisco Ruiz and
                  Mario Piattini},
  title        = {Prediction of Business Process Model Quality Based on Structural Metrics},
  booktitle    = {Conceptual Modeling - {ER} 2010, 29th International Conference on
                  Conceptual Modeling, Vancouver, BC, Canada, November 1-4, 2010. Proceedings},
  pages        = {458--463},
  year         = {2010},
  crossref     = {DBLP:conf/er/2010},
  url          = {https://doi.org/10.1007/978-3-642-16373-9\_35},
  doi          = {10.1007/978-3-642-16373-9\_35},
  timestamp    = {Sun, 06 Oct 2024 21:00:57 +0200},
  biburl       = {https://dblp.org/rec/conf/er/Sanchez-GonzalezGMRP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/ChoffnesSB10,
  author       = {David R. Choffnes and
                  Mario A. S{\'{a}}nchez and
                  Fabian E. Bustamante},
  title        = {Network Positioning from the Edge - An Empirical Study of the Effectiveness
                  of Network Positioning in {P2P} Systems},
  booktitle    = {{INFOCOM} 2010. 29th {IEEE} International Conference on Computer Communications,
                  Joint Conference of the {IEEE} Computer and Communications Societies,
                  15-19 March 2010, San Diego, CA, {USA}},
  pages        = {291--295},
  year         = {2010},
  crossref     = {DBLP:conf/infocom/2010},
  url          = {https://doi.org/10.1109/INFCOM.2010.5462225},
  doi          = {10.1109/INFCOM.2010.5462225},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/infocom/ChoffnesSB10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/jisbd/Sanchez-GonzalezGRP10,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Francisco Ruiz and
                  Mario Piattini},
  title        = {Validaci{\'{o}}n Global de Medidas para Modelos Conceptuales
                  de Procesos de Negocio mediante Meta-An{\'{a}}lisis},
  booktitle    = {{XV} Jornadas de Ingenier{\'{\i}}a del Software y Bases de Datos
                  {(JISBD} 2010), Valencia, Spain, September 7-10, 2010. Actas},
  pages        = {293--298},
  year         = {2010},
  crossref     = {DBLP:conf/jisbd/2010},
  timestamp    = {Sun, 05 Nov 2017 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/jisbd/Sanchez-GonzalezGRP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/paams/CrespoSFAL10,
  author       = {Mario Crespo and
                  Daniel S{\'{a}}nchez and
                  Luis Felipe Crespo Foix and
                  Sonia Astorga Moreno and
                  Antonio Le{\'{o}}n},
  title        = {Collaborative Dialogue Agent for {COPD} Self-management in {AMICA:}
                  {A} First Insight},
  booktitle    = {Advances in Practical Applications of Agents and Multiagent Systems,
                  8th International Conference on Practical Applications of Agents and
                  Multiagent Systems, {PAAMS} 2010, Salamanca, Spain, 26-28 April 2010},
  pages        = {75--80},
  year         = {2010},
  crossref     = {DBLP:conf/paams/2010},
  url          = {https://doi.org/10.1007/978-3-642-12384-9\_10},
  doi          = {10.1007/978-3-642-12384-9\_10},
  timestamp    = {Mon, 17 Jul 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/paams/CrespoSFAL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trustbus/SanchezPFP10,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Antonio Santos{-}Olmo and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Building {ISMS} through the Reuse of Knowledge},
  booktitle    = {Trust, Privacy and Security in Digital Business, 7th International
                  Conference, TrustBus 2010, Bilbao, Spain, August 30-31, 2010. Proceedings},
  pages        = {190--201},
  year         = {2010},
  crossref     = {DBLP:conf/trustbus/2010},
  url          = {https://doi.org/10.1007/978-3-642-15152-1\_17},
  doi          = {10.1007/978-3-642-15152-1\_17},
  timestamp    = {Mon, 29 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/trustbus/SanchezPFP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eor/BilbaoO09,
  author       = {Jes{\'{u}}s Mario Bilbao and
                  Manuel Ord{\'{o}}{\~{n}}ez},
  title        = {Axiomatizations of the Shapley value for games on augmenting systems},
  journal      = {Eur. J. Oper. Res.},
  volume       = {196},
  number       = {3},
  pages        = {1008--1014},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.ejor.2008.04.028},
  doi          = {10.1016/J.EJOR.2008.04.028},
  timestamp    = {Fri, 21 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eor/BilbaoO09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jikm/Perez-SolteroBS09,
  author       = {Alonso Perez{-}Soltero and
                  Mario Barcelo{-}Valenzuela and
                  Gerardo Sanchez{-}Schmitz},
  title        = {Design of an Ontology as a Support to the Knowledge Audit Process
                  in Organisations},
  journal      = {J. Inf. Knowl. Manag.},
  volume       = {8},
  number       = {2},
  pages        = {147--158},
  year         = {2009},
  url          = {https://doi.org/10.1142/S0219649209002257},
  doi          = {10.1142/S0219649209002257},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jikm/Perez-SolteroBS09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/SanchezPRP09,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Antonio Santos{-}Olmo and
                  David Garcia Rosado and
                  Mario Piattini},
  title        = {Managing Security and its Maturity in Small and Medium-sized Enterprises},
  journal      = {J. Univers. Comput. Sci.},
  volume       = {15},
  number       = {15},
  pages        = {3038--3058},
  year         = {2009},
  url          = {https://doi.org/10.3217/jucs-015-15-3038},
  doi          = {10.3217/JUCS-015-15-3038},
  timestamp    = {Mon, 29 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jucs/SanchezPRP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rasi/SanchezV009,
  author       = {Mario E. S{\'{a}}nchez and
                  Jorge Villalobos and
                  Daniel Romero},
  title        = {Un mecanismo de coordinaci{\'{o}}n basado en m{\'{a}}quinas
                  de estado, empleado en las aplicaciones que usan workflows},
  journal      = {Rev. Avances en Sistemas Inform{\'{a}}tica},
  volume       = {6},
  number       = {1},
  pages        = {35--44},
  year         = {2009},
  url          = {http://www.minas.medellin.unal.edu.co/index.php?option=com\_docman\&task=doc\_view\&gid=551\&tmpl=component\&format=raw\&Itemid=285},
  timestamp    = {Fri, 22 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rasi/SanchezV009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09,
  author       = {Andr{\'{e}} Ferreira and
                  Teodiano Freire Bastos{-}Filho and
                  M{\'{a}}rio Sarcinelli Filho and
                  Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and
                  Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and
                  Manuel Mazo Quintas},
  title        = {Evaluation of {PSD} Components and {AAR} Parameters as Input Features
                  for a {SVM} Classifier Applied to a Robotic Wheelchair},
  booktitle    = {{BIODEVICES} 2009 - Proceedings of the International Conference on
                  Biomedical Electronics and Devices, Porto, Portugal, January 14-17,
                  2009},
  pages        = {7--12},
  year         = {2009},
  crossref     = {DBLP:conf/biostec/2009bd},
  timestamp    = {Mon, 30 Sep 2024 21:31:02 +0200},
  biburl       = {https://dblp.org/rec/conf/biostec/FerreiraFFSGQ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/biostec/FerreiraFFSGQ09a,
  author       = {Andr{\'{e}} Ferreira and
                  Teodiano Freire Bastos{-}Filho and
                  M{\'{a}}rio Sarcinelli Filho and
                  Jos{\'{e}} Luis Mart{\'{\i}}n S{\'{a}}nchez and
                  Juan Carlos Garc{\'{\i}}a Garc{\'{\i}}a and
                  Manuel Mazo Quintas},
  title        = {Improvements of a Brain-Computer Interface Applied to a Robotic Wheelchair},
  booktitle    = {Biomedical Engineering Systems and Technologies - International Joint
                  Conference, {BIOSTEC} 2009 Porto, Portugal, January 14-17, 2009, Revised
                  Selected Papers},
  pages        = {64--73},
  year         = {2009},
  crossref     = {DBLP:conf/biostec/2009ccis},
  url          = {https://doi.org/10.1007/978-3-642-11721-3\_4},
  doi          = {10.1007/978-3-642-11721-3\_4},
  timestamp    = {Mon, 30 Sep 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/biostec/FerreiraFFSGQ09a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ciarp/Sanchez-CruzR09,
  author       = {Hermilo S{\'{a}}nchez{-}Cruz and
                  Mario A. Rodr{\'{\i}}guez{-}D{\'{\i}}az},
  title        = {Coding Long Contour Shapes of Binary Objects},
  booktitle    = {Progress in Pattern Recognition, Image Analysis, Computer Vision,
                  and Applications, 14th Iberoamerican Conference on Pattern Recognition,
                  {CIARP} 2009, Guadalajara, Jalisco, Mexico, November 15-18, 2009.
                  Proceedings},
  pages        = {45--52},
  year         = {2009},
  crossref     = {DBLP:conf/ciarp/2009},
  url          = {https://doi.org/10.1007/978-3-642-10268-4\_5},
  doi          = {10.1007/978-3-642-10268-4\_5},
  timestamp    = {Tue, 14 May 2019 10:00:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ciarp/Sanchez-CruzR09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/Segura-BedmarCPM09,
  author       = {Isabel Segura{-}Bedmar and
                  Mario Crespo and
                  C{\'{e}}sar de Pablo{-}S{\'{a}}nchez and
                  Paloma Mart{\'{\i}}nez},
  title        = {DrugNerAR: linguistic rule-based anaphora resolver for drug-drug interaction
                  extraction in pharmacological documents},
  booktitle    = {Proceeding of the 3rd International Workshop on Data and Text Mining
                  in Bioinformatics, {DTMBIO} 2009, Hong Kong, China, November 6, 2009},
  pages        = {19--26},
  year         = {2009},
  crossref     = {DBLP:conf/cikm/2009dtmbio},
  url          = {https://doi.org/10.1145/1651318.1651324},
  doi          = {10.1145/1651318.1651324},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cikm/Segura-BedmarCPM09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/enc/Anzures-GarciaSHP09,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Miguel J. Hornos and
                  Patricia Paderewski},
  title        = {Service-Based Layered Architectural Model for Building Collaborative
                  Applications in Heterogeneous Environments},
  booktitle    = {2009 Mexican International Conference on Computer Science, {ENC} 2009,
                  Mexico City, Mexico, September 21-25, 2009},
  pages        = {252--263},
  year         = {2009},
  crossref     = {DBLP:conf/enc/2009},
  url          = {https://doi.org/10.1109/ENC.2009.37},
  doi          = {10.1109/ENC.2009.37},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/enc/Anzures-GarciaSHP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/micai/ColungaSM09,
  author       = {Mario Chirinos Colunga and
                  Oscar S{\'{a}}nchez Siordia and
                  Stephen J. Maybank},
  title        = {Leukocyte Recognition Using EM-Algorithm},
  booktitle    = {{MICAI} 2009: Advances in Artificial Intelligence, 8th Mexican International
                  Conference on Artificial Intelligence, Guanajuato, Mexico, November
                  9-13, 2009. Proceedings},
  pages        = {545--555},
  year         = {2009},
  crossref     = {DBLP:conf/micai/2009},
  url          = {https://doi.org/10.1007/978-3-642-05258-3\_48},
  doi          = {10.1007/978-3-642-05258-3\_48},
  timestamp    = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/ColungaSM09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/nldb/Segura-BedmarCP09,
  author       = {Isabel Segura{-}Bedmar and
                  Mario Crespo and
                  C{\'{e}}sar de Pablo{-}S{\'{a}}nchez},
  title        = {Score-Based Approach for Anaphora Resolution in Drug-Drug Interactions
                  Documents},
  booktitle    = {Natural Language Processing and Information Systems, 14th International
                  Conference on Applications of Natural Language to Information Systems,
                  {NLDB} 2009, Saarbr{\"{u}}cken, Germany, June 24-26, 2009. Revised
                  Papers},
  pages        = {91--102},
  year         = {2009},
  crossref     = {DBLP:conf/nldb/2009},
  url          = {https://doi.org/10.1007/978-3-642-12550-8\_8},
  doi          = {10.1007/978-3-642-12550-8\_8},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/nldb/Segura-BedmarCP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/SanchezPFP09,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Antonio Santos{-}Olmo and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {{MMSM-SME:} Methodology for the Management of Security and its Maturity
                  in {SME}},
  booktitle    = {Security in Information Systems, Proceedings of the 7th International
                  Workshop on Security in Information Systems, {WOSIS} 2009, In conjunction
                  with {ICEIS} 2009, Milan, Italy, May 2009},
  pages        = {67--78},
  year         = {2009},
  crossref     = {DBLP:conf/sis/2009},
  timestamp    = {Mon, 29 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/SanchezPFP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sws/LischkaEC09,
  author       = {Mario Lischka and
                  Yukiko Endo and
                  Manuel S{\'{a}}nchez Cuenca},
  title        = {Deductive policies with {XACML}},
  booktitle    = {Proceedings of the 6th {ACM} Workshop On Secure Web Services, {SWS}
                  2009, Chicago, Illinois, USA, November 13, 2009},
  pages        = {37--44},
  year         = {2009},
  crossref     = {DBLP:conf/sws/2009},
  url          = {https://doi.org/10.1145/1655121.1655130},
  doi          = {10.1145/1655121.1655130},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sws/LischkaEC09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tools/SanchezJVD09,
  author       = {Mario E. S{\'{a}}nchez and
                  Camilo Jim{\'{e}}nez and
                  Jorge Villalobos and
                  Dirk Deridder},
  title        = {Extensibility in Model-Based Business Process Engines},
  booktitle    = {Objects, Components, Models and Patterns, 47th International Conference,
                  {TOOLS} {EUROPE} 2009, Zurich, Switzerland, June 29-July 3, 2009.
                  Proceedings},
  pages        = {157--174},
  year         = {2009},
  crossref     = {DBLP:conf/tools/47-2009},
  url          = {https://doi.org/10.1007/978-3-642-02571-6\_10},
  doi          = {10.1007/978-3-642-02571-6\_10},
  timestamp    = {Mon, 30 Oct 2017 11:35:08 +0100},
  biburl       = {https://dblp.org/rec/conf/tools/SanchezJVD09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wecwis/AguilarSCRPCV09,
  author       = {Elvira Rol{\'{o}}n Aguilar and
                  Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Francisco Ruiz and
                  Mario Piattini and
                  Danilo Caivano and
                  Giuseppe Visaggio},
  title        = {Prediction Models for {BPMN} Usability and Maintainability},
  booktitle    = {2009 {IEEE} Conference on Commerce and Enterprise Computing, {CEC}
                  2009, Vienna, Austria, July 20-23, 2009},
  pages        = {383--390},
  year         = {2009},
  crossref     = {DBLP:conf/wecwis/2009},
  url          = {https://doi.org/10.1109/CEC.2009.53},
  doi          = {10.1109/CEC.2009.53},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/wecwis/AguilarSCRPCV09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/igi/09/Sanchez-GonzalezD00P09,
  author       = {Laura S{\'{a}}nchez{-}Gonz{\'{a}}lez and
                  Andrea Delgado and
                  Francisco Ruiz and
                  F{\'{e}}lix Garc{\'{\i}}a and
                  Mario Piattini},
  title        = {Measurement and Maturity of Business Processes},
  booktitle    = {Handbook of Research on Business Process Modeling},
  pages        = {532--556},
  year         = {2009},
  crossref     = {DBLP:books/igi/09/CA2009},
  url          = {https://doi.org/10.4018/978-1-60566-288-6.ch024},
  doi          = {10.4018/978-1-60566-288-6.CH024},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/books/igi/09/Sanchez-GonzalezD00P09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/SalvadorRMRCSFCGMM08,
  author       = {Carlos Hern{\'{a}}ndez Salvador and
                  Antonio Ruiz{-}Sanchez and
                  M. A. Gonz{\'{a}}lez de Mingo and
                  Montserrat Carmona Rodriguez and
                  Mario Pascual Carrasco and
                  Pilar G. Sagredo and
                  Juan A. Fragua and
                  Fernando Caballero{-}Martinez and
                  Fernando Garcia{-}Lopez and
                  J. M{\'{a}}rquez Montes and
                  Jose Luis Monteagudo},
  title        = {Evaluation of a Telemedicine-Based Service for the Follow-Up and Monitoring
                  of Patients Treated With Oral Anticoagulant Therapy},
  journal      = {{IEEE} Trans. Inf. Technol. Biomed.},
  volume       = {12},
  number       = {6},
  pages        = {696--706},
  year         = {2008},
  url          = {https://doi.org/10.1109/TITB.2008.910750},
  doi          = {10.1109/TITB.2008.910750},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/titb/SalvadorRMRCSFCGMM08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEares/Anzures-GarciaS08,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
  title        = {Policy-based Group Organizational Structure Management using an Ontological
                  Approach},
  booktitle    = {Proceedings of the The Third International Conference on Availability,
                  Reliability and Security, {ARES} 2008, March 4-7, 2008, Technical
                  University of Catalonia, Barcelona , Spain},
  pages        = {807--812},
  year         = {2008},
  crossref     = {DBLP:conf/IEEEares/2008},
  url          = {https://doi.org/10.1109/ARES.2008.186},
  doi          = {10.1109/ARES.2008.186},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/IEEEares/Anzures-GarciaS08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aosd/SanchezV08,
  author       = {Mario E. S{\'{a}}nchez and
                  Jorge Villalobos},
  title        = {A flexible architecture to build workflows using aspect-oriented concepts},
  booktitle    = {Proceedings of the 2008 {AOSD} Workshop on Aspect-Oriented Modeling,
                  {AOM} '08, Brussels, Belgium, April 1, 2008},
  pages        = {25--30},
  year         = {2008},
  crossref     = {DBLP:conf/aosd/2008aom},
  url          = {https://doi.org/10.1145/1404920.1404925},
  doi          = {10.1145/1404920.1404925},
  timestamp    = {Mon, 03 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/aosd/SanchezV08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisis/Anzures-GarciaS08,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez},
  title        = {Group Organizational Structure Adaptation for Groupware Applications},
  booktitle    = {Second International Conference on Complex, Intelligent and Software
                  Intensive Systems (CISIS-2008), March 4th-7th, 2008, Technical University
                  of Catalonia, Barcelona, Spain},
  pages        = {435--440},
  year         = {2008},
  crossref     = {DBLP:conf/cisis/2008},
  url          = {https://doi.org/10.1109/CISIS.2008.149},
  doi          = {10.1109/CISIS.2008.149},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cisis/Anzures-GarciaS08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/secrypt/SanchezVFP08,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Daniel Villafranca and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Practical Application of a Security Management Maturity Model for
                  SMEs based on Predefined Schemas},
  booktitle    = {{SECRYPT} 2008, Proceedings of the International Conference on Security
                  and Cryptography, Porto, Portugal, July 26-29, 2008, {SECRYPT} is
                  part of {ICETE} - The International Joint Conference on e-Business
                  and Telecommunications},
  pages        = {391--398},
  year         = {2008},
  crossref     = {DBLP:conf/secrypt/2008},
  timestamp    = {Mon, 08 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/secrypt/SanchezVFP08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/his/2008,
  editor       = {Fatos Xhafa and
                  Francisco Herrera and
                  Ajith Abraham and
                  Mario K{\"{o}}ppen and
                  Jos{\'{e}} Manuel Ben{\'{\i}}tez},
  title        = {8th International Conference on Hybrid Intelligent Systems {(HIS}
                  2008), September 10-12, 2008, Barcelona, Spain},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4626579/proceeding},
  isbn         = {978-0-7695-3326-1},
  timestamp    = {Wed, 16 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/his/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0801-0969,
  author       = {Javier Gonzalez{-}Estevez and
                  Mario G. Cosenza and
                  Ricardo L{\'{o}}pez{-}Ruiz and
                  Juan R. S{\'{a}}nchez},
  title        = {Pareto and Boltzmann-Gibbs behaviors in a deterministic multi-agent
                  system},
  journal      = {CoRR},
  volume       = {abs/0801.0969},
  year         = {2008},
  url          = {http://arxiv.org/abs/0801.0969},
  eprinttype    = {arXiv},
  eprint       = {0801.0969},
  timestamp    = {Fri, 16 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-0801-0969.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/Martinez-BazanMGNSL07,
  author       = {Norbert Mart{\'{\i}}nez{-}Bazan and
                  Victor Munt{\'{e}}s{-}Mulero and
                  Sergio G{\'{o}}mez{-}Villamor and
                  Jordi Nin and
                  Mario{-}A. S{\'{a}}nchez{-}Mart{\'{\i}}nez and
                  Josep Llu{\'{\i}}s Larriba{-}Pey},
  title        = {Dex: high-performance exploration on large graphs for information
                  retrieval},
  booktitle    = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge
                  Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007},
  pages        = {573--582},
  year         = {2007},
  crossref     = {DBLP:conf/cikm/2007},
  url          = {https://doi.org/10.1145/1321440.1321521},
  doi          = {10.1145/1321440.1321521},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cikm/Martinez-BazanMGNSL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eurocast/Anzures-GarciaSHP07,
  author       = {Mario Anzures{-}Garc{\'{\i}}a and
                  Luz A. S{\'{a}}nchez{-}G{\'{a}}lvez and
                  Miguel J. Hornos and
                  Patricia Paderewski{-}Rodr{\'{\i}}guez},
  title        = {Ontology-Based Modelling of Session Management Policies for Groupware
                  Applications},
  booktitle    = {Computer Aided Systems Theory - {EUROCAST} 2007, 11th International
                  Conference on Computer Aided Systems Theory, Las Palmas de Gran Canaria,
                  Spain, February 12-16, 2007, Revised Selected Papers},
  pages        = {57--64},
  year         = {2007},
  crossref     = {DBLP:conf/eurocast/2007},
  url          = {https://doi.org/10.1007/978-3-540-75867-9\_8},
  doi          = {10.1007/978-3-540-75867-9\_8},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eurocast/Anzures-GarciaSHP07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iasam/AzcondoOMDBRPDC07,
  author       = {Francisco J. Azcondo and
                  Alfredo Ortiz and
                  Mario Ma{\~{n}}ana and
                  F. Javier D{\'{\i}}az and
                  Christian Bra{\~{n}}as and
                  Carlos Renedo and
                  Severiano P{\'{e}}rez and
                  Fernando Delgado and
                  Rosario Casanueva},
  title        = {Effects of Flicker on Different Types of 150-W High-Pressure Sodium
                  Lamps and Ballasts},
  booktitle    = {Conference Record of the 2007 {IEEE} Industry Applications Conference
                  Forty-Second {IAS} Annual Meeting, New Orleans, LA, USA, September
                  23-27, 2007},
  pages        = {833--838},
  year         = {2007},
  crossref     = {DBLP:conf/iasam/2007},
  url          = {https://doi.org/10.1109/07IAS.2007.131},
  doi          = {10.1109/07IAS.2007.131},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iasam/AzcondoOMDBRPDC07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ibpria/Anton-CanalisHS07,
  author       = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
                  Mario Hern{\'{a}}ndez{-}Tejera and
                  Elena S{\'{a}}nchez{-}Nielsen},
  title        = {Analysis of Relevant Maxima in Distance Transform. An Application
                  to Fast Coarse Image Segmentation},
  booktitle    = {Pattern Recognition and Image Analysis, Third Iberian Conference,
                  IbPRIA 2007, Girona, Spain, June 6-8, 2007, Proceedings, Part {I}},
  pages        = {97--104},
  year         = {2007},
  crossref     = {DBLP:conf/ibpria/2007-1},
  url          = {https://doi.org/10.1007/978-3-540-72847-4\_14},
  doi          = {10.1007/978-3-540-72847-4\_14},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/Anton-CanalisHS07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icsoft/SanchezVFP07,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Daniel Villafranca and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Scmm-Tool - Tool for Computer Automation of the Information Security
                  Management Systems},
  booktitle    = {{ICSOFT} 2007, Proceedings of the Second International Conference
                  on Software and Data Technologies, Volume SE, Barcelona, Spain, July
                  22-25, 2007},
  pages        = {311--318},
  year         = {2007},
  crossref     = {DBLP:conf/icsoft/2007-2},
  timestamp    = {Mon, 08 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icsoft/SanchezVFP07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/secrypt/SanchezVFP07,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Daniel Villafranca and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Developing a Model and a Tool to Manage the Information Security in
                  Small and Medium Enterprises},
  booktitle    = {{SECRYPT} 2007, Proceedings of the International Conference on Security
                  and Cryptography, Barcelona, Spain, July 28-13, 2007, {SECRYPT} is
                  part of {ICETE} - The International Joint Conference on e-Business
                  and Telecommunications},
  pages        = {355--362},
  year         = {2007},
  crossref     = {DBLP:conf/secrypt/2007},
  timestamp    = {Mon, 08 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/secrypt/SanchezVFP07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/SachezVP07,
  author       = {Lu{\'{\i}}s Enrique Sanchez and
                  Daniel Villafranca and
                  Mario Piattini},
  title        = {{MMISS-SME} Practical Development: Maturity Model for Information
                  Systems Security Management in SMEs},
  booktitle    = {Security in Information Systems, Proceedings of the 5th International
                  Workshop on Security in Information Systems, {WOSIS} 2007, In conjunction
                  with {ICEIS} 2007, Funchal, Madeira, Portugal, June 2007},
  pages        = {233--244},
  year         = {2007},
  crossref     = {DBLP:conf/sis/2007},
  timestamp    = {Mon, 11 Aug 2008 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/SachezVP07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-0712-2684,
  author       = {Ricardo L{\'{o}}pez{-}Ruiz and
                  Javier Gonzalez{-}Estevez and
                  Mario G. Cosenza and
                  Juan R. S{\'{a}}nchez},
  title        = {An Economic Model of Coupled Exponential Maps},
  journal      = {CoRR},
  volume       = {abs/0712.2684},
  year         = {2007},
  url          = {http://arxiv.org/abs/0712.2684},
  eprinttype    = {arXiv},
  eprint       = {0712.2684},
  timestamp    = {Fri, 16 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-0712-2684.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/rasi/RodriguezSC06,
  author       = {Elkin Rodr{\'{\i}}guez and
                  Andr{\'{e}}s Felipe S{\'{a}}nchez and
                  Jorge Mario Chaverra},
  title        = {Desarrollo de una Herramienta para la Minimizaci{\'{o}}n de Tardanza
                  Total en Ambientes Job Shop Apoyada en B{\'{u}}squeda Tab{\'{u}}},
  journal      = {Rev. Avances en Sistemas Inform{\'{a}}tica},
  volume       = {3},
  number       = {1},
  pages        = {75--78},
  year         = {2006},
  url          = {http://pisis.unalmed.edu.co/avances/archivos/ediciones/2006/rodriguez\_etal06.pdf},
  timestamp    = {Fri, 22 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/rasi/RodriguezSC06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/VelaFMP06,
  author       = {Bel{\'{e}}n Vela and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Esperanza Marcos and
                  Mario Piattini},
  title        = {Model driven development of secure {XML} databases},
  journal      = {{SIGMOD} Rec.},
  volume       = {35},
  number       = {3},
  pages        = {22--27},
  year         = {2006},
  url          = {https://doi.org/10.1145/1168092.1168095},
  doi          = {10.1145/1168092.1168095},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigmod/VelaFMP06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEares/SanchezVFP06,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Daniel Villafranca and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Practical Approach of a Secure Management System based on {ISO/IEC}
                  17799},
  booktitle    = {Proceedings of the The First International Conference on Availability,
                  Reliability and Security, {ARES} 2006, The International Dependability
                  Conference - Bridging Theory and Practice, April 20-22 2006, Vienna
                  University of Technology, Austria},
  pages        = {585--592},
  year         = {2006},
  crossref     = {DBLP:conf/IEEEares/2006},
  url          = {https://doi.org/10.1109/ARES.2006.94},
  doi          = {10.1109/ARES.2006.94},
  timestamp    = {Sat, 27 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/IEEEares/SanchezVFP06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acivs/Anton-CanalisHS06,
  author       = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
                  Mario Hern{\'{a}}ndez{-}Tejera and
                  Elena S{\'{a}}nchez{-}Nielsen},
  title        = {AddCanny: Edge Detector for Video Processing},
  booktitle    = {Advanced Concepts for Intelligent Vision Systems, 8th International
                  Conference, {ACIVS} 2006, Antwerp, Belgium, September 18-21, 2006,
                  Proceedings},
  pages        = {501--512},
  year         = {2006},
  crossref     = {DBLP:conf/acivs/2006},
  url          = {https://doi.org/10.1007/11864349\_46},
  doi          = {10.1007/11864349\_46},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/acivs/Anton-CanalisHS06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/SznaierPP06,
  author       = {Mario Sznaier and
                  Ricardo Salvador S{\'{a}}nchez Pe{\~{n}}a and
                  Vicen{\c{c}} Puig},
  title        = {Set-Membership Identification of Parametric Systems},
  booktitle    = {45th {IEEE} Conference on Decision and Control, {CDC} 2006, San Diego,
                  CA, USA, December 13-15, 2006},
  pages        = {151--156},
  year         = {2006},
  crossref     = {DBLP:conf/cdc/2006},
  url          = {https://doi.org/10.1109/CDC.2006.377561},
  doi          = {10.1109/CDC.2006.377561},
  timestamp    = {Fri, 04 Mar 2022 13:26:30 +0100},
  biburl       = {https://dblp.org/rec/conf/cdc/SznaierPP06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cibse/VelaFMP06,
  author       = {Bel{\'{e}}n Vela and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Esperanza Marcos and
                  Mario Piattini},
  title        = {Una Aproximaci{\'{o}}n Dirigida por Modelos para el Dise{\~{n}}o
                  de Bases de Datos {XML} Seguras},
  booktitle    = {Memorias de la {IX} Conferenci a Iberoamericana de Software Engineering
                  (CIbSE 2006), La Plata, Argentina, Abril 24-28, 2006},
  pages        = {229--242},
  year         = {2006},
  crossref     = {DBLP:conf/cibse/2006},
  timestamp    = {Tue, 21 Dec 2010 15:32:51 +0100},
  biburl       = {https://dblp.org/rec/conf/cibse/VelaFMP06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fpt/MarcosGLL06,
  author       = {Miguel A. S{\'{a}}nchez Marcos and
                  Mario Garrido and
                  Marisa L{\'{o}}pez{-}Vallejo and
                  Carlos A. L{\'{o}}pez{-}Barrio},
  title        = {Automated design space exploration of FPGA-based {FFT} architectures
                  based on area and power estimation},
  booktitle    = {2006 {IEEE} International Conference on Field Programmable Technology,
                  {FPT} 2006, Bangkok, Thailand, December 13-15, 2006},
  pages        = {127--134},
  year         = {2006},
  crossref     = {DBLP:conf/fpt/2006},
  url          = {https://doi.org/10.1109/FPT.2006.270303},
  doi          = {10.1109/FPT.2006.270303},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/fpt/MarcosGLL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/glvlsi/GargSGJGK06,
  author       = {Rajesh Garg and
                  Mario S{\'{a}}nchez and
                  Kanupriya Gulati and
                  Nikhil Jayakumar and
                  Anshul Gupta and
                  Sunil P. Khatri},
  title        = {A design flow to optimize circuit delay by using standard cells and
                  PLAs},
  booktitle    = {Proceedings of the 16th {ACM} Great Lakes Symposium on {VLSI} 2006,
                  Philadelphia, PA, USA, April 30 - May 1, 2006},
  pages        = {217--222},
  year         = {2006},
  crossref     = {DBLP:conf/glvlsi/2006},
  url          = {https://doi.org/10.1145/1127908.1127960},
  doi          = {10.1145/1127908.1127960},
  timestamp    = {Wed, 16 Aug 2023 21:16:32 +0200},
  biburl       = {https://dblp.org/rec/conf/glvlsi/GargSGJGK06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/Anton-CanalisHS06,
  author       = {Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
                  Mario Hern{\'{a}}ndez{-}Tejera and
                  Elena S{\'{a}}nchez{-}Nielsen},
  title        = {Particle Swarms as Video Sequence Inhabitants For Object Tracking
                  in Computer Vision},
  booktitle    = {Proceedings of the Sixth International Conference on Intelligent Systems
                  Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan,
                  China},
  pages        = {604--609},
  year         = {2006},
  crossref     = {DBLP:conf/isda/2006},
  url          = {https://doi.org/10.1109/ISDA.2006.253905},
  doi          = {10.1109/ISDA.2006.253905},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/isda/Anton-CanalisHS06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/SanchezVFP06,
  author       = {Luis Enrique S{\'{a}}nchez and
                  Daniel Villafranca and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mario Piattini},
  title        = {Developing a Maturity Model for Information System Security Management
                  within Small and Medium Size Enterprises},
  booktitle    = {Security in Information Systems, Proceedings of the 4th International
                  Workshop on Security in Information Systems, {WOSIS} 2006, In conjunction
                  with {ICEIS} 2006, Paphos, Cyprus, May 2006},
  pages        = {256--266},
  year         = {2006},
  crossref     = {DBLP:conf/sis/2006},
  timestamp    = {Mon, 08 Apr 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/SanchezVFP06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sis/VelaFMP06,
  author       = {Bel{\'{e}}n Vela and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Esperanza Marcos and
                  Mario Piattini},
  title        = {A Model Driven Approach for Secure {XML} Database Development},
  booktitle    = {Security in Information Systems, Proceedings of the 4th International
                  Workshop on Security in Information Systems, {WOSIS} 2006, In conjunction
                  with {ICEIS} 2006, Paphos, Cyprus, May 2006},
  pages        = {33--46},
  year         = {2006},
  crossref     = {DBLP:conf/sis/2006},
  timestamp    = {Tue, 19 Sep 2006 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/VelaFMP06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wises/IbanezSMS06,
  author       = {Mario Ib{\'{a}}{\~{n}}ez and
                  Juan Jes{\'{u}}s S{\'{a}}nchez S{\'{a}}nchez and
                  Natividad Mart{\'{\i}}nez Madrid and
                  Ralf Seepold},
  title        = {Portable Profiles for Residential Gateways},
  booktitle    = {4th International Workshop on Intelligent Solutions in Embedded Systems,
                  {WISES} 2006, Vienna, Austria, June 30, 2006},
  pages        = {189--200},
  year         = {2006},
  crossref     = {DBLP:conf/wises/2006},
  url          = {https://doi.org/10.1109/WISES.2006.329129},
  doi          = {10.1109/WISES.2006.329129},
  timestamp    = {Fri, 27 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/wises/IbanezSMS06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acivs/Sanchez-NielsenH05,
  author       = {Elena S{\'{a}}nchez{-}Nielsen and
                  Mario Hern{\'{a}}ndez{-}Tejera},
  title        = {Heuristic Algorithm for Computing Fast Template Motion in Video Streams},
  booktitle    = {Advanced Concepts for Intelligent Vision Systems, 7th International
                  Conference, {ACIVS} 2005, Antwerp, Belgium, September 20-23, 2005,
                  Proceedings},
  pages        = {547--554},
  year         = {2005},
  crossref     = {DBLP:conf/acivs/2005},
  url          = {https://doi.org/10.1007/11558484\_69},
  doi          = {10.1007/11558484\_69},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/acivs/Sanchez-NielsenH05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bvai/Sanchez-NielsenH05,
  author       = {Elena S{\'{a}}nchez{-}Nielsen and
                  Mario Hern{\'{a}}ndez{-}Tejera},
  title        = {Heuristic Algorithms for Fast and Accurate Tracking of Moving Objects
                  in Unrestricted Environments},
  booktitle    = {Brain, Vision, and Artificial Intelligence, First International Symposium,
                  {BVAI} 2005, Naples, Italy, October 19-21, 2005, Proceedings},
  pages        = {507--516},
  year         = {2005},
  crossref     = {DBLP:conf/bvai/2005},
  url          = {https://doi.org/10.1007/11565123\_49},
  doi          = {10.1007/11565123\_49},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/bvai/Sanchez-NielsenH05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/OsorioOPPJKG05,
  author       = {Ren{\'{e}} Osorio and
                  Marco Antonio Oliver{-}Salazar and
                  Mario Ponce{-}Silva and
                  Sergio Pinto and
                  Mario A. Ju{\'{a}}rez and
                  Reza Katebi and
                  M. J. Grimble},
  title        = {Analysis and Design of Discrete-Sliding-Mode Control for a Square-Waveform-Ballast},
  booktitle    = {44th {IEEE} {IEEE} Conference on Decision and Control and 8th European
                  Control Conference Control, {CDC/ECC} 2005, Seville, Spain, 12-15
                  December, 2005},
  pages        = {584--589},
  year         = {2005},
  crossref     = {DBLP:conf/cdc/2005},
  url          = {https://doi.org/10.1109/CDC.2005.1582219},
  doi          = {10.1109/CDC.2005.1582219},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/OsorioOPPJKG05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/PenaSP05,
  author       = {Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
                  Mario Sznaier and
                  Vicen{\c{c}} Puig},
  title        = {Robust Interpolation using Interval Structures},
  booktitle    = {44th {IEEE} {IEEE} Conference on Decision and Control and 8th European
                  Control Conference Control, {CDC/ECC} 2005, Seville, Spain, 12-15
                  December, 2005},
  pages        = {4983--4987},
  year         = {2005},
  crossref     = {DBLP:conf/cdc/2005},
  url          = {https://doi.org/10.1109/CDC.2005.1582951},
  doi          = {10.1109/CDC.2005.1582951},
  timestamp    = {Tue, 19 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/PenaSP05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/egc/GomesDMBGHKMMRDCSGSFLNLOWBNPWFFCFTXDACHSKRG05,
  author       = {Jorge A. T. Gomes and
                  M{\'{a}}rio David and
                  J. Martins and
                  Lu{\'{\i}}s Bernardo and
                  Ariel Garc{\'{\i}}a and
                  Markus Hardt and
                  Harald Kornmayer and
                  J. Marco and
                  R. Marco and
                  D. Rodr{\'{\i}}guez and
                  Iv{\'{a}}n D{\'{\i}}az and
                  D. Cano and
                  Jos{\'{e}} Salt and
                  S. Gonzalez and
                  Javier S{\'{a}}nchez and
                  Farida Fassi and
                  V. Lara and
                  P. Nyczyk and
                  Patryk Lason and
                  Andrzej Ozieblo and
                  Pawel Wolniewicz and
                  Michal Bluj and
                  Krzysztof Nawrocki and
                  Adam Padee and
                  Wojciech Wislicki and
                  C. Fern{\'{a}}ndez and
                  J. Font{\'{a}}n and
                  Yannis Cotronis and
                  Evangelos Floros and
                  George Tsouloupas and
                  Wei Xing and
                  Marios D. Dikaiakos and
                  J{\'{a}}n Astalos and
                  Brian A. Coghlan and
                  Elisa Heymann and
                  Miquel A. Senar and
                  C. Kanellopoulos and
                  A. Ramos and
                  Derek Groen},
  title        = {Experience with the International Testbed in the CrossGrid Project},
  booktitle    = {Advances in Grid Computing - {EGC} 2005, European Grid Conference,
                  Amsterdam, The Netherlands, February 14-16, 2005, Revised Selected
                  Papers},
  pages        = {98--110},
  year         = {2005},
  crossref     = {DBLP:conf/egc/2005},
  url          = {https://doi.org/10.1007/11508380\_12},
  doi          = {10.1007/11508380\_12},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/egc/GomesDMBGHKMMRDCSGSFLNLOWBNPWFFCFTXDACHSKRG05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ijcai/Sanchez-NielsenH05,
  author       = {Elena S{\'{a}}nchez{-}Nielsen and
                  Mario Hern{\'{a}}ndez{-}Tejera},
  title        = {An Heuristic Search based Approach for Moving Objects Tracking},
  booktitle    = {IJCAI-05, Proceedings of the Nineteenth International Joint Conference
                  on Artificial Intelligence, Edinburgh, Scotland, UK, July 30 - August
                  5, 2005},
  pages        = {1736--1737},
  year         = {2005},
  crossref     = {DBLP:conf/ijcai/2005},
  url          = {http://ijcai.org/Proceedings/05/Papers/post-0184.pdf},
  timestamp    = {Tue, 20 Aug 2019 16:16:29 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcai/Sanchez-NielsenH05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/idea/encyclopedia2005/BarcaMVM05,
  author       = {Jos{\'{e}} Mar{\'{\i}}a Cavero Barca and
                  Esperanza Marcos Mart{\'{\i}}nez and
                  Mario Piattini and
                  Adolfo Sanchez de Miguel},
  title        = {Data Warehouse Development},
  booktitle    = {Encyclopedia of Information Science and Technology {(5} Volumes)},
  pages        = {729--733},
  year         = {2005},
  crossref     = {DBLP:books/idea/Ency05},
  url          = {http://www.igi-global.com/Bookstore/Chapter.aspx?TitleId=14326},
  timestamp    = {Sun, 09 Jul 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/books/idea/encyclopedia2005/BarcaMVM05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/EchavarriaSPCC04,
  author       = {Rodolfo Echavarr{\'{\i}}a and
                  Victor M. Sanchez and
                  Mario Ponce and
                  Maria Cotorogea and
                  Abraham Claudio},
  title        = {Analysis And Design Of {A} Quasi-Resonant Fast On-Load Tap Changing
                  Regulator},
  journal      = {J. Circuits Syst. Comput.},
  volume       = {13},
  number       = {4},
  pages        = {877--899},
  year         = {2004},
  url          = {https://doi.org/10.1142/S0218126604001738},
  doi          = {10.1142/S0218126604001738},
  timestamp    = {Tue, 28 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jcsc/EchavarriaSPCC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsp/FernandezPAP04,
  author       = {Matilde S{\'{a}}nchez Fern{\'{a}}ndez and
                  Mario de Prado{-}Cumplido and
                  Jer{\'{o}}nimo Arenas{-}Garc{\'{\i}}a and
                  Fernando P{\'{e}}rez{-}Cruz},
  title        = {{SVM} multiregression for nonlinear channel estimation in multiple-input
                  multiple-output systems},
  journal      = {{IEEE} Trans. Signal Process.},
  volume       = {52},
  number       = {8},
  pages        = {2298--2307},
  year         = {2004},
  url          = {https://doi.org/10.1109/TSP.2004.831028},
  doi          = {10.1109/TSP.2004.831028},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tsp/FernandezPAP04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wscg/Sanchez-NielsenAH04,
  author       = {Elena S{\'{a}}nchez{-}Nielsen and
                  Luis Ant{\'{o}}n{-}Canal{\'{\i}}s and
                  Mario Hern{\'{a}}ndez{-}Tejera},
  title        = {Hand Gesture Recognition for Human-Machine Interaction},
  booktitle    = {The 12-th International Conference in Central Europe on Computer Graphics,
                  Visualization and Computer Vision'2004, {WSCG} 2004, University of
                  West Bohemia, Campus Bory, Plzen-Bory, Czech Republic, February 2-6,
                  2004},
  pages        = {395--402},
  year         = {2004},
  crossref     = {DBLP:conf/wscg/2004},
  timestamp    = {Wed, 24 Jul 2013 17:32:33 +0200},
  biburl       = {https://dblp.org/rec/conf/wscg/Sanchez-NielsenAH04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/cs-PL-0404050,
  author       = {Puri Arenas{-}S{\'{a}}nchez and
                  Mario Rodr{\'{\i}}guez{-}Artalejo},
  title        = {A General Framework For Lazy Functional Logic Programming With Algebraic
                  Polymorphic Types},
  journal      = {CoRR},
  volume       = {cs.PL/0404050},
  year         = {2004},
  url          = {http://arxiv.org/abs/cs/0404050},
  timestamp    = {Fri, 10 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/cs-PL-0404050.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcmc/ClimentMOSSTV03,
  author       = {Salvador Climent and
                  Joaquim Mor{\'{e}} and
                  Antoni Oliver and
                  M{\'{\i}}riam Salvatierra and
                  Imma S{\`{a}}nchez and
                  Mariona Taul{\'{e}} and
                  Llu{\"{\i}}sa Vallmanya},
  title        = {Bilingual Newsgroups in Catalonia: {A} Challenge for Machine Translation},
  journal      = {J. Comput. Mediat. Commun.},
  volume       = {9},
  number       = {1},
  pages        = {0},
  year         = {2003},
  url          = {https://doi.org/10.1111/j.1083-6101.2003.tb00360.x},
  doi          = {10.1111/J.1083-6101.2003.TB00360.X},
  timestamp    = {Thu, 01 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcmc/ClimentMOSSTV03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pdln/AdurizAAABCCIFGHMMMMMMMNOPPPRSSSST03,
  author       = {Itziar Aduriz and
                  Alicia Ageno and
                  Bertol Arrieta and
                  Jose Maria Arriola and
                  Empar Bisbal and
                  N{\'{u}}ria Castell and
                  Montserrat Civit and
                  Arantza D{\'{\i}}az de Ilarraza and
                  Bel{\'{e}}n Fern{\'{a}}ndez and
                  Koldo Gojenola and
                  Reda Halkoum and
                  Raquel Marcos and
                  Llu{\'{\i}}s M{\`{a}}rquez and
                  Maria Ant{\`{o}}nia Mart{\'{\i}} and
                  Patricio Mart{\'{\i}}nez{-}Barco and
                  Antonio Molina and
                  Paloma Moreda and
                  Lidia Moreno and
                  Borja Navarro and
                  Maite Oronoz and
                  Llu{\'{\i}}s Padr{\'{o}} and
                  Manuel Palomar and
                  Ferran Pla and
                  Horacio Rodr{\'{\i}}guez and
                  Maximiliano Saiz{-}Noeda and
                  Emilio Sanchis and
                  Kepa Sarasola and
                  Armando Su{\'{a}}rez and
                  Mariona Taul{\'{e}}},
  title        = {3LB: Construcci{\'{o}}n de una base de datos de {\'{a}}rboles
                  sint{\'{a}}ctico sem{\'{a}}nticos},
  journal      = {Proces. del Leng. Natural},
  volume       = {31},
  year         = {2003},
  url          = {http://journal.sepln.org/sepln/ojs/ojs/index.php/pln/article/view/3179/1670},
  timestamp    = {Thu, 09 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pdln/AdurizAAABCCIFGHMMMMMMMNOPPPRSSSST03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eagc/GomesDMBMMRSGSFHGNOWBNPWFFGLCFTXDACHSMKA03,
  author       = {Jorge A. T. Gomes and
                  M{\'{a}}rio David and
                  J. Martins and
                  Lu{\'{\i}}s Bernardo and
                  J. Marco and
                  R. Marco and
                  D. Rodr{\'{\i}}guez and
                  Jos{\'{e}} Salt and
                  S. Gonzalez and
                  Javier S{\'{a}}nchez and
                  A. Fuentes and
                  Markus Hardt and
                  Ariel Garc{\'{\i}}a and
                  P. Nyczyk and
                  Andrzej Ozieblo and
                  Pawel Wolniewicz and
                  Michal Bluj and
                  Krzysztof Nawrocki and
                  Adam Padee and
                  Wojciech Wislicki and
                  C. Fern{\'{a}}ndez and
                  J. Font{\'{a}}n and
                  A. G{\'{o}}mez and
                  I. L{\'{o}}pez and
                  Yannis Cotronis and
                  Evangelos Floros and
                  George Tsouloupas and
                  Wei Xing and
                  Marios D. Dikaiakos and
                  J{\'{a}}n Astalos and
                  Brian A. Coghlan and
                  Elisa Heymann and
                  Miquel A. Senar and
                  Gonzalo Merino and
                  C. Kanellopoulos and
                  G. Dick van Albada},
  title        = {First Prototype of the CrossGrid Testbed},
  booktitle    = {Grid Computing, First European Across Grids Conference, Santiago de
                  Compostela, Spain, February 13-14, 2003, Revised Papers},
  pages        = {67--77},
  year         = {2003},
  crossref     = {DBLP:conf/eagc/2003},
  url          = {https://doi.org/10.1007/978-3-540-24689-3\_9},
  doi          = {10.1007/978-3-540-24689-3\_9},
  timestamp    = {Sun, 12 Nov 2023 02:12:58 +0100},
  biburl       = {https://dblp.org/rec/conf/eagc/GomesDMBMMRSGSFHGNOWBNPWFFGLCFTXDACHSMKA03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/EchavarriaSPCC02,
  author       = {Rodolfo Echavarr{\'{\i}}a and
                  Victor M. Sanchez and
                  Mario Ponce and
                  Maria Cotorogea and
                  Abraham Claudio},
  title        = {Analysis of a power topology for a quasi-resonant fast on-load tap
                  changing regulator},
  booktitle    = {Proceedings of the 2002 International Symposium on Circuits and Systems,
                  {ISCAS} 2002, Scottsdale, Arizona, USA, May 26-29, 2002},
  pages        = {837--840},
  year         = {2002},
  crossref     = {DBLP:conf/iscas/2002},
  url          = {https://doi.org/10.1109/ISCAS.2002.1010834},
  doi          = {10.1109/ISCAS.2002.1010834},
  timestamp    = {Tue, 28 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iscas/EchavarriaSPCC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcst/InancSPP01,
  author       = {Tamer Inanc and
                  Mario Sznaier and
                  Pablo A. Parrilo and
                  Ricardo S. S{\'{a}}nchez Pe{\~{n}}a},
  title        = {Robust identification with mixed parametric/nonparametric models and
                  time/frequency-domain experiments: theory and an application},
  journal      = {{IEEE} Trans. Control. Syst. Technol.},
  volume       = {9},
  number       = {4},
  pages        = {608--617},
  year         = {2001},
  url          = {https://doi.org/10.1109/87.930971},
  doi          = {10.1109/87.930971},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcst/InancSPP01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tplp/Arenas-SanchezR01,
  author       = {Puri Arenas{-}S{\'{a}}nchez and
                  Mario Rodr{\'{\i}}guez{-}Artalejo},
  title        = {A General Framework for Lazy Functional Logic, Programming with Algebraic
                  Polymorphic Types},
  journal      = {Theory Pract. Log. Program.},
  volume       = {1},
  number       = {2},
  pages        = {185--245},
  year         = {2001},
  url          = {http://journals.cambridge.org/action/displayAbstract?aid=74981},
  timestamp    = {Thu, 13 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tplp/Arenas-SanchezR01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iciap/NielsenLH01,
  author       = {Elena S{\'{a}}nchez{-}Nielsen and
                  Javier Lorenzo{-}Navarro and
                  Mario Hern{\'{a}}ndez{-}Tejera},
  title        = {Increasing Efficiency of Hausdorff Approach for Tracking Real Scenes
                  with Complex Environments},
  booktitle    = {11th International Conference on Image Analysis and Processing {(ICIAP}
                  2001), 26-28 September 2001, Palermo, Italy},
  pages        = {131--136},
  year         = {2001},
  crossref     = {DBLP:conf/iciap/2001},
  url          = {https://doi.org/10.1109/ICIAP.2001.956997},
  doi          = {10.1109/ICIAP.2001.956997},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iciap/NielsenLH01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tac/ParriloPS99,
  author       = {Pablo A. Parrilo and
                  Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
                  Mario Sznaier},
  title        = {A parametric extension of mixed time/frequency robust identification},
  journal      = {{IEEE} Trans. Autom. Control.},
  volume       = {44},
  number       = {2},
  pages        = {364--369},
  year         = {1999},
  url          = {https://doi.org/10.1109/9.746267},
  doi          = {10.1109/9.746267},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tac/ParriloPS99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/infocom/PazosSG99,
  author       = {Carlos M. D. Pazos and
                  Juan C. Sanchez{-}Agrelo and
                  Mario Gerla},
  title        = {Using Back-Pressure to Improve {TCP} Performance with Many Flows},
  booktitle    = {Proceedings {IEEE} {INFOCOM} '99, The Conference on Computer Communications,
                  Eighteenth Annual Joint Conference of the {IEEE} Computer and Communications
                  Societies, The Future Is Now, New York, NY, USA, March 21-25, 1999},
  pages        = {431--438},
  year         = {1999},
  crossref     = {DBLP:conf/infocom/1999},
  url          = {https://doi.org/10.1109/INFCOM.1999.751375},
  doi          = {10.1109/INFCOM.1999.751375},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/infocom/PazosSG99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscas/TeschPBS99,
  author       = {Bruce J. Tesch and
                  Philip M. Pratt and
                  Kanti Bacrania and
                  Mario Sanchez},
  title        = {A 14-b, 125 {MSPS} digital-to-analog converter and bandgap voltage
                  reference in 0.5 um {CMOS}},
  booktitle    = {Proceedings of the 1999 International Symposium on Circuits and Systems,
                  {ISCAS} 1999, Orlando, Florida, USA, May 30 - June 2, 1999},
  pages        = {452--455},
  year         = {1999},
  crossref     = {DBLP:conf/iscas/1999},
  url          = {https://doi.org/10.1109/ISCAS.1999.780765},
  doi          = {10.1109/ISCAS.1999.780765},
  timestamp    = {Wed, 03 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iscas/TeschPBS99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ppdp/Arenas-SanchezLR99,
  author       = {Puri Arenas{-}S{\'{a}}nchez and
                  Francisco Javier L{\'{o}}pez{-}Fraguas and
                  Mario Rodr{\'{u}}guez{-}Arteljo},
  title        = {Functional Plus Logic Programming with Built-In and Symbolic Constraints},
  booktitle    = {Principles and Practice of Declarative Programming, International
                  Conference PPDP'99, Paris, France, September 29 - October 1, 1999,
                  Proceedings},
  pages        = {152--169},
  year         = {1999},
  crossref     = {DBLP:conf/ppdp/1999},
  url          = {https://doi.org/10.1007/10704567\_9},
  doi          = {10.1007/10704567\_9},
  timestamp    = {Tue, 14 May 2019 10:00:46 +0200},
  biburl       = {https://dblp.org/rec/conf/ppdp/Arenas-SanchezLR99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/ParriloSPI98,
  author       = {Pablo A. Parrilo and
                  Mario Sznaier and
                  Ricardo S. S{\'{a}}nchez Pe{\~{n}}a and
                  Tamer Inanc},
  title        = {Mixed Time/Frequency-Domain Based Robust Identification},
  journal      = {Autom.},
  volume       = {34},
  number       = {11},
  pages        = {1375--1389},
  year         = {1998},
  url          = {https://doi.org/10.1016/S0005-1098(98)00083-1},
  doi          = {10.1016/S0005-1098(98)00083-1},
  timestamp    = {Sun, 04 Aug 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/automatica/ParriloSPI98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/plilp/Arenas-SanchezLR98,
  author       = {Puri Arenas{-}S{\'{a}}nchez and
                  Francisco Javier L{\'{o}}pez{-}Fraguas and
                  Mario Rodr{\'{u}}guez{-}Arteljo},
  title        = {Embedding Multiset Constraints into a Lazy Functional Logic Language},
  booktitle    = {Principles of Declarative Programming, 10th International Symposium,
                  PLILP'98 Held Jointly with the 7th International Conference, ALP'98,
                  Pisa, Italy, September 16-18, 1998, Proceedings},
  pages        = {429--444},
  year         = {1998},
  crossref     = {DBLP:conf/plilp/1998},
  url          = {https://doi.org/10.1007/BFb0056631},
  doi          = {10.1007/BFB0056631},
  timestamp    = {Tue, 14 May 2019 10:00:35 +0200},
  biburl       = {https://dblp.org/rec/conf/plilp/Arenas-SanchezLR98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/slp/Arenas-SanchezR97,
  author       = {Puri Arenas{-}S{\'{a}}nchez and
                  Mario Rodr{\'{\i}}guez{-}Artalejo},
  title        = {A Lazy Narrowing Calculus for Functional Logic Programming with Algebraic
                  Polymorphic Types},
  booktitle    = {Logic Programming, Proceedings of the 1997 International Symposium,
                  Port Jefferson, Long Island, NY, USA, October 13-16, 1997},
  pages        = {53--67},
  year         = {1997},
  crossref     = {DBLP:conf/slp/1997},
  timestamp    = {Fri, 10 Jul 2015 12:20:33 +0200},
  biburl       = {https://dblp.org/rec/conf/slp/Arenas-SanchezR97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/tapsoft/Arenas-SanchezR97,
  author       = {Puri Arenas{-}S{\'{a}}nchez and
                  Mario Rodr{\'{\i}}guez{-}Artalejo},
  title        = {A Semantic Framework for Functional Logic Programming with Algebraic
                  Polymorphic Types},
  booktitle    = {TAPSOFT'97: Theory and Practice of Software Development, 7th International
                  Joint Conference CAAP/FASE, Lille, France, April 14-18, 1997, Proceedings},
  pages        = {453--464},
  year         = {1997},
  crossref     = {DBLP:conf/tapsoft/1997},
  url          = {https://doi.org/10.1007/BFb0030618},
  doi          = {10.1007/BFB0030618},
  timestamp    = {Tue, 14 May 2019 10:00:50 +0200},
  biburl       = {https://dblp.org/rec/conf/tapsoft/Arenas-SanchezR97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/time/SanchezS96,
  author       = {Mario R. S{\'{a}}nchez and
                  Anil M. Shende},
  title        = {Time Accountability for Lattice Computers},
  booktitle    = {Proceedings of the Third International Workshop on Temporal Representation
                  and Reasoning, TIME-96, Key West, Florida, USA, May 19-20, 1996},
  pages        = {211--216},
  year         = {1996},
  crossref     = {DBLP:conf/time/1996},
  url          = {https://doi.org/10.1109/TIME.1996.555702},
  doi          = {10.1109/TIME.1996.555702},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/time/SanchezS96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigmod/RisheSBDOALOSS95,
  author       = {Naphtali Rishe and
                  Wei Sun and
                  David Barton and
                  Yi Deng and
                  Cyril U. Orji and
                  Michael Alexopoulos and
                  Leonard Loureiro and
                  Carlos Ordonez and
                  Mario R. S{\'{a}}nchez and
                  Artyom Shaposhnikov},
  title        = {Florida International University High Performance Database Research
                  Center},
  journal      = {{SIGMOD} Rec.},
  volume       = {24},
  number       = {3},
  pages        = {71--76},
  year         = {1995},
  url          = {https://doi.org/10.1145/211990.212019},
  doi          = {10.1145/211990.212019},
  timestamp    = {Thu, 20 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigmod/RisheSBDOALOSS95.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cbms/2024,
  editor       = {Gilberto Ochoa{-}Ruiz and
                  Enrico Grisan and
                  Sharib Ali and
                  Rosa Sicilia and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Bridget Kane and
                  Christian Daul and
                  Gildardo S{\'{a}}nchez{-}Ante and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {37th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2024, Guadalajara, Mexico, June 26-28, 2024},
  publisher    = {{IEEE}},
  year         = {2024},
  url          = {https://doi.org/10.1109/CBMS61543.2024},
  doi          = {10.1109/CBMS61543.2024},
  isbn         = {979-8-3503-8472-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/2024.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/clihc/2023,
  title        = {Proceedings of the {XI} Latin American Conference on Human Computer
                  Interaction, {CLIHC} 2023, Puebla, Mexico, 30 October 2023- 1 November
                  2023},
  publisher    = {{ACM}},
  year         = {2023},
  url          = {https://doi.org/10.1145/3630970},
  doi          = {10.1145/3630970},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/clihc/2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/edoc/2023w,
  editor       = {Tiago Prince Sales and
                  Sybren de Kinderen and
                  Henderik A. Proper and
                  Luise Pufahl and
                  Dimka Karastoyanova and
                  Marten van Sinderen},
  title        = {Enterprise Design, Operations, and Computing. {EDOC} 2023 Workshops
                  - IDAMS, iRESEARCH, MIDas4CS, SoEA4EE, {EDOC} Forum, Demonstrations
                  Track and Doctoral Consortium, Groningen, The Netherlands, October
                  30 - November 3, 2023, Revised Selected Papers},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {498},
  publisher    = {Springer},
  year         = {2024},
  url          = {https://doi.org/10.1007/978-3-031-54712-6},
  doi          = {10.1007/978-3-031-54712-6},
  isbn         = {978-3-031-54711-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/edoc/2023w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icaisc/2023-1,
  editor       = {Leszek Rutkowski and
                  Rafal Scherer and
                  Marcin Korytkowski and
                  Witold Pedrycz and
                  Ryszard Tadeusiewicz and
                  Jacek M. Zurada},
  title        = {Artificial Intelligence and Soft Computing - 22nd International Conference,
                  {ICAISC} 2023, Zakopane, Poland, June 18-22, 2023, Proceedings, Part
                  {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {14125},
  publisher    = {Springer},
  year         = {2023},
  url          = {https://doi.org/10.1007/978-3-031-42505-9},
  doi          = {10.1007/978-3-031-42505-9},
  isbn         = {978-3-031-42504-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icaisc/2023-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceee/2023,
  title        = {20th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2023, Mexico City, Mexico, October
                  25-27, 2023},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CCE60043.2023},
  doi          = {10.1109/CCE60043.2023},
  isbn         = {979-8-3503-0676-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/igarss/2023,
  title        = {{IEEE} International Geoscience and Remote Sensing Symposium, {IGARSS}
                  2023, Pasadena, CA, USA, July 16-21, 2023},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/IGARSS52108.2023},
  doi          = {10.1109/IGARSS52108.2023},
  isbn         = {979-8-3503-2010-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/vts/2023,
  title        = {41st {IEEE} {VLSI} Test Symposium, {VTS} 2023, San Diego, CA, USA,
                  April 24-26, 2023},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/VTS56346.2023},
  doi          = {10.1109/VTS56346.2023},
  isbn         = {979-8-3503-4630-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/vts/2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/23/CGVS2023,
  editor       = {Franco Cicirelli and
                  Antonio Guerrieri and
                  Andrea Vinci and
                  Giandomenico Spezzano},
  title        = {IoT Edge Solutions for Cognitive Buildings - Technology, Communications
                  and Computing},
  publisher    = {Springer},
  year         = {2023},
  url          = {https://doi.org/10.1007/978-3-031-15160-6},
  doi          = {10.1007/978-3-031-15160-6},
  isbn         = {978-3-031-15159-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/books/sp/23/CGVS2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/embc/2022,
  title        = {44th Annual International Conference of the {IEEE} Engineering in
                  Medicine {\&} Biology Society, {EMBC} 2022, Glasgow, Scotland,
                  United Kingdom, July 11-15, 2022},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/EMBC48229.2022},
  doi          = {10.1109/EMBC48229.2022},
  isbn         = {978-1-7281-2782-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscas/2022,
  title        = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2022,
                  Austin, TX, USA, May 27 - June 1, 2022},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/ISCAS48785.2022},
  doi          = {10.1109/ISCAS48785.2022},
  isbn         = {978-1-6654-8485-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/micai/2022-1,
  editor       = {Obdulia Pichardo{-}Lagunas and
                  Juan Mart{\'{\i}}nez{-}Miranda and
                  Bella Mart{\'{\i}}nez{-}Seis},
  title        = {Advances in Computational Intelligence - 21st Mexican International
                  Conference on Artificial Intelligence, {MICAI} 2022, Monterrey, Mexico,
                  October 24-29, 2022, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13612},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-19493-1},
  doi          = {10.1007/978-3-031-19493-1},
  isbn         = {978-3-031-19492-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/2022-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/riiforum/2022,
  editor       = {Anna Visvizi and
                  Orlando Troisi and
                  Mara Grimaldi},
  title        = {Research and Innovation Forum 2022: Rupture, Resilience and Recovery
                  in the Post-Covid World, {RIIFORUM} 2022, Athens, Greece, April 20-22,
                  2022},
  series       = {Springer Proceedings in Complexity},
  publisher    = {Springer},
  year         = {2023},
  url          = {https://doi.org/10.1007/978-3-031-19560-0},
  doi          = {10.1007/978-3-031-19560-0},
  isbn         = {978-3-031-19560-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/riiforum/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigcomm/2022,
  editor       = {Fernando Kuipers and
                  Ariel Orda},
  title        = {{SIGCOMM} '22: {ACM} {SIGCOMM} 2022 Conference, Amsterdam, The Netherlands,
                  August 22 - 26, 2022},
  publisher    = {{ACM}},
  year         = {2022},
  url          = {https://doi.org/10.1145/3544216},
  doi          = {10.1145/3544216},
  isbn         = {978-1-4503-9420-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcomm/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/bmsd/2021,
  editor       = {Boris Shishkov},
  title        = {Business Modeling and Software Design - 11th International Symposium,
                  {BMSD} 2021, Sofia, Bulgaria, July 5-7, 2021, Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {422},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-79976-2},
  doi          = {10.1007/978-3-030-79976-2},
  isbn         = {978-3-030-79975-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/bmsd/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caip/2021-1,
  editor       = {Nicolas Tsapatsoulis and
                  Andreas Panayides and
                  Theo Theocharides and
                  Andreas Lanitis and
                  Constantinos S. Pattichis and
                  Mario Vento},
  title        = {Computer Analysis of Images and Patterns - 19th International Conference,
                  {CAIP} 2021, Virtual Event, September 28-30, 2021, Proceedings, Part
                  {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13052},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-89128-2},
  doi          = {10.1007/978-3-030-89128-2},
  isbn         = {978-3-030-89127-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/caip/2021-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cbms/2021,
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Linlin Shen and
                  Bridget Kane and
                  Agma J. M. Traina and
                  Paolo Soda and
                  Jos{\'{e}} Lu{\'{\i}}s Oliveira},
  title        = {34th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2021, Aveiro, Portugal, June 7-9, 2021},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/CBMS52027.2021},
  doi          = {10.1109/CBMS52027.2021},
  isbn         = {978-1-6654-4121-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/fie/2021,
  title        = {{IEEE} Frontiers in Education Conference, {FIE} 2021, Lincoln, NE,
                  USA, October 13-16, 2021},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/FIE49875.2021},
  doi          = {10.1109/FIE49875.2021},
  isbn         = {978-1-6654-3851-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/fie/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icai2/2021,
  editor       = {Hector Florez and
                  Mar{\'{\i}}a Florencia Pollo Cattaneo},
  title        = {Applied Informatics - Fourth International Conference, {ICAI} 2021,
                  Buenos Aires, Argentina, October 28-30, 2021, Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {1455},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-89654-6},
  doi          = {10.1007/978-3-030-89654-6},
  isbn         = {978-3-030-89653-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icai2/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceee/2021,
  title        = {18th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2021, Mexico City, Mexico, November
                  10-12, 2021},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/CCE53527.2021},
  doi          = {10.1109/CCE53527.2021},
  isbn         = {978-1-6654-0029-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iwann/2021-2,
  editor       = {Ignacio Rojas and
                  Gonzalo Joya and
                  Andreu Catal{\`{a}}},
  title        = {Advances in Computational Intelligence - 16th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2021, Virtual Event, June 16-18,
                  2021, Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {12862},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-85099-9},
  doi          = {10.1007/978-3-030-85099-9},
  isbn         = {978-3-030-85098-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/2021-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/micai/2021-1,
  editor       = {Ildar Z. Batyrshin and
                  Alexander F. Gelbukh and
                  Grigori Sidorov},
  title        = {Advances in Computational Intelligence - 20th Mexican International
                  Conference on Artificial Intelligence, {MICAI} 2021, Mexico City,
                  Mexico, October 25-30, 2021, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13067},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-89817-5},
  doi          = {10.1007/978-3-030-89817-5},
  isbn         = {978-3-030-89816-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/2021-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ondm/2021,
  title        = {International Conference on Optical Network Design and Modeling, {ONDM}
                  2021, Gothenburg, Sweden, June 28 - July 1, 2021},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.23919/ONDM51796.2021},
  doi          = {10.23919/ONDM51796.2021},
  isbn         = {978-3-9031-7633-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ondm/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/vcip/2021,
  title        = {International Conference on Visual Communications and Image Processing,
                  {VCIP} 2021, Munich, Germany, December 5-8, 2021},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/VCIP53242.2021},
  doi          = {10.1109/VCIP53242.2021},
  isbn         = {978-1-7281-8551-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/vcip/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/worldcist/2021-2,
  editor       = {{\'{A}}lvaro Rocha and
                  Hojjat Adeli and
                  Gintautas Dzemyda and
                  Fernando Moreira and
                  Ana Maria Ramalho Correia},
  title        = {Trends and Applications in Information Systems and Technologies -
                  Volume 2, WorldCIST 2021, Terceira Island, Azores, Portugal, 30 March
                  - 2 April, 2021},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {1366},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-72651-5},
  doi          = {10.1007/978-3-030-72651-5},
  isbn         = {978-3-030-72650-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/worldcist/2021-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ahfe/2020-15,
  editor       = {Waldemar Karwowski and
                  Ravindra S. Goonetilleke and
                  Shuping Xiong and
                  Richard H. M. Goossens and
                  Atsuo Murata},
  title        = {Advances in Physical, Social {\&} Occupational Ergonomics - Proceedings
                  of the {AHFE} 2020 Virtual Conferences on Physical Ergonomics and
                  Human Factors, Social {\&} Occupational Ergonomics and Cross-Cultural
                  Decision Making, July 16-20, 2020, {USA}},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {1215},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-51549-2},
  doi          = {10.1007/978-3-030-51549-2},
  isbn         = {978-3-030-51548-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ahfe/2020-15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cec/2020,
  title        = {{IEEE} Congress on Evolutionary Computation, {CEC} 2020, Glasgow,
                  United Kingdom, July 19-24, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9178820/proceeding},
  isbn         = {978-1-7281-6929-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/cec/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cosecivi/2020,
  editor       = {Ra{\'{u}}l Lara{-}Cabrera and
                  Antonio Jos{\'{e}} Fern{\'{a}}ndez Leiva},
  title        = {Proceedings of the {VI} Congreso de la Sociedad Espa{\~{n}}ola para
                  las Ciencias del Videojuego, On-line, October 7-8, 2020},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {2719},
  publisher    = {CEUR-WS.org},
  year         = {2020},
  url          = {https://ceur-ws.org/Vol-2719},
  urn          = {urn:nbn:de:0074-2719-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/cosecivi/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icassp/2020,
  title        = {2020 {IEEE} International Conference on Acoustics, Speech and Signal
                  Processing, {ICASSP} 2020, Barcelona, Spain, May 4-8, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9040208/proceeding},
  isbn         = {978-1-5090-6631-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icecsys/2020,
  title        = {27th {IEEE} International Conference on Electronics, Circuits and
                  Systems, {ICECS} 2020, Glasgow, Scotland, UK, November 23-25, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/ICECS49266.2020},
  doi          = {10.1109/ICECS49266.2020},
  isbn         = {978-1-7281-6044-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icecsys/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceee/2020,
  title        = {17th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2020, Mexico City, Mexico, November
                  11-13, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/CCE50788.2020},
  doi          = {10.1109/CCE50788.2020},
  isbn         = {978-1-7281-8987-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icict2/2020,
  title        = {3rd International Conference on Information and Computer Technologies,
                  {ICICT} 2020, San Jose, CA, USA, March 9-12, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9086668/proceeding},
  isbn         = {978-1-7281-7283-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icict2/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icip/2020,
  title        = {{IEEE} International Conference on Image Processing, {ICIP} 2020,
                  Abu Dhabi, United Arab Emirates, October 25-28, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9184803/proceeding?isnumber=9190635},
  isbn         = {978-1-7281-6396-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscas/2020,
  title        = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2020,
                  Sevilla, Spain, October 10-21, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/ISCAS45731.2020},
  doi          = {10.1109/ISCAS45731.2020},
  isbn         = {978-1-7281-3320-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iticse/2020,
  editor       = {Michail N. Giannakos and
                  Guttorm Sindre and
                  Andrew Luxton{-}Reilly and
                  Monica Divitini},
  title        = {Proceedings of the 2020 {ACM} Conference on Innovation and Technology
                  in Computer Science Education, ITiCSE 2020, Trondheim, Norway, June
                  15-19, 2020},
  publisher    = {{ACM}},
  year         = {2020},
  url          = {https://doi.org/10.1145/3341525},
  doi          = {10.1145/3341525},
  isbn         = {978-1-4503-6874-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iticse/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/micai/2020-1,
  editor       = {Lourdes Mart{\'{\i}}nez{-}Villase{\~{n}}or and
                  Oscar Herrera{-}Alc{\'{a}}ntara and
                  Hiram E. Ponce and
                  F{\'{e}}lix Castro{-}Espinoza},
  title        = {Advances in Soft Computing - 19th Mexican International Conference
                  on Artificial Intelligence, {MICAI} 2020, Mexico City, Mexico, October
                  12-17, 2020, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {12468},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-60884-2},
  doi          = {10.1007/978-3-030-60884-2},
  isbn         = {978-3-030-60883-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/2020-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ssci/2020,
  title        = {2020 {IEEE} Symposium Series on Computational Intelligence, {SSCI}
                  2020, Canberra, Australia, December 1-4, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/SSCI47803.2020},
  doi          = {10.1109/SSCI47803.2020},
  isbn         = {978-1-7281-2547-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ssci/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ssiai/2020,
  title        = {{IEEE} Southwest Symposium on Image Analysis and Interpretation, {SSIAI}
                  2020, Albuquerque, NM, USA, March 29-31, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9092968/proceeding},
  isbn         = {978-1-7281-5745-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ssiai/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caise/2019fo,
  editor       = {Cinzia Cappiello and
                  Marcela Ruiz},
  title        = {Information Systems Engineering in Responsible Information Systems
                  - CAiSE Forum 2019, Rome, Italy, June 3-7, 2019, Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {350},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-21297-1},
  doi          = {10.1007/978-3-030-21297-1},
  isbn         = {978-3-030-21296-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/2019fo.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cisis-spain/2019,
  editor       = {Francisco Mart{\'{\i}}nez{-}{\'{A}}lvarez and
                  Alicia Troncoso Lora and
                  Jos{\'{e}} Ant{\'{o}}nio S{\'{a}}ez Mu{\~{n}}oz and
                  H{\'{e}}ctor Quinti{\'{a}}n and
                  Emilio Corchado},
  title        = {International Joint Conference: 12th International Conference on Computational
                  Intelligence in Security for Information Systems {(CISIS} 2019) and
                  10th International Conference on EUropean Transnational Education
                  {(ICEUTE} 2019) - Seville, Spain, May 13-15, 2019, Proceedings},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {951},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-20005-3},
  doi          = {10.1007/978-3-030-20005-3},
  isbn         = {978-3-030-20004-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/cisis-spain/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/citi/2019,
  editor       = {Rafael Valencia{-}Garc{\'{\i}}a and
                  Gema Alcaraz{-}M{\'{a}}rmol and
                  Javier del Cioppo{-}Morstadt and
                  N{\'{e}}stor Vera{-}Lucio and
                  Martha Bucaram{-}Leverone},
  title        = {Technologies and Innovation - 5th International Conference, {CITI}
                  2019, Guayaquil, Ecuador, December 2-5, 2019, Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {1124},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-34989-9},
  doi          = {10.1007/978-3-030-34989-9},
  isbn         = {978-3-030-34988-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/citi/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/clei/2019,
  title        = {{XLV} Latin American Computing Conference, {CLEI} 2019, Panama, September
                  30 - October 4, 2019},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9042768/proceeding},
  isbn         = {978-1-7281-5574-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/clei/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/conielecomp/2019,
  title        = {International Conference on Electronics, Communications and Computers,
                  {CONIELECOMP} 2019, Cholula, Mexico, February 27 - March 1, 2019},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8671596/proceeding},
  isbn         = {978-1-7281-1145-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/conielecomp/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hci-collab/2019,
  editor       = {Pablo H. Ruiz and
                  Vanessa Agredo Delgado},
  title        = {Human-Computer Interaction - 5th Iberoamerican Workshop, HCI-Collab
                  2019, Puebla, Mexico, June 19-21, 2019, Revised Selected Papers},
  series       = {Communications in Computer and Information Science},
  volume       = {1114},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-37386-3},
  doi          = {10.1007/978-3-030-37386-3},
  isbn         = {978-3-030-37385-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/hci-collab/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceee/2019,
  title        = {16th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2019, Mexico City, Mexico, September
                  11-13, 2019},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8869547/proceeding},
  isbn         = {978-1-7281-4840-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/igarss/2019,
  title        = {2019 {IEEE} International Geoscience and Remote Sensing Symposium,
                  {IGARSS} 2019, Yokohama, Japan, July 28 - August 2, 2019},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8891871/proceeding},
  isbn         = {978-1-5386-9154-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscas/2019,
  title        = {{IEEE} International Symposium on Circuits and Systems, {ISCAS} 2019,
                  Sapporo, Japan, May 26-29, 2019},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8682239/proceeding},
  isbn         = {978-1-7281-0397-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iwann/2019-2,
  editor       = {Ignacio Rojas and
                  Gonzalo Joya and
                  Andreu Catal{\`{a}}},
  title        = {Advances in Computational Intelligence - 15th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
                  June 12-14, 2019, Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {11507},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-20518-8},
  doi          = {10.1007/978-3-030-20518-8},
  isbn         = {978-3-030-20517-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/2019-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iwann/2019-1,
  editor       = {Ignacio Rojas and
                  Gonzalo Joya and
                  Andreu Catal{\`{a}}},
  title        = {Advances in Computational Intelligence - 15th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2019, Gran Canaria, Spain,
                  June 12-14, 2019, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {11506},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-20521-8},
  doi          = {10.1007/978-3-030-20521-8},
  isbn         = {978-3-030-20520-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/2019-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/CRP2019,
  editor       = {Sergio Consoli and
                  Diego Reforgiato Recupero and
                  Milan Petkovic},
  title        = {Data Science for Healthcare - Methodologies and Applications},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-05249-2},
  doi          = {10.1007/978-3-030-05249-2},
  isbn         = {978-3-030-05248-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/books/sp/CRP2019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/amcis/2018,
  title        = {24th Americas Conference on Information Systems, {AMCIS} 2018, New
                  Orleans, LA, USA, August 16-18, 2018},
  publisher    = {Association for Information Systems},
  year         = {2018},
  url          = {http://aisel.aisnet.org/amcis2018/},
  isbn         = {978-0-9966831-6-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/amcis/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/appis/2018,
  editor       = {Nicolai Petkov and
                  Nicola Strisciuglio and
                  Carlos Manuel Travieso{-}Gonz{\'{a}}lez},
  title        = {Applications of Intelligent Systems - Proceedings of the 1st International
                  {APPIS} Conference 2018, Las Palmas de Gran Canaria, Spain, 8-12 January
                  2018},
  series       = {Frontiers in Artificial Intelligence and Applications},
  volume       = {310},
  publisher    = {{IOS} Press},
  year         = {2018},
  isbn         = {978-1-61499-928-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/appis/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ccia/2018,
  editor       = {Zoe Falomir and
                  Karina Gibert and
                  Enric Plaza},
  title        = {Artificial Intelligence Research and Development - Current Challenges,
                  New Trends and Applications, {CCIA} 2018, 21st International Conference
                  of the Catalan Association for Artificial Intelligence, Alt Empord{\`{a}},
                  Catalonia, Spain, 8-10th October 2018},
  series       = {Frontiers in Artificial Intelligence and Applications},
  volume       = {308},
  publisher    = {{IOS} Press},
  year         = {2018},
  url          = {http://ebooks.iospress.nl/volume/artificial-intelligence-research-and-development-current-challenges-new-trends-and-applications},
  isbn         = {978-1-61499-917-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ccia/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/citi/2018,
  editor       = {Rafael Valencia{-}Garc{\'{\i}}a and
                  Gema Alcaraz{-}M{\'{a}}rmol and
                  Javier del Cioppo{-}Morstadt and
                  N{\'{e}}stor Vera{-}Lucio and
                  Martha Bucaram{-}Leverone},
  title        = {Technologies and Innovation - 4th International Conference, {CITI}
                  2018, Guayaquil, Ecuador, November 6-9, 2018, Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {883},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-030-00940-3},
  doi          = {10.1007/978-3-030-00940-3},
  isbn         = {978-3-030-00939-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/citi/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/clef/2018w,
  editor       = {Linda Cappellato and
                  Nicola Ferro and
                  Jian{-}Yun Nie and
                  Laure Soulier},
  title        = {Working Notes of {CLEF} 2018 - Conference and Labs of the Evaluation
                  Forum, Avignon, France, September 10-14, 2018},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {2125},
  publisher    = {CEUR-WS.org},
  year         = {2018},
  url          = {https://ceur-ws.org/Vol-2125},
  urn          = {urn:nbn:de:0074-2125-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/clef/2018w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eccv/2018w1,
  editor       = {Laura Leal{-}Taix{\'{e}} and
                  Stefan Roth},
  title        = {Computer Vision - {ECCV} 2018 Workshops - Munich, Germany, September
                  8-14, 2018, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {11129},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-11009-3},
  doi          = {10.1007/978-3-030-11009-3},
  isbn         = {978-3-030-11008-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/2018w1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icassp/2018,
  title        = {2018 {IEEE} International Conference on Acoustics, Speech and Signal
                  Processing, {ICASSP} 2018, Calgary, AB, Canada, April 15-20, 2018},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8450881/proceeding},
  isbn         = {978-1-5386-4658-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ipmu/2018-3,
  editor       = {Jes{\'{u}}s Medina and
                  Manuel Ojeda{-}Aciego and
                  Jos{\'{e}} Luis Verdegay Galdeano and
                  Irina Perfilieva and
                  Bernadette Bouchon{-}Meunier and
                  Ronald R. Yager},
  title        = {Information Processing and Management of Uncertainty in Knowledge-Based
                  Systems. Applications - 17th International Conference, {IPMU} 2018,
                  C{\'{a}}diz, Spain, June 11-15, 2018, Proceedings, Part {III}},
  series       = {Communications in Computer and Information Science},
  volume       = {855},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-319-91479-4},
  doi          = {10.1007/978-3-319-91479-4},
  isbn         = {978-3-319-91478-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ipmu/2018-3.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ni/2018,
  editor       = {Ann Kristin Roteg{\aa}rd and
                  Diane J. Skiba and
                  Sayonara F. F. Barbosa and
                  Angelica G. Davalos Alc{\'{a}}zar},
  title        = {Nursing Informatics 2018 - {ICT} to Improve Quality and Safety at
                  the Point of Care, Proceedings of the 14th International Congress
                  on Nursing Informatics, Guadalajara, Mexico, June 6-8, 2018},
  series       = {Studies in Health Technology and Informatics},
  volume       = {250},
  publisher    = {{IOS} Press},
  year         = {2018},
  isbn         = {978-1-61499-871-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ni/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/rice/2018,
  title        = {Proceedings of the 2018 {IEEE} International Conference on Research
                  in Intelligent and Computing in Engineering, {RICE} 2018, San Salvador,
                  El Salvador, August 22-24, 2018},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://doi.org/10.1109/RICE43080.2018},
  doi          = {10.1109/RICE43080.2018},
  isbn         = {978-1-5386-2599-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/rice/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sbcci/2018,
  title        = {31st Symposium on Integrated Circuits and Systems Design, {SBCCI}
                  2018, Bento Gon{\c{c}}alves, RS, Brazil, August 27-31, 2018},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8513831/proceeding},
  isbn         = {978-1-5386-7431-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/sbcci/2018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sepln/2018ibereval,
  editor       = {Paolo Rosso and
                  Julio Gonzalo and
                  Raquel Mart{\'{\i}}nez and
                  Soto Montalvo and
                  Jorge Carrillo de Albornoz},
  title        = {Proceedings of the Third Workshop on Evaluation of Human Language
                  Technologies for Iberian Languages (IberEval 2018) co-located with
                  34th Conference of the Spanish Society for Natural Language Processing
                  {(SEPLN} 2018), Sevilla, Spain, September 18th, 2018},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {2150},
  publisher    = {CEUR-WS.org},
  year         = {2018},
  url          = {https://ceur-ws.org/Vol-2150},
  urn          = {urn:nbn:de:0074-2150-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/sepln/2018ibereval.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/bis/2017,
  editor       = {Witold Abramowicz},
  title        = {Business Information Systems - 20th International Conference, {BIS}
                  2017, Poznan, Poland, June 28-30, 2017, Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {288},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-59336-4},
  doi          = {10.1007/978-3-319-59336-4},
  isbn         = {978-3-319-59335-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/bis/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/clihc/2017,
  title        = {Proceedings of the 8th Latin American Conference on Human-Computer
                  Interaction, {CLIHC} '17, Antigua Guatemala, Guatemala, November 8-10,
                  2017},
  publisher    = {{ACM}},
  year         = {2017},
  url          = {https://doi.org/10.1145/3151470},
  doi          = {10.1145/3151470},
  isbn         = {978-1-4503-5429-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/clihc/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/conf-irm/2017,
  title        = {2017 International Conference on Information Resources Management
                  - Democratization and Participation: People's Roles in Digital World,
                  {CONF-IRM} 2017, Santiago de Chile, Chile, May 17-19, 2017},
  year         = {2017},
  url          = {http://aisel.aisnet.org/confirm2017/},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/conf-irm/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/csedu/2017-1,
  editor       = {Paula Escudeiro and
                  Gennaro Costagliola and
                  Susan Zvacek and
                  James Onohuome Uhomoibhi and
                  Bruce M. McLaren},
  title        = {{CSEDU} 2017 - Proceedings of the 9th International Conference on
                  Computer Supported Education, Volume 1, Porto, Portugal, April 21-23,
                  2017},
  publisher    = {SciTePress},
  year         = {2017},
  isbn         = {978-989-758-239-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/csedu/2017-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cvpr/2017w,
  title        = {2017 {IEEE} Conference on Computer Vision and Pattern Recognition
                  Workshops, {CVPR} Workshops 2017, Honolulu, HI, USA, July 21-26, 2017},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8014302/proceeding},
  isbn         = {978-1-5386-0733-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/2017w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/edoc/2017,
  editor       = {Sylvain Hall{\'{e}} and
                  Roger Villemaire and
                  Robert Lagerstr{\"{o}}m},
  title        = {21st {IEEE} International Enterprise Distributed Object Computing
                  Conference, {EDOC} 2017, Quebec City, QC, Canada, October 10-13, 2017},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8086096/proceeding},
  isbn         = {978-1-5090-3045-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/edoc/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/emoocs/2017es,
  editor       = {Carlos Delgado Kloos and
                  Carlos Alario{-}Hoyos and
                  Rocael Hern{\'{a}}ndez Rizzardini},
  title        = {Actas de la Jornada de MOOCs en Espa{\~{n}}ol en EMOOCs 2017, EMOOCs-ES
                  2017, Madrid, Spain, May 26, 2017},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {1836},
  publisher    = {CEUR-WS.org},
  year         = {2017},
  url          = {https://ceur-ws.org/Vol-1836},
  urn          = {urn:nbn:de:0074-1836-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/emoocs/2017es.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eusipco/2017,
  title        = {25th European Signal Processing Conference, {EUSIPCO} 2017, Kos, Greece,
                  August 28 - September 2, 2017},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8067434/proceeding},
  isbn         = {978-0-9928626-7-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/eusipco/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/evoW/2017a-1,
  editor       = {Giovanni Squillero and
                  Kevin Sim},
  title        = {Applications of Evolutionary Computation - 20th European Conference,
                  EvoApplications 2017, Amsterdam, The Netherlands, April 19-21, 2017,
                  Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {10199},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-55849-3},
  doi          = {10.1007/978-3-319-55849-3},
  isbn         = {978-3-319-55848-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/evoW/2017a-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ibpria/2017,
  editor       = {Lu{\'{\i}}s A. Alexandre and
                  Jos{\'{e}} Salvador S{\'{a}}nchez and
                  Jo{\~{a}}o M. F. Rodrigues},
  title        = {Pattern Recognition and Image Analysis - 8th Iberian Conference, IbPRIA
                  2017, Faro, Portugal, June 20-23, 2017, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {10255},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-58838-4},
  doi          = {10.1007/978-3-319-58838-4},
  isbn         = {978-3-319-58837-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icar/2017,
  title        = {18th International Conference on Advanced Robotics, {ICAR} 2017, Hong
                  Kong, China, July 10-12, 2017},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8016525/proceeding},
  isbn         = {978-1-5386-3157-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icar/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iccS/2017,
  editor       = {Petros Koumoutsakos and
                  Michael Lees and
                  Valeria V. Krzhizhanovskaya and
                  Jack J. Dongarra and
                  Peter M. A. Sloot},
  title        = {International Conference on Computational Science, {ICCS} 2017, 12-14
                  June 2017, Zurich, Switzerland},
  series       = {Procedia Computer Science},
  volume       = {108},
  publisher    = {Elsevier},
  year         = {2017},
  url          = {https://www.sciencedirect.com/science/journal/18770509/108},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iccS/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceis/2017-3,
  editor       = {Slimane Hammoudi and
                  Michal Smialek and
                  Olivier Camp and
                  Joaquim Filipe},
  title        = {{ICEIS} 2017 - Proceedings of the 19th International Conference on
                  Enterprise Information Systems, Volume 3, Porto, Portugal, April 26-29,
                  2017},
  publisher    = {SciTePress},
  year         = {2017},
  isbn         = {978-989-758-249-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/2017-3.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ict4ageingwell/2017,
  editor       = {Carsten R{\"{o}}cker and
                  John O'Donoghue and
                  Martina Ziefle and
                  Leszek A. Maciaszek and
                  William Molloy},
  title        = {Proceedings of the 3rd International Conference on Information and
                  Communication Technologies for Ageing Well and e-Health, ICT4AgeingWell
                  2017, Porto, Portugal, April 28-29, 2017},
  publisher    = {{SCITEPRESS}},
  year         = {2017},
  isbn         = {978-989-758-251-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ict4ageingwell/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ict4ageingwell/2017s,
  editor       = {Carsten R{\"{o}}cker and
                  John O'Donoghue and
                  Martina Ziefle and
                  Leszek A. Maciaszek and
                  William Molloy},
  title        = {Information and Communication Technologies for Ageing Well and e-Health
                  - Third International Conference, {ICT4AWE} 2017, Porto, Portugal,
                  April 28-29, 2017, Revised Selected Papers},
  series       = {Communications in Computer and Information Science},
  volume       = {869},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-319-93644-4},
  doi          = {10.1007/978-3-319-93644-4},
  isbn         = {978-3-319-93643-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ict4ageingwell/2017s.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/infocom/2017,
  title        = {2017 {IEEE} Conference on Computer Communications, {INFOCOM} 2017,
                  Atlanta, GA, USA, May 1-4, 2017},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/8049192/proceeding},
  isbn         = {978-1-5090-5336-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/infocom/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iwann/2017-1,
  editor       = {Ignacio Rojas and
                  Gonzalo Joya and
                  Andreu Catal{\`{a}}},
  title        = {Advances in Computational Intelligence - 14th International Work-Conference
                  on Artificial Neural Networks, {IWANN} 2017, Cadiz, Spain, June 14-16,
                  2017, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {10305},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-59153-7},
  doi          = {10.1007/978-3-319-59153-7},
  isbn         = {978-3-319-59152-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iwann/2017-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lascas/2017,
  title        = {8th {IEEE} Latin American Symposium on Circuits {\&} Systems,
                  {LASCAS} 2017, Bariloche, Argentina, February 20-23, 2017},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7940150/proceeding},
  isbn         = {978-1-5090-5859-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/somet/2017,
  editor       = {Hamido Fujita and
                  Ali Selamat and
                  Sigeru Omatu},
  title        = {New Trends in Intelligent Software Methodologies, Tools and Techniques
                  - Proceedings of the 16th International Conference, SoMeT{\_}17, Kitakyushu
                  City, Japan, September 26-28, 2017},
  series       = {Frontiers in Artificial Intelligence and Applications},
  volume       = {297},
  publisher    = {{IOS} Press},
  year         = {2017},
  isbn         = {978-1-61499-799-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/somet/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ucami/2017,
  editor       = {Sergio F. Ochoa and
                  Pritpal Singh and
                  Jos{\'{e}} Bravo},
  title        = {Ubiquitous Computing and Ambient Intelligence - 11th International
                  Conference, UCAmI 2017, Philadelphia, PA, USA, November 7-10, 2017,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {10586},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-67585-5},
  doi          = {10.1007/978-3-319-67585-5},
  isbn         = {978-3-319-67584-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ucami/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:series/sci/2017-667,
  editor       = {Patricia Melin and
                  Oscar Castillo and
                  Janusz Kacprzyk},
  title        = {Nature-Inspired Design of Hybrid Intelligent Systems},
  series       = {Studies in Computational Intelligence},
  volume       = {667},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-47054-2},
  doi          = {10.1007/978-3-319-47054-2},
  isbn         = {978-3-319-47053-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/series/sci/2017-667.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/alife/2016,
  editor       = {Tom Froese and
                  Jes{\'{u}}s Mario Siqueiros{-}Garc{\'{\i}}a and
                  Wendy Aguilar and
                  Eduardo J. Izquierdo and
                  Hiroki Sayama and
                  Carlos Gershenson},
  title        = {Fifteenth International Conference on the Simulation and Synthesis
                  of Living Systems, {ALIFE} 2016, Cancun, Mexico, July 4-6, 2016},
  publisher    = {{MIT} Press},
  year         = {2016},
  url          = {https://direct.mit.edu/isal/alif2016/volume/28},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/alife/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caise/2016bpmds,
  editor       = {Rainer Schmidt and
                  Wided Gu{\'{e}}dria and
                  Ilia Bider and
                  S{\'{e}}rgio Guerreiro},
  title        = {Enterprise, Business-Process and Information Systems Modeling - 17th
                  International Conference, {BPMDS} 2016, 21st International Conference,
                  {EMMSAD} 2016, Held at CAiSE 2016, Ljubljana, Slovenia, June 13-14,
                  2016, Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {248},
  publisher    = {Springer},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-39429-9},
  doi          = {10.1007/978-3-319-39429-9},
  isbn         = {978-3-319-39428-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/2016bpmds.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eccv/2016w2,
  editor       = {Gang Hua and
                  Herv{\'{e}} J{\'{e}}gou},
  title        = {Computer Vision - {ECCV} 2016 Workshops - Amsterdam, The Netherlands,
                  October 8-10 and 15-16, 2016, Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {9914},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-48881-3},
  doi          = {10.1007/978-3-319-48881-3},
  isbn         = {978-3-319-48880-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/2016w2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/er/2016,
  editor       = {Isabelle Comyn{-}Wattiau and
                  Katsumi Tanaka and
                  Il{-}Yeol Song and
                  Shuichiro Yamamoto and
                  Motoshi Saeki},
  title        = {Conceptual Modeling - 35th International Conference, {ER} 2016, Gifu,
                  Japan, November 14-17, 2016, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {9974},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-46397-1},
  doi          = {10.1007/978-3-319-46397-1},
  isbn         = {978-3-319-46396-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/er/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/evoW/2016a-2,
  editor       = {Giovanni Squillero and
                  Paolo Burelli},
  title        = {Applications of Evolutionary Computation - 19th European Conference,
                  EvoApplications 2016, Porto, Portugal, March 30 - April 1, 2016, Proceedings,
                  Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {9598},
  publisher    = {Springer},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-31153-1},
  doi          = {10.1007/978-3-319-31153-1},
  isbn         = {978-3-319-31152-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/evoW/2016a-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/gecco/2016,
  editor       = {Tobias Friedrich and
                  Frank Neumann and
                  Andrew M. Sutton},
  title        = {Proceedings of the 2016 on Genetic and Evolutionary Computation Conference,
                  Denver, CO, USA, July 20 - 24, 2016},
  publisher    = {{ACM}},
  year         = {2016},
  url          = {https://doi.org/10.1145/2908812},
  doi          = {10.1145/2908812},
  isbn         = {978-1-4503-4206-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/gecco/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/gecco/2016c,
  editor       = {Tobias Friedrich and
                  Frank Neumann and
                  Andrew M. Sutton},
  title        = {Genetic and Evolutionary Computation Conference, {GECCO} 2016, Denver,
                  CO, USA, July 20-24, 2016, Companion Material Proceedings},
  publisher    = {{ACM}},
  year         = {2016},
  url          = {https://doi.org/10.1145/2908961},
  doi          = {10.1145/2908961},
  isbn         = {978-1-4503-4323-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/gecco/2016c.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icecsys/2016,
  title        = {2016 {IEEE} International Conference on Electronics, Circuits and
                  Systems, {ICECS} 2016, Monte Carlo, Monaco, December 11-14, 2016},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7829200/proceeding},
  isbn         = {978-1-5090-6113-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icecsys/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceee/2016,
  title        = {13th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2016, Mexico City, Mexico, September
                  26-30, 2016},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7742113/proceeding},
  isbn         = {978-1-5090-3511-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceis/2016-2,
  editor       = {Slimane Hammoudi and
                  Leszek A. Maciaszek and
                  Michele Missikoff and
                  Olivier Camp and
                  Jos{\'{e}} Cordeiro},
  title        = {{ICEIS} 2016 - Proceedings of the 18th International Conference on
                  Enterprise Information Systems, Volume 2, Rome, Italy, April 25-28,
                  2016},
  publisher    = {SciTePress},
  year         = {2016},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/2016-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceis/2016sp,
  editor       = {Slimane Hammoudi and
                  Leszek A. Maciaszek and
                  Michele Missikoff and
                  Olivier Camp and
                  Jos{\'{e}} Cordeiro},
  title        = {Enterprise Information Systems - 18th International Conference, {ICEIS}
                  2016, Rome, Italy, April 25-28, 2016, Revised Selected Papers},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {291},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-62386-3},
  doi          = {10.1007/978-3-319-62386-3},
  isbn         = {978-3-319-62385-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/2016sp.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icpr/2016,
  title        = {23rd International Conference on Pattern Recognition, {ICPR} 2016,
                  Canc{\'{u}}n, Mexico, December 4-8, 2016},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7893644/proceeding},
  isbn         = {978-1-5090-4847-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icpr/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iecon/2016,
  title        = {{IECON} 2016 - 42nd Annual Conference of the {IEEE} Industrial Electronics
                  Society, Florence, Italy, October 23-26, 2016},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7782522/proceeding},
  isbn         = {978-1-5090-3474-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iecon/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ijcci/2016ecta,
  editor       = {Juan Juli{\'{a}}n Merelo Guerv{\'{o}}s and
                  Fernando Mel{\'{\i}}cio and
                  Jos{\'{e}} Manuel Cadenas and
                  Ant{\'{o}}nio Dourado and
                  Kurosh Madani and
                  Ant{\'{o}}nio E. B. Ruano and
                  Joaquim Filipe},
  title        = {Proceedings of the 8th International Joint Conference on Computational
                  Intelligence, {IJCCI} 2016, Volume 1: ECTA, Porto, Portugal, November
                  9-11, 2016},
  publisher    = {SciTePress},
  year         = {2016},
  isbn         = {978-989-758-201-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcci/2016ecta.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lascas/2016,
  title        = {{IEEE} 7th Latin American Symposium on Circuits {\&} Systems,
                  {LASCAS} 2016, Florianopolis, Brazil, February 28 - March 2, 2016},
  publisher    = {{IEEE}},
  year         = {2016},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7447194/proceeding},
  isbn         = {978-1-4673-7835-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/2016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/micai/2016-2,
  editor       = {Obdulia Pichardo{-}Lagunas and
                  Sabino Miranda{-}Jim{\'{e}}nez},
  title        = {Advances in Soft Computing - 15th Mexican International Conference
                  on Artificial Intelligence, {MICAI} 2016, Canc{\'{u}}n, Mexico,
                  October 23-28, 2016, Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {10062},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-62428-0},
  doi          = {10.1007/978-3-319-62428-0},
  isbn         = {978-3-319-62427-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/2016-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/approx/2015,
  editor       = {Naveen Garg and
                  Klaus Jansen and
                  Anup Rao and
                  Jos{\'{e}} D. P. Rolim},
  title        = {Approximation, Randomization, and Combinatorial Optimization. Algorithms
                  and Techniques, {APPROX/RANDOM} 2015, August 24-26, 2015, Princeton,
                  NJ, {USA}},
  series       = {LIPIcs},
  volume       = {40},
  publisher    = {Schloss Dagstuhl - Leibniz-Zentrum f{\"{u}}r Informatik},
  year         = {2015},
  url          = {http://www.dagstuhl.de/dagpub/978-3-939897-89-7},
  isbn         = {978-3-939897-89-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/approx/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caise/2015w,
  editor       = {Anne Persson and
                  Janis Stirna},
  title        = {Advanced Information Systems Engineering Workshops - CAiSE 2015 International
                  Workshops, Stockholm, Sweden, June 8-9, 2015, Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {215},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-19243-7},
  doi          = {10.1007/978-3-319-19243-7},
  isbn         = {978-3-319-19242-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/2015w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caise/2015bpmds,
  editor       = {Khaled Gaaloul and
                  Rainer Schmidt and
                  Selmin Nurcan and
                  S{\'{e}}rgio Guerreiro and
                  Qin Ma},
  title        = {Enterprise, Business-Process and Information Systems Modeling - 16th
                  International Conference, {BPMDS} 2015, 20th International Conference,
                  {EMMSAD} 2015, Held at CAiSE 2015, Stockholm, Sweden, June 8-9, 2015,
                  Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {214},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-19237-6},
  doi          = {10.1007/978-3-319-19237-6},
  isbn         = {978-3-319-19236-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/2015bpmds.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/fskd/2015,
  title        = {12th International Conference on Fuzzy Systems and Knowledge Discovery,
                  {FSKD} 2015, Zhangjiajie, China, August 15-17, 2015},
  publisher    = {{IEEE}},
  year         = {2015},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7374053/proceeding},
  isbn         = {978-1-4673-7682-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/fskd/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ibpria/2015,
  editor       = {Roberto Paredes and
                  Jaime S. Cardoso and
                  Xos{\'{e}} M. Pardo},
  title        = {Pattern Recognition and Image Analysis - 7th Iberian Conference, IbPRIA
                  2015, Santiago de Compostela, Spain, June 17-19, 2015, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {9117},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-19390-8},
  doi          = {10.1007/978-3-319-19390-8},
  isbn         = {978-3-319-19389-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscas/2015,
  title        = {2015 {IEEE} International Symposium on Circuits and Systems, {ISCAS}
                  2015, Lisbon, Portugal, May 24-27, 2015},
  publisher    = {{IEEE}},
  year         = {2015},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7152138/proceeding},
  isbn         = {978-1-4799-8391-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iwbbio/2015-2,
  editor       = {Francisco M. Ortu{\~{n}}o Guzman and
                  Ignacio Rojas},
  title        = {Bioinformatics and Biomedical Engineering - Third International Conference,
                  {IWBBIO} 2015, Granada, Spain, April 15-17, 2015. Proceedings, Part
                  {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {9044},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-16480-9},
  doi          = {10.1007/978-3-319-16480-9},
  isbn         = {978-3-319-16479-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iwbbio/2015-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lascas/2015,
  title        = {{IEEE} 6th Latin American Symposium on Circuits {\&} Systems,
                  {LASCAS} 2015, Montevideo, Uruguay, February 24-27, 2015},
  publisher    = {{IEEE}},
  year         = {2015},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7235122/proceeding},
  isbn         = {978-1-4799-8332-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mie/2015,
  editor       = {Ronald Cornet and
                  Lacramioara Stoicu{-}Tivadar and
                  Alexander H{\"{o}}rbst and
                  Carlos Luis Parra Calder{\'{o}}n and
                  Stig Kj{\ae}r Andersen and
                  Mira Hercigonja{-}Szekeres},
  title        = {Digital Healthcare Empowering Europeans - Proceedings of MIE2015,
                  Madrid Spain, 27-29 May, 2015},
  series       = {Studies in Health Technology and Informatics},
  volume       = {210},
  publisher    = {{IOS} Press},
  year         = {2015},
  isbn         = {978-1-61499-511-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/mie/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/mswim/2015,
  editor       = {J. J. Garcia{-}Luna{-}Aceves and
                  Graciela Rom{\'{a}}n{-}Alonso and
                  Falko Dressler and
                  Brahim Bensaou and
                  Antonio A. F. Loureiro},
  title        = {Proceedings of the 18th {ACM} International Conference on Modeling,
                  Analysis and Simulation of Wireless and Mobile Systems, MSWiM 2015,
                  Cancun, Mexico, November 2-6, 2015},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {https://doi.org/10.1145/2811587},
  doi          = {10.1145/2811587},
  isbn         = {978-1-4503-3762-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/mswim/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sepln/2015tass,
  editor       = {Julio Villena{-}Rom{\'{a}}n and
                  Janine Garc{\'{\i}}a{-}Morera and
                  Miguel {\'{A}}ngel Garc{\'{\i}}a Cumbreras and
                  Eugenio Mart{\'{\i}}nez{-}C{\'{a}}mara and
                  Mar{\'{\i}}a Teresa Mart{\'{\i}}n{-}Valdivia and
                  Luis Alfonso Ure{\~{n}}a L{\'{o}}pez},
  title        = {Proceedings of {TASS} 2015: Workshop on Sentiment Analysis at {SEPLN}
                  co-located with 31st {SEPLN} Conference {(SEPLN} 2015), Alicante,
                  Spain, September 15, 2015},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {1397},
  publisher    = {CEUR-WS.org},
  year         = {2015},
  url          = {https://ceur-ws.org/Vol-1397},
  urn          = {urn:nbn:de:0074-1397-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/sepln/2015tass.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigcomm/2015s2bid,
  editor       = {Fabi{\'{a}}n E. Bustamante and
                  Balachander Krishnamurthy and
                  Walter Willinger},
  title        = {Proceedings of the 2015 {ACM} {SIGCOMM} Workshop on Crowdsourcing
                  and Crowdsharing of Big (Internet) Data, C2B(I)D@SIGCOMM 2015, London,
                  United Kingdom, August 17, 2015},
  publisher    = {{ACM}},
  year         = {2015},
  url          = {https://doi.org/10.1145/2787394},
  doi          = {10.1145/2787394},
  isbn         = {978-1-4503-3539-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcomm/2015s2bid.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ucami/2015,
  editor       = {Juan Manuel Garc{\'{\i}}a Chamizo and
                  Giancarlo Fortino and
                  Sergio F. Ochoa},
  title        = {Ubiquitous Computing and Ambient Intelligence. Sensing, Processing,
                  and Using Environmental Information - 9th International Conference,
                  UCAmI 2015, Puerto Varas, Chile, December 1-4, 2015, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {9454},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-26401-1},
  doi          = {10.1007/978-3-319-26401-1},
  isbn         = {978-3-319-26400-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ucami/2015.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:series/sci/2015-601,
  editor       = {Patricia Melin and
                  Oscar Castillo and
                  Janusz Kacprzyk},
  title        = {Design of Intelligent Systems Based on Fuzzy Logic, Neural Networks
                  and Nature-Inspired Optimization},
  series       = {Studies in Computational Intelligence},
  volume       = {601},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-17747-2},
  doi          = {10.1007/978-3-319-17747-2},
  isbn         = {978-3-319-17746-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/series/sci/2015-601.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caise/2014bpmds,
  editor       = {Ilia Bider and
                  Khaled Gaaloul and
                  John Krogstie and
                  Selmin Nurcan and
                  Henderik Alex Proper and
                  Rainer Schmidt and
                  Pnina Soffer},
  title        = {Enterprise, Business-Process and Information Systems Modeling - 15th
                  International Conference, {BPMDS} 2014, 19th International Conference,
                  {EMMSAD} 2014, Held at CAiSE 2014, Thessaloniki, Greece, June 16-17,
                  2014. Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {175},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-662-43745-2},
  doi          = {10.1007/978-3-662-43745-2},
  isbn         = {978-3-662-43744-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/2014bpmds.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caise/2014eomas,
  editor       = {Joseph Barjis and
                  Robert Pergl},
  title        = {Enterprise and Organizational Modeling and Simulation - 10th International
                  Workshop, {EOMAS} 2014, Held at CAiSE 2014, Thessaloniki, Greece,
                  June 16-17, 2014, Selected Papers},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {191},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-662-44860-1},
  doi          = {10.1007/978-3-662-44860-1},
  isbn         = {978-3-662-44859-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/2014eomas.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ccgrid/2014,
  title        = {14th {IEEE/ACM} International Symposium on Cluster, Cloud and Grid
                  Computing, CCGrid 2014, Chicago, IL, USA, May 26-29, 2014},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6844760/proceeding},
  isbn         = {978-1-4799-2783-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ccgrid/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/clei/2014,
  title        = {{XL} Latin American Computing Conference, {CLEI} 2014, Montevideo,
                  Uruguay, September 15-19, 2014},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6939950/proceeding},
  isbn         = {978-1-4799-6130-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/clei/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/edoc/2014,
  editor       = {Manfred Reichert and
                  Stefanie Rinderle{-}Ma and
                  Georg Grossmann},
  title        = {18th {IEEE} International Enterprise Distributed Object Computing
                  Conference, {EDOC} 2014, Ulm, Germany, September 1-5, 2014},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6970365/proceeding},
  isbn         = {978-1-4799-5470-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/edoc/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/edoc/2014w,
  editor       = {Georg Grossmann and
                  Sylvain Hall{\'{e}} and
                  Dimka Karastoyanova and
                  Manfred Reichert and
                  Stefanie Rinderle{-}Ma},
  title        = {18th {IEEE} International Enterprise Distributed Object Computing
                  Conference Workshops and Demonstrations, {EDOC} Workshops 2014, Ulm,
                  Germany, September 1-2, 2014},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6971861/proceeding},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/edoc/2014w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceee/2014,
  title        = {11th International Conference on Electrical Engineering, Computing
                  Science and Automatic Control, {CCE} 2014, Campeche, Mexico, September
                  29 - October 3, 2014},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6961334/proceeding},
  isbn         = {978-1-4799-6228-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceee/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceis/2014-3,
  editor       = {Slimane Hammoudi and
                  Leszek A. Maciaszek and
                  Jos{\'{e}} Cordeiro},
  title        = {{ICEIS} 2014 - Proceedings of the 16th International Conference on
                  Enterprise Information Systems, Volume 3, Lisbon, Portugal, 27-30
                  April, 2014},
  publisher    = {SciTePress},
  year         = {2014},
  isbn         = {978-989-758-029-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/2014-3.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceis/2014sp,
  editor       = {Jos{\'{e}} Cordeiro and
                  Slimane Hammoudi and
                  Leszek A. Maciaszek and
                  Olivier Camp and
                  Joaquim Filipe},
  title        = {Enterprise Information Systems - 16th International Conference, {ICEIS}
                  2014, Lisbon, Portugal, April 27-30, 2014, Revised Selected Papers},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {227},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-22348-3},
  doi          = {10.1007/978-3-319-22348-3},
  isbn         = {978-3-319-22347-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iceis/2014sp.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icete/2014,
  editor       = {Mohammad S. Obaidat and
                  Andreas Holzinger and
                  Marten van Sinderen and
                  Peter Dolog},
  title        = {{ICE-B} 2014 - Proceedings of the 11th International Conference on
                  e-Business, Vienna, Austria, 28-30 August, 2014},
  publisher    = {SciTePress},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7503273/proceeding},
  isbn         = {978-989-758-043-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icete/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icip/2014,
  title        = {2014 {IEEE} International Conference on Image Processing, {ICIP} 2014,
                  Paris, France, October 27-30, 2014},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6992914/proceeding},
  isbn         = {978-1-4799-5751-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icira/2014-1,
  editor       = {Xianmin Zhang and
                  Honghai Liu and
                  Zhong Chen and
                  Nianfeng F. Wang},
  title        = {Intelligent Robotics and Applications - 7th International Conference,
                  {ICIRA} 2014, Guangzhou, China, December 17-20, 2014, Proceedings,
                  Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {8917},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-319-13966-1},
  doi          = {10.1007/978-3-319-13966-1},
  isbn         = {978-3-319-13965-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icira/2014-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/imc/2014,
  editor       = {Carey Williamson and
                  Aditya Akella and
                  Nina Taft},
  title        = {Proceedings of the 2014 Internet Measurement Conference, {IMC} 2014,
                  Vancouver, BC, Canada, November 5-7, 2014},
  publisher    = {{ACM}},
  year         = {2014},
  url          = {http://dl.acm.org/citation.cfm?id=2663716},
  isbn         = {978-1-4503-3213-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/imc/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iolts/2014,
  title        = {2014 {IEEE} 20th International On-Line Testing Symposium, {IOLTS}
                  2014, Platja d'Aro, Girona, Spain, July 7-9, 2014},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6867432/proceeding},
  isbn         = {978-1-4799-5323-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iolts/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lanmr/2014,
  editor       = {Juan Carlos Acosta Guadarrama},
  title        = {Proceedings of the Ninth Latin American Workshop on Logic/Languages,
                  Algorithms and New Methods of Reasoning, Valle de Bravo, Mexico, November
                  5-7, 2014},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {1287},
  publisher    = {CEUR-WS.org},
  year         = {2014},
  url          = {https://ceur-ws.org/Vol-1287},
  urn          = {urn:nbn:de:0074-1287-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/lanmr/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lascas/2014,
  title        = {{IEEE} 5th Latin American Symposium on Circuits and Systems, {LASCAS}
                  2014, Santiago, Chile, February 25-28, 2014},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6815880/proceeding},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/lascas/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/vcip/2014,
  title        = {2014 {IEEE} Visual Communications and Image Processing Conference,
                  {VCIP} 2014, Valletta, Malta, December 7-10, 2014},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7041330/proceeding},
  isbn         = {978-1-4799-6139-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/vcip/2014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:series/sci/2014-547,
  editor       = {Oscar Castillo and
                  Patricia Melin and
                  Witold Pedrycz and
                  Janusz Kacprzyk},
  title        = {Recent Advances on Hybrid Approaches for Designing Intelligent Systems},
  series       = {Studies in Computational Intelligence},
  volume       = {547},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-319-05170-3},
  doi          = {10.1007/978-3-319-05170-3},
  isbn         = {978-3-319-05169-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/series/sci/2014-547.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ccgrid/2013,
  title        = {13th {IEEE/ACM} International Symposium on Cluster, Cloud, and Grid
                  Computing, CCGrid 2013, Delft, Netherlands, May 13-16, 2013},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6545869/proceeding},
  isbn         = {978-1-4673-6465-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ccgrid/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cdc/2013,
  title        = {Proceedings of the 52nd {IEEE} Conference on Decision and Control,
                  {CDC} 2013, Florence, Italy, December 10-13, 2013},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/CDC20427.2013},
  doi          = {10.1109/CDC20427.2013},
  isbn         = {978-1-4673-5714-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ecoop/2013acme,
  editor       = {Davide Di Ruscio and
                  Dimitris S. Kolovos and
                  Louis M. Rose and
                  Samir Al{-}Hilank},
  title        = {Proceedings of the workshop on ACadeMics Tooling with Eclipse, ACME@ECOOP
                  2013, Montpellier, France, July 2, 2013},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2491279},
  doi          = {10.1145/2491279},
  isbn         = {978-1-4503-2036-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ecoop/2013acme.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ecoop/2013globaldsl,
  editor       = {Beno{\^{\i}}t Combemale and
                  Walter Cazzola and
                  Robert B. France},
  title        = {Proceedings of the First Workshop on the Globalization of Domain Specific
                  Languages, GlobalDSL@ECOOP 2013, Montpellier, France, July 1, 2013},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2489812},
  doi          = {10.1145/2489812},
  isbn         = {978-1-4503-2043-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ecoop/2013globaldsl.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/europar/2013,
  editor       = {Felix Wolf and
                  Bernd Mohr and
                  Dieter an Mey},
  title        = {Euro-Par 2013 Parallel Processing - 19th International Conference,
                  Aachen, Germany, August 26-30, 2013. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {8097},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-40047-6},
  doi          = {10.1007/978-3-642-40047-6},
  isbn         = {978-3-642-40046-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/europar/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/hbu/2013,
  editor       = {Albert Ali Salah and
                  Hayley Hung and
                  Oya Aran and
                  Hatice Gunes},
  title        = {Human Behavior Understanding - 4th International Workshop, {HBU} 2013,
                  Barcelona, Spain, October 22, 2013. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {8212},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-319-02714-2},
  doi          = {10.1007/978-3-319-02714-2},
  isbn         = {978-3-319-02713-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/hbu/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ica3pp/2013-1,
  editor       = {Joanna Kolodziej and
                  Beniamino Di Martino and
                  Domenico Talia and
                  Kaiqi Xiong},
  title        = {Algorithms and Architectures for Parallel Processing - 13th International
                  Conference, {ICA3PP} 2013, Vietri sul Mare, Italy, December 18-20,
                  2013, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {8285},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-319-03859-9},
  doi          = {10.1007/978-3-319-03859-9},
  isbn         = {978-3-319-03858-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/ica3pp/2013-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icb/2013,
  editor       = {Julian Fi{\'{e}}rrez and
                  Ajay Kumar and
                  Mayank Vatsa and
                  Raymond N. J. Veldhuis and
                  Javier Ortega{-}Garcia},
  title        = {International Conference on Biometrics, {ICB} 2013, 4-7 June, 2013,
                  Madrid, Spain},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6596180/proceeding},
  isbn         = {978-1-4799-0310-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:39 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icsoc/2013w,
  editor       = {Alessio Lomuscio and
                  Surya Nepal and
                  Fabio Patrizi and
                  Boualem Benatallah and
                  Ivona Brandic},
  title        = {Service-Oriented Computing - {ICSOC} 2013 Workshops - CCSA, CSB, PASCEB,
                  SWESE, WESOA, and PhD Symposium, Berlin, Germany, December 2-5, 2013.
                  Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {8377},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-319-06859-6},
  doi          = {10.1007/978-3-319-06859-6},
  isbn         = {978-3-319-06858-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/icsoc/2013w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ifip8-1/2013s,
  editor       = {Janis Grabis and
                  Marite Kirikova and
                  Jelena Zdravkovic and
                  Janis Stirna},
  title        = {Short Paper Proceedings of the 6th {IFIP} {WG} 8.1 Working Conference
                  on the Practice of Enterprise Modeling (PoEM 2013), Riga, Latvia,
                  November 6-7, 2013},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {1023},
  publisher    = {CEUR-WS.org},
  year         = {2013},
  url          = {https://ceur-ws.org/Vol-1023},
  urn          = {urn:nbn:de:0074-1023-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ifip8-1/2013s.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isami/2013,
  editor       = {Ad van Berlo and
                  Kasper Hallenborg and
                  Juan M. Corchado Rodr{\'{\i}}guez and
                  Dante I. Tapia and
                  Paulo Novais},
  title        = {Ambient Intelligence - Software and Applications - 4th International
                  Symposium on Ambient Intelligence, ISAmI 2013, Salamanca, Spain, May
                  22-24, 2013},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {219},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-319-00566-9},
  doi          = {10.1007/978-3-319-00566-9},
  isbn         = {978-3-319-00565-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/isami/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/lion/2013,
  editor       = {Giuseppe Nicosia and
                  Panos M. Pardalos},
  title        = {Learning and Intelligent Optimization - 7th International Conference,
                  {LION} 7, Catania, Italy, January 7-11, 2013, Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {7997},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-44973-4},
  doi          = {10.1007/978-3-642-44973-4},
  isbn         = {978-3-642-44972-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/lion/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nsdi/2013,
  editor       = {Nick Feamster and
                  Jeffrey C. Mogul},
  title        = {Proceedings of the 10th {USENIX} Symposium on Networked Systems Design
                  and Implementation, {NSDI} 2013, Lombard, IL, USA, April 2-5, 2013},
  publisher    = {{USENIX} Association},
  year         = {2013},
  isbn         = {978-1-931971-00-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/nsdi/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/pam/2013,
  editor       = {Matthew Roughan and
                  Rocky K. C. Chang},
  title        = {Passive and Active Measurement - 14th International Conference, {PAM}
                  2013, Hong Kong, China, March 18-19, 2013. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7799},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-36516-4},
  doi          = {10.1007/978-3-642-36516-4},
  isbn         = {978-3-642-36515-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/pam/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wcsc/2013,
  editor       = {Mo M. Jamshidi and
                  Vladik Kreinovich and
                  Janusz Kacprzyk},
  title        = {Advance Trends in Soft Computing - Proceedings of {WCSC} 2013, December
                  16-18, San Antonio, Texas, {USA}},
  series       = {Studies in Fuzziness and Soft Computing},
  volume       = {312},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-319-03674-8},
  doi          = {10.1007/978-3-319-03674-8},
  isbn         = {978-3-319-03673-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/wcsc/2013.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/caise/2012w,
  editor       = {Marko Bajec and
                  Johann Eder},
  title        = {Advanced Information Systems Engineering Workshops - CAiSE 2012 International
                  Workshops, Gda{\'{n}}sk, Poland, June 25-26, 2012. Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {112},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-31069-0},
  doi          = {10.1007/978-3-642-31069-0},
  isbn         = {978-3-642-31068-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/caise/2012w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cescit/2012,
  editor       = {Klaus Schilling and
                  Florian Leutert},
  title        = {1st Conference on Embedded Systems, Computational Intelligence and
                  Telematics in Control, {CESCIT} 2012, W{\"{u}}rzburg, Germany,
                  April 03-05, 2012},
  publisher    = {International Federation of Automatic Control},
  year         = {2012},
  url          = {http://www.ifac-papersonline.net/Embedded\_Systems\_\_Computational\_Intelligence\_and\_Telematics\_in\_Control/1st\_Conference\_on\_Embedded\_Systems\_\_Computational\_Intelligence\_and\_Telematics\_in\_Control/index.html},
  isbn         = {978-3-902661-97-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cescit/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cgames/2012,
  editor       = {Quasim H. Mehdi and
                  Adel Elmaghraby and
                  Ian Marshall and
                  Robert Moreton and
                  Rammohan K. Ragade and
                  Bego{\~{n}}a Garc{\'{\i}}a Zapirain and
                  Julia Chariker and
                  Mostafa M. El{-}Said and
                  Roman V. Yampolskiy and
                  Nickola Li Zhigiang},
  title        = {17th International Conference on Computer Games, {CGAMES} 2012, Louisville,
                  KY, USA, July 30 - Aug. 1, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6289461/proceeding},
  isbn         = {978-1-4673-1120-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cgames/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/conielecomp/2012,
  editor       = {Pedro Ba{\~{n}}uelos S{\'{a}}nchez and
                  Roberto Rosas{-}Romero and
                  Mauricio Javier Osorio Galindo},
  title        = {22nd International Conference on Electrical Communications and Computers,
                  {CONIELECOMP} 2012, Cholula, Puebla, Mexico, February 27-29, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6184562/proceeding},
  isbn         = {978-1-4577-1326-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/conielecomp/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/edoc/2012w,
  title        = {16th {IEEE} International Enterprise Distributed Object Computing
                  Conference Workshops, {EDOC} Workshops, Beijing, China, September
                  10-14, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6403619/proceeding},
  isbn         = {978-1-4673-5005-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/edoc/2012w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/embc/2012,
  title        = {Annual International Conference of the {IEEE} Engineering in Medicine
                  and Biology Society, {EMBC} 2012, San Diego, CA, USA, August 28 -
                  September 1, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6320834/proceeding},
  isbn         = {978-1-4244-4119-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/europar/2012,
  editor       = {Christos Kaklamanis and
                  Theodore S. Papatheodorou and
                  Paul G. Spirakis},
  title        = {Euro-Par 2012 Parallel Processing - 18th International Conference,
                  Euro-Par 2012, Rhodes Island, Greece, August 27-31, 2012. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7484},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-32820-6},
  doi          = {10.1007/978-3-642-32820-6},
  isbn         = {978-3-642-32819-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/europar/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icce-berlin/2012,
  title        = {{IEEE} Second International Conference on Consumer Electronics - Berlin,
                  ICCE-Berlin 2012, Berlin, Germany, September 3-5, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6328540/proceeding},
  isbn         = {978-1-4673-1546-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/icce-berlin/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iccel/2012,
  title        = {{IEEE} International Conference on Consumer Electronics, {ICCE} 2012,
                  Las Vegas, NV, USA, January 13-16, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6153584/proceeding},
  isbn         = {978-1-4577-0230-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iccel/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icip/2012,
  title        = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012,
                  Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6451323/proceeding},
  isbn         = {978-1-4673-2534-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iecon/2012,
  title        = {38th Annual Conference on {IEEE} Industrial Electronics Society, {IECON}
                  2012, Montreal, QC, Canada, October 25-28, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6373889/proceeding},
  isbn         = {978-1-4673-2419-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iecon/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ieeehpcs/2012,
  editor       = {Waleed W. Smari and
                  Vesna Zeljkovic},
  title        = {2012 International Conference on High Performance Computing {\&}
                  Simulation, {HPCS} 2012, Madrid, Spain, July 2-6, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6260982/proceeding},
  isbn         = {978-1-4673-2359-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ieeehpcs/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/igarss/2012,
  title        = {2012 {IEEE} International Geoscience and Remote Sensing Symposium,
                  {IGARSS} 2012, Munich, Germany, July 22-27, 2012},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6334512/proceeding},
  isbn         = {978-1-4673-1160-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/igarss/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/imc/2012,
  editor       = {John W. Byers and
                  Jim Kurose and
                  Ratul Mahajan and
                  Alex C. Snoeren},
  title        = {Proceedings of the 12th {ACM} {SIGCOMM} Internet Measurement Conference,
                  {IMC} '12, Boston, MA, USA, November 14-16, 2012},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {http://dl.acm.org/citation.cfm?id=2398776},
  isbn         = {978-1-4503-1705-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/imc/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iolts/2012,
  title        = {18th {IEEE} International On-Line Testing Symposium, {IOLTS} 2012,
                  Sitges, Spain, June 27-29, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6304844/proceeding},
  isbn         = {978-1-4673-2082-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iolts/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/its/2012,
  editor       = {Stefano A. Cerri and
                  William J. Clancey and
                  Giorgos Papadourakis and
                  Kitty Panourgia},
  title        = {Intelligent Tutoring Systems - 11th International Conference, {ITS}
                  2012, Chania, Crete, Greece, June 14-18, 2012. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7315},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-30950-2},
  doi          = {10.1007/978-3-642-30950-2},
  isbn         = {978-3-642-30949-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/its/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/models/2012me,
  title        = {Proceedings of the 6th International Workshop on Models and Evolution,
                  ME@MoDELS 2012, Innsbruck, Austria, October 1-5, 2012},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {https://doi.org/10.1145/2523599},
  doi          = {10.1145/2523599},
  isbn         = {978-1-4503-1798-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/models/2012me.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/models/2012xm,
  editor       = {Davide Di Ruscio and
                  Alfonso Pierantonio and
                  Juan de Lara},
  title        = {Proceedings of the 2012 Extreme Modeling Workshop, {XM} '12, Innsbruck,
                  Austria, October 1, 2012},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {https://doi.org/10.1145/2467307},
  doi          = {10.1145/2467307},
  isbn         = {978-1-4503-1804-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/models/2012xm.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nocs/2012,
  title        = {2012 Sixth {IEEE/ACM} International Symposium on Networks-on-Chip
                  (NoCS), Copenhagen, Denmark, 9-11 May, 2012},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6209063/proceeding},
  isbn         = {978-0-7695-4677-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/nocs/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigcomm/2012,
  editor       = {Lars Eggert and
                  J{\"{o}}rg Ott and
                  Venkata N. Padmanabhan and
                  George Varghese},
  title        = {{ACM} {SIGCOMM} 2012 Conference, {SIGCOMM} '12, Helsinki, Finland
                  - August 13 - 17, 2012},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {https://doi.org/10.1145/2342356},
  doi          = {10.1145/2342356},
  isbn         = {978-1-4503-1419-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcomm/2012.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/bpm/2011w2,
  editor       = {Florian Daniel and
                  Kamel Barkaoui and
                  Schahram Dustdar},
  title        = {Business Process Management Workshops - {BPM} 2011 International Workshops,
                  Clermont-Ferrand, France, August 29, 2011, Revised Selected Papers,
                  Part {II}},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {100},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-28115-0},
  doi          = {10.1007/978-3-642-28115-0},
  isbn         = {978-3-642-28114-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/bpm/2011w2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eScience/2011,
  title        = {{IEEE} 7th International Conference on E-Science, e-Science 2011,
                  Stockholm, Sweden, December 5-8, 2011},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6122900/proceeding},
  isbn         = {978-1-4577-2163-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/eScience/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/enase/2011s,
  editor       = {Leszek A. Maciaszek and
                  Kang Zhang},
  title        = {Evaluation of Novel Approaches to Software Engineering - 6th International
                  Conference, {ENASE} 2011, Beijing, China, June 8-11, 2011. Revised
                  Selected Papers},
  series       = {Communications in Computer and Information Science},
  volume       = {275},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-32341-6},
  doi          = {10.1007/978-3-642-32341-6},
  isbn         = {978-3-642-32340-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/enase/2011s.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/enase/2011,
  editor       = {Leszek A. Maciaszek and
                  Kang Zhang},
  title        = {{ENASE} 2011 - Proceedings of the 6th International Conference on
                  Evaluation of Novel Approaches to Software Engineering, Beijing, China,
                  8-11 June, 2011},
  publisher    = {SciTePress},
  year         = {2011},
  isbn         = {978-989-8425-57-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/enase/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/esem/2011,
  title        = {Proceedings of the 5th International Symposium on Empirical Software
                  Engineering and Measurement, {ESEM} 2011, Banff, AB, Canada, September
                  22-23, 2011},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6088933/proceeding},
  isbn         = {978-1-4577-2203-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/esem/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eusipco/2011,
  title        = {Proceedings of the 19th European Signal Processing Conference, {EUSIPCO}
                  2011, Barcelona, Spain, August 29 - Sept. 2, 2011},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7069644/proceeding},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/eusipco/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ibpria/2011,
  editor       = {Jordi Vitri{\`{a}} and
                  Jo{\~{a}}o Miguel Raposo Sanches and
                  Mario Hern{\'{a}}ndez},
  title        = {Pattern Recognition and Image Analysis - 5th Iberian Conference, IbPRIA
                  2011, Las Palmas de Gran Canaria, Spain, June 8-10, 2011. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6669},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-3-642-21257-4},
  doi          = {10.1007/978-3-642-21257-4},
  isbn         = {978-3-642-21256-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sac/2011,
  editor       = {William C. Chu and
                  W. Eric Wong and
                  Mathew J. Palakal and
                  Chih{-}Cheng Hung},
  title        = {Proceedings of the 2011 {ACM} Symposium on Applied Computing (SAC),
                  TaiChung, Taiwan, March 21 - 24, 2011},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/1982185},
  doi          = {10.1145/1982185},
  isbn         = {978-1-4503-0113-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sac/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigcomm/2011wmust,
  editor       = {Nina Taft and
                  David Wetherall},
  title        = {Proceedings of the first {ACM} {SIGCOMM} workshop on Measurements
                  up the stack, W-MUST@SIGCOMM 2011, Toronto, Ontario, Canada, August
                  19, 2011},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2018602},
  doi          = {10.1145/2018602},
  isbn         = {978-1-4503-0800-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcomm/2011wmust.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigcomm/2011,
  editor       = {Srinivasan Keshav and
                  J{\"{o}}rg Liebeherr and
                  John W. Byers and
                  Jeffrey C. Mogul},
  title        = {Proceedings of the {ACM} {SIGCOMM} 2011 Conference on Applications,
                  Technologies, Architectures, and Protocols for Computer Communications,
                  Toronto, ON, Canada, August 15-19, 2011},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2018436},
  doi          = {10.1145/2018436},
  isbn         = {978-1-4503-0797-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sigcomm/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sis/2011,
  editor       = {David Garcia Rosado and
                  Luis Enrique S{\'{a}}nchez and
                  Jan J{\"{u}}rjens},
  title        = {{WOSIS} 2011 - Proceedings of the 8th International Workshop on Security
                  in Information Systems, In conjunction with {ICEIS} 2011, Beijing,
                  China, 8-9 June, 2011},
  publisher    = {SciTePress},
  year         = {2011},
  isbn         = {978-989-8425-61-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/tools/49-2011,
  editor       = {Judith Bishop and
                  Antonio Vallecillo},
  title        = {Objects, Models, Components, Patterns - 49th International Conference,
                  {TOOLS} 2011, Zurich, Switzerland, June 28-30, 2011. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6705},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-3-642-21952-8},
  doi          = {10.1007/978-3-642-21952-8},
  isbn         = {978-3-642-21951-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/tools/49-2011.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/IEEEares/2010,
  title        = {{ARES} 2010, Fifth International Conference on Availability, Reliability
                  and Security, 15-18 February 2010, Krakow, Poland},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5437532/proceeding},
  isbn         = {978-0-7695-3965-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/IEEEares/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/centeris/2010-2,
  editor       = {Jo{\~{a}}o Eduardo Quintela Varaj{\~{a}}o and
                  Maria Manuela Cruz{-}Cunha and
                  Goran D. Putnik and
                  Ant{\'{o}}nio Trigo},
  title        = {ENTERprise Information Systems - International Conference, {CENTERIS}
                  2010, Viana do Castelo, Portugal, October 20-22, 2010, Proceedings,
                  Part {II}},
  series       = {Communications in Computer and Information Science},
  volume       = {110},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-16419-4},
  doi          = {10.1007/978-3-642-16419-4},
  isbn         = {978-3-642-16418-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/centeris/2010-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cibse/2010,
  editor       = {Xavier Franch and
                  Itana Maria de Souza Gimenes and
                  Juan Pablo Carvallo},
  title        = {Proceedings of the 13th Iberoamerican Conference on Software Engineering,
                  CIbSE 2010, Cuenca, Ecuador, April 12-16, 2010},
  year         = {2010},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cibse/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/conielecomp/2010,
  title        = {20th International Conference on Electronics, Communications and Computer,
                  {CONIELECOMP} 2010, Cholula, Puebla, Mexico, February 22-24, 2010},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5433810/proceeding},
  isbn         = {978-1-4244-5352-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/conielecomp/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/er/2010,
  editor       = {Jeffrey Parsons and
                  Motoshi Saeki and
                  Peretz Shoval and
                  Carson C. Woo and
                  Yair Wand},
  title        = {Conceptual Modeling - {ER} 2010, 29th International Conference on
                  Conceptual Modeling, Vancouver, BC, Canada, November 1-4, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6412},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-16373-9},
  doi          = {10.1007/978-3-642-16373-9},
  isbn         = {978-3-642-16372-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/er/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/infocom/2010,
  title        = {{INFOCOM} 2010. 29th {IEEE} International Conference on Computer Communications,
                  Joint Conference of the {IEEE} Computer and Communications Societies,
                  15-19 March 2010, San Diego, CA, {USA}},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5461675/proceeding},
  isbn         = {978-1-4244-5838-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/infocom/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/jisbd/2010,
  editor       = {Ernest Teniente and
                  Silvia Abrah{\~{a}}o},
  title        = {{XV} Jornadas de Ingenier{\'{\i}}a del Software y Bases de Datos
                  {(JISBD} 2010), Valencia, Spain, September 7-10, 2010. Actas},
  publisher    = {{IBERGARCETA} Pub. {S.L.}},
  year         = {2010},
  isbn         = {978-84-92812-51-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/jisbd/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/paams/2010,
  editor       = {Yves Demazeau and
                  Frank Dignum and
                  Juan M. Corchado and
                  Javier Bajo},
  title        = {Advances in Practical Applications of Agents and Multiagent Systems,
                  8th International Conference on Practical Applications of Agents and
                  Multiagent Systems, {PAAMS} 2010, Salamanca, Spain, 26-28 April 2010},
  series       = {Advances in Intelligent and Soft Computing},
  volume       = {70},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-12384-9},
  doi          = {10.1007/978-3-642-12384-9},
  isbn         = {978-3-642-12383-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/paams/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/trustbus/2010,
  editor       = {Sokratis K. Katsikas and
                  Javier L{\'{o}}pez and
                  Miguel Soriano},
  title        = {Trust, Privacy and Security in Digital Business, 7th International
                  Conference, TrustBus 2010, Bilbao, Spain, August 30-31, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6264},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-15152-1},
  doi          = {10.1007/978-3-642-15152-1},
  isbn         = {978-3-642-15151-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/trustbus/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/biostec/2009bd,
  editor       = {Teodiano Freire Bastos{-}Filho and
                  Hugo Gamboa},
  title        = {{BIODEVICES} 2009 - Proceedings of the International Conference on
                  Biomedical Electronics and Devices, Porto, Portugal, January 14-17,
                  2009},
  publisher    = {{INSTICC} Press},
  year         = {2009},
  isbn         = {978-989-8111-64-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/biostec/2009bd.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/biostec/2009ccis,
  editor       = {Ana L. N. Fred and
                  Joaquim Filipe and
                  Hugo Gamboa},
  title        = {Biomedical Engineering Systems and Technologies - International Joint
                  Conference, {BIOSTEC} 2009 Porto, Portugal, January 14-17, 2009, Revised
                  Selected Papers},
  series       = {Communications in Computer and Information Science},
  volume       = {52},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-11721-3},
  doi          = {10.1007/978-3-642-11721-3},
  isbn         = {978-3-642-11720-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/biostec/2009ccis.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ciarp/2009,
  editor       = {Eduardo Bayro{-}Corrochano and
                  Jan{-}Olof Eklundh},
  title        = {Progress in Pattern Recognition, Image Analysis, Computer Vision,
                  and Applications, 14th Iberoamerican Conference on Pattern Recognition,
                  {CIARP} 2009, Guadalajara, Jalisco, Mexico, November 15-18, 2009.
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5856},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-10268-4},
  doi          = {10.1007/978-3-642-10268-4},
  isbn         = {978-3-642-10267-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ciarp/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cikm/2009dtmbio,
  editor       = {Doheon Lee and
                  Russ B. Altman and
                  Min Song and
                  Jun Huan},
  title        = {Proceeding of the 3rd International Workshop on Data and Text Mining
                  in Bioinformatics, {DTMBIO} 2009, Hong Kong, China, November 6, 2009},
  publisher    = {{ACM}},
  year         = {2009},
  url          = {https://doi.org/10.1145/1651318},
  doi          = {10.1145/1651318},
  isbn         = {978-1-60558-803-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cikm/2009dtmbio.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/enc/2009,
  editor       = {Alejandro P. Buchmann},
  title        = {2009 Mexican International Conference on Computer Science, {ENC} 2009,
                  Mexico City, Mexico, September 21-25, 2009},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5452232/proceeding},
  isbn         = {978-0-7695-3882-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/enc/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/micai/2009,
  editor       = {Arturo Hern{\'{a}}ndez Aguirre and
                  Ra{\'{u}}l Monroy Borja and
                  Carlos A. Reyes Garc{\'{\i}}a},
  title        = {{MICAI} 2009: Advances in Artificial Intelligence, 8th Mexican International
                  Conference on Artificial Intelligence, Guanajuato, Mexico, November
                  9-13, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5845},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-05258-3},
  doi          = {10.1007/978-3-642-05258-3},
  isbn         = {978-3-642-05257-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/micai/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/nldb/2009,
  editor       = {Helmut Horacek and
                  Elisabeth M{\'{e}}tais and
                  Rafael Mu{\~{n}}oz and
                  Magdalena Wolska},
  title        = {Natural Language Processing and Information Systems, 14th International
                  Conference on Applications of Natural Language to Information Systems,
                  {NLDB} 2009, Saarbr{\"{u}}cken, Germany, June 24-26, 2009. Revised
                  Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {5723},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-12550-8},
  doi          = {10.1007/978-3-642-12550-8},
  isbn         = {978-3-642-12549-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/nldb/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sis/2009,
  editor       = {Alfonso Rodr{\'{\i}}guez and
                  Mariemma Inmaculada Yag{\"{u}}e del Valle and
                  Eduardo Fern{\'{a}}ndez{-}Medina},
  title        = {Security in Information Systems, Proceedings of the 7th International
                  Workshop on Security in Information Systems, {WOSIS} 2009, In conjunction
                  with {ICEIS} 2009, Milan, Italy, May 2009},
  publisher    = {{INSTICC} Press},
  year         = {2009},
  isbn         = {978-989-8111-91-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sws/2009,
  editor       = {Ernesto Damiani and
                  Seth Proctor and
                  Anoop Singhal},
  title        = {Proceedings of the 6th {ACM} Workshop On Secure Web Services, {SWS}
                  2009, Chicago, Illinois, USA, November 13, 2009},
  publisher    = {{ACM}},
  year         = {2009},
  isbn         = {978-1-60558-789-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sws/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/tools/47-2009,
  editor       = {Manuel Oriol and
                  Bertrand Meyer},
  title        = {Objects, Components, Models and Patterns, 47th International Conference,
                  {TOOLS} {EUROPE} 2009, Zurich, Switzerland, June 29-July 3, 2009.
                  Proceedings},
  series       = {Lecture Notes in Business Information Processing},
  volume       = {33},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-02571-6},
  doi          = {10.1007/978-3-642-02571-6},
  isbn         = {978-3-642-02570-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/tools/47-2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wecwis/2009,
  editor       = {Birgit Hofreiter and
                  Hannes Werthner},
  title        = {2009 {IEEE} Conference on Commerce and Enterprise Computing, {CEC}
                  2009, Vienna, Austria, July 20-23, 2009},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/5210725/proceeding},
  isbn         = {978-0-7695-3755-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/wecwis/2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/igi/09/CA2009,
  editor       = {Jorge Cardoso and
                  Wil M. P. van der Aalst},
  title        = {Handbook of Research on Business Process Modeling},
  publisher    = {{IGI} Global},
  year         = {2009},
  url          = {https://doi.org/10.4018/978-1-60566-288-6},
  doi          = {10.4018/978-1-60566-288-6},
  isbn         = {978-1-60566-288-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/books/igi/09/CA2009.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/IEEEares/2008,
  title        = {Proceedings of the The Third International Conference on Availability,
                  Reliability and Security, {ARES} 2008, March 4-7, 2008, Technical
                  University of Catalonia, Barcelona , Spain},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4529302/proceeding},
  isbn         = {978-0-7695-3102-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/IEEEares/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/aosd/2008aom,
  editor       = {Omar Aldawud and
                  Walter Cazzola and
                  Tzilla Elrad and
                  Jeff Gray and
                  J{\"{o}}rg Kienzle and
                  Dominik Stein},
  title        = {Proceedings of the 2008 {AOSD} Workshop on Aspect-Oriented Modeling,
                  {AOM} '08, Brussels, Belgium, April 1, 2008},
  publisher    = {{ACM}},
  year         = {2008},
  url          = {https://doi.org/10.1145/1404920},
  doi          = {10.1145/1404920},
  isbn         = {978-1-60558-145-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/aosd/2008aom.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cisis/2008,
  editor       = {Fatos Xhafa and
                  Leonard Barolli},
  title        = {Second International Conference on Complex, Intelligent and Software
                  Intensive Systems (CISIS-2008), March 4th-7th, 2008, Technical University
                  of Catalonia, Barcelona, Spain},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4606617/proceeding},
  isbn         = {978-0-7695-3109-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cisis/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/secrypt/2008,
  editor       = {Eduardo Fern{\'{a}}ndez{-}Medina and
                  Manu Malek and
                  Javier Hernando},
  title        = {{SECRYPT} 2008, Proceedings of the International Conference on Security
                  and Cryptography, Porto, Portugal, July 26-29, 2008, {SECRYPT} is
                  part of {ICETE} - The International Joint Conference on e-Business
                  and Telecommunications},
  publisher    = {{INSTICC} Press},
  year         = {2008},
  isbn         = {978-989-8111-59-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/secrypt/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cikm/2007,
  editor       = {M{\'{a}}rio J. Silva and
                  Alberto H. F. Laender and
                  Ricardo A. Baeza{-}Yates and
                  Deborah L. McGuinness and
                  Bj{\o}rn Olstad and
                  {\O}ystein Haug Olsen and
                  Andr{\'{e}} O. Falc{\~{a}}o},
  title        = {Proceedings of the Sixteenth {ACM} Conference on Information and Knowledge
                  Management, {CIKM} 2007, Lisbon, Portugal, November 6-10, 2007},
  publisher    = {{ACM}},
  year         = {2007},
  isbn         = {978-1-59593-803-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cikm/2007.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eurocast/2007,
  editor       = {Roberto Moreno{-}D{\'{\i}}az and
                  Franz Pichler and
                  Alexis Quesada{-}Arencibia},
  title        = {Computer Aided Systems Theory - {EUROCAST} 2007, 11th International
                  Conference on Computer Aided Systems Theory, Las Palmas de Gran Canaria,
                  Spain, February 12-16, 2007, Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {4739},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-75867-9},
  doi          = {10.1007/978-3-540-75867-9},
  isbn         = {978-3-540-75866-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/eurocast/2007.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iasam/2007,
  title        = {Conference Record of the 2007 {IEEE} Industry Applications Conference
                  Forty-Second {IAS} Annual Meeting, New Orleans, LA, USA, September
                  23-27, 2007},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4347748/proceeding},
  isbn         = {978-1-4244-1259-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iasam/2007.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ibpria/2007-1,
  editor       = {Joan Mart{\'{\i}} and
                  Jos{\'{e}}{-}Miguel Bened{\'{\i}} and
                  Ana Maria Mendon{\c{c}}a and
                  Joan Serrat},
  title        = {Pattern Recognition and Image Analysis, Third Iberian Conference,
                  IbPRIA 2007, Girona, Spain, June 6-8, 2007, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {4477},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-72847-4},
  doi          = {10.1007/978-3-540-72847-4},
  isbn         = {978-3-540-72846-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ibpria/2007-1.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icsoft/2007-2,
  editor       = {Joaquim Filipe and
                  Boris Shishkov and
                  Markus Helfert},
  title        = {{ICSOFT} 2007, Proceedings of the Second International Conference
                  on Software and Data Technologies, Volume SE, Barcelona, Spain, July
                  22-25, 2007},
  publisher    = {{INSTICC} Press},
  year         = {2007},
  isbn         = {978-989-8111-06-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/icsoft/2007-2.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/secrypt/2007,
  editor       = {Javier Hernando and
                  Eduardo Fern{\'{a}}ndez{-}Medina and
                  Manu Malek},
  title        = {{SECRYPT} 2007, Proceedings of the International Conference on Security
                  and Cryptography, Barcelona, Spain, July 28-13, 2007, {SECRYPT} is
                  part of {ICETE} - The International Joint Conference on e-Business
                  and Telecommunications},
  publisher    = {{INSTICC} Press},
  year         = {2007},
  isbn         = {978-989-8111-12-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/secrypt/2007.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sis/2007,
  editor       = {Mariemma Inmaculada Yag{\"{u}}e del Valle and
                  Eduardo Fern{\'{a}}ndez{-}Medina},
  title        = {Security in Information Systems, Proceedings of the 5th International
                  Workshop on Security in Information Systems, {WOSIS} 2007, In conjunction
                  with {ICEIS} 2007, Funchal, Madeira, Portugal, June 2007},
  publisher    = {{INSTICC} Press},
  year         = {2007},
  isbn         = {978-972-8865-96-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/2007.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/IEEEares/2006,
  title        = {Proceedings of the The First International Conference on Availability,
                  Reliability and Security, {ARES} 2006, The International Dependability
                  Conference - Bridging Theory and Practice, April 20-22 2006, Vienna
                  University of Technology, Austria},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/10823/proceeding},
  isbn         = {0-7695-2567-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/IEEEares/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acivs/2006,
  editor       = {Jacques Blanc{-}Talon and
                  Wilfried Philips and
                  Dan C. Popescu and
                  Paul Scheunders},
  title        = {Advanced Concepts for Intelligent Vision Systems, 8th International
                  Conference, {ACIVS} 2006, Antwerp, Belgium, September 18-21, 2006,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4179},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11864349},
  doi          = {10.1007/11864349},
  isbn         = {3-540-44630-3},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/acivs/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cdc/2006,
  title        = {45th {IEEE} Conference on Decision and Control, {CDC} 2006, San Diego,
                  CA, USA, December 13-15, 2006},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://doi.org/10.1109/CDC10086.2006},
  doi          = {10.1109/CDC10086.2006},
  isbn         = {1-4244-0171-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cibse/2006,
  editor       = {Jaelson Castro and
                  Luca Cernuzzi and
                  Silvia E. Gordillo},
  title        = {Memorias de la {IX} Conferenci a Iberoamericana de Software Engineering
                  (CIbSE 2006), La Plata, Argentina, Abril 24-28, 2006},
  year         = {2006},
  isbn         = {978-950-34-0360-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cibse/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/fpt/2006,
  editor       = {George A. Constantinides and
                  Wai{-}Kei Mak and
                  Phaophak Sirisuk and
                  Theerayod Wiangtong},
  title        = {2006 {IEEE} International Conference on Field Programmable Technology,
                  {FPT} 2006, Bangkok, Thailand, December 13-15, 2006},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4042379/proceeding},
  isbn         = {0-7803-9728-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/fpt/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/glvlsi/2006,
  editor       = {Gang Qu and
                  Yehea I. Ismail and
                  Narayanan Vijaykrishnan and
                  Hai Zhou},
  title        = {Proceedings of the 16th {ACM} Great Lakes Symposium on {VLSI} 2006,
                  Philadelphia, PA, USA, April 30 - May 1, 2006},
  publisher    = {{ACM}},
  year         = {2006},
  url          = {https://doi.org/10.1145/1127908},
  doi          = {10.1145/1127908},
  isbn         = {1-59593-347-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/glvlsi/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/isda/2006,
  title        = {Proceedings of the Sixth International Conference on Intelligent Systems
                  Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan,
                  China},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4021381/proceeding},
  isbn         = {0-7695-2528-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/isda/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sis/2006,
  editor       = {Eduardo Fern{\'{a}}ndez{-}Medina and
                  Mariemma Inmaculada Yag{\"{u}}e del Valle},
  title        = {Security in Information Systems, Proceedings of the 4th International
                  Workshop on Security in Information Systems, {WOSIS} 2006, In conjunction
                  with {ICEIS} 2006, Paphos, Cyprus, May 2006},
  publisher    = {{INSTICC} Press},
  year         = {2006},
  isbn         = {978-972-8865-52-8},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/sis/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wises/2006,
  editor       = {Wilfried Elmenreich and
                  Gregor Novak and
                  Ralf Seepold},
  title        = {4th International Workshop on Intelligent Solutions in Embedded Systems,
                  {WISES} 2006, Vienna, Austria, June 30, 2006},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4125753/proceeding},
  isbn         = {3-902463-06-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/wises/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/acivs/2005,
  editor       = {Jacques Blanc{-}Talon and
                  Wilfried Philips and
                  Dan C. Popescu and
                  Paul Scheunders},
  title        = {Advanced Concepts for Intelligent Vision Systems, 7th International
                  Conference, {ACIVS} 2005, Antwerp, Belgium, September 20-23, 2005,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3708},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11558484},
  doi          = {10.1007/11558484},
  isbn         = {3-540-29032-X},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/acivs/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/bvai/2005,
  editor       = {Massimo De Gregorio and
                  Vito Di Maio and
                  Maria Frucci and
                  Carlo Musio},
  title        = {Brain, Vision, and Artificial Intelligence, First International Symposium,
                  {BVAI} 2005, Naples, Italy, October 19-21, 2005, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3704},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11565123},
  doi          = {10.1007/11565123},
  isbn         = {3-540-29282-9},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/bvai/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cdc/2005,
  title        = {44th {IEEE} {IEEE} Conference on Decision and Control and 8th European
                  Control Conference Control, {CDC/ECC} 2005, Seville, Spain, 12-15
                  December, 2005},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/CDC-ECC7191.2005},
  doi          = {10.1109/CDC-ECC7191.2005},
  isbn         = {0-7803-9567-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/egc/2005,
  editor       = {Peter M. A. Sloot and
                  Alfons G. Hoekstra and
                  Thierry Priol and
                  Alexander Reinefeld and
                  Marian Bubak},
  title        = {Advances in Grid Computing - {EGC} 2005, European Grid Conference,
                  Amsterdam, The Netherlands, February 14-16, 2005, Revised Selected
                  Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {3470},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/b137919},
  doi          = {10.1007/B137919},
  isbn         = {3-540-26918-5},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/egc/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ijcai/2005,
  editor       = {Leslie Pack Kaelbling and
                  Alessandro Saffiotti},
  title        = {IJCAI-05, Proceedings of the Nineteenth International Joint Conference
                  on Artificial Intelligence, Edinburgh, Scotland, UK, July 30 - August
                  5, 2005},
  publisher    = {Professional Book Center},
  year         = {2005},
  url          = {http://ijcai.org/proceedings/2005},
  isbn         = {0938075934},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ijcai/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/idea/Ency05,
  editor       = {Mehdi Khosrow{-}Pour},
  title        = {Encyclopedia of Information Science and Technology {(5} Volumes)},
  publisher    = {Idea Group},
  year         = {2005},
  isbn         = {1-59140-553-X},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/books/idea/Ency05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/wscg/2004,
  title        = {The 12-th International Conference in Central Europe on Computer Graphics,
                  Visualization and Computer Vision'2004, {WSCG} 2004, University of
                  West Bohemia, Campus Bory, Plzen-Bory, Czech Republic, February 2-6,
                  2004},
  year         = {2004},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/wscg/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/eagc/2003,
  editor       = {Francisco Fernandez Rivera and
                  Marian Bubak and
                  Andr{\'{e}}s G{\'{o}}mez{-}Tato and
                  Ramon Doallo},
  title        = {Grid Computing, First European Across Grids Conference, Santiago de
                  Compostela, Spain, February 13-14, 2003, Revised Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {2970},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/b95647},
  doi          = {10.1007/B95647},
  isbn         = {3-540-21048-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/eagc/2003.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscas/2002,
  title        = {Proceedings of the 2002 International Symposium on Circuits and Systems,
                  {ISCAS} 2002, Scottsdale, Arizona, USA, May 26-29, 2002},
  publisher    = {{IEEE}},
  year         = {2002},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7897/proceeding},
  isbn         = {0-7803-7448-7},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/2002.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iciap/2001,
  title        = {11th International Conference on Image Analysis and Processing {(ICIAP}
                  2001), 26-28 September 2001, Palermo, Italy},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/7583/proceeding},
  isbn         = {0-7695-1183-X},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iciap/2001.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/infocom/1999,
  title        = {Proceedings {IEEE} {INFOCOM} '99, The Conference on Computer Communications,
                  Eighteenth Annual Joint Conference of the {IEEE} Computer and Communications
                  Societies, The Future Is Now, New York, NY, USA, March 21-25, 1999},
  publisher    = {{IEEE} Computer Society},
  year         = {1999},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6063/proceeding},
  isbn         = {0-7803-5417-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/infocom/1999.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iscas/1999,
  title        = {Proceedings of the 1999 International Symposium on Circuits and Systems,
                  {ISCAS} 1999, Orlando, Florida, USA, May 30 - June 2, 1999},
  publisher    = {{IEEE}},
  year         = {1999},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/6311/proceeding},
  isbn         = {0-7803-5471-0},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/iscas/1999.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ppdp/1999,
  editor       = {Gopalan Nadathur},
  title        = {Principles and Practice of Declarative Programming, International
                  Conference PPDP'99, Paris, France, September 29 - October 1, 1999,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1702},
  publisher    = {Springer},
  year         = {1999},
  url          = {https://doi.org/10.1007/10704567},
  doi          = {10.1007/10704567},
  isbn         = {3-540-66540-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/ppdp/1999.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/plilp/1998,
  editor       = {Catuscia Palamidessi and
                  Hugh Glaser and
                  Karl Meinke},
  title        = {Principles of Declarative Programming, 10th International Symposium,
                  PLILP'98 Held Jointly with the 7th International Conference, ALP'98,
                  Pisa, Italy, September 16-18, 1998, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1490},
  publisher    = {Springer},
  year         = {1998},
  url          = {https://doi.org/10.1007/BFb0056603},
  doi          = {10.1007/BFB0056603},
  isbn         = {3-540-65012-1},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/plilp/1998.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/slp/1997,
  editor       = {Jan Maluszynski},
  title        = {Logic Programming, Proceedings of the 1997 International Symposium,
                  Port Jefferson, Long Island, NY, USA, October 13-16, 1997},
  publisher    = {{MIT} Press},
  year         = {1997},
  isbn         = {0-262-63180-6},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/slp/1997.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/tapsoft/1997,
  editor       = {Michel Bidoit and
                  Max Dauchet},
  title        = {TAPSOFT'97: Theory and Practice of Software Development, 7th International
                  Joint Conference CAAP/FASE, Lille, France, April 14-18, 1997, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {1214},
  publisher    = {Springer},
  year         = {1997},
  url          = {https://doi.org/10.1007/BFb0030581},
  doi          = {10.1007/BFB0030581},
  isbn         = {3-540-62781-2},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/tapsoft/1997.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/time/1996,
  editor       = {Luca Chittaro and
                  Scott D. Goodwin and
                  Howard J. Hamilton and
                  Angelo Montanari},
  title        = {Proceedings of the Third International Workshop on Temporal Representation
                  and Reasoning, TIME-96, Key West, Florida, USA, May 19-20, 1996},
  publisher    = {{IEEE} Computer Society},
  year         = {1996},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/4105/proceeding},
  isbn         = {0-8186-7528-4},
  timestamp    = {Mon, 07 Oct 2024 01:30:40 +0200},
  biburl       = {https://dblp.org/rec/conf/time/1996.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}